Basic Information | |
---|---|
Family ID | F066272 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 43 residues |
Representative Sequence | MLNDFITVANLLQPGPGYGTTPQDDTAWYTALSASNITVS |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.51 % |
% of genes near scaffold ends (potentially truncated) | 91.34 % |
% of genes from short scaffolds (< 2000 bps) | 83.46 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.181 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (21.260 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.795 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.118 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF08044 | DUF1707 | 6.30 |
PF06831 | H2TH | 4.72 |
PF02720 | DUF222 | 3.94 |
PF03816 | LytR_cpsA_psr | 3.15 |
PF13419 | HAD_2 | 3.15 |
PF00582 | Usp | 2.36 |
PF00578 | AhpC-TSA | 2.36 |
PF02607 | B12-binding_2 | 2.36 |
PF13857 | Ank_5 | 1.57 |
PF04075 | F420H2_quin_red | 1.57 |
PF13731 | WxL | 1.57 |
PF00440 | TetR_N | 1.57 |
PF02350 | Epimerase_2 | 1.57 |
PF12728 | HTH_17 | 1.57 |
PF01850 | PIN | 1.57 |
PF13692 | Glyco_trans_1_4 | 1.57 |
PF00291 | PALP | 1.57 |
PF01047 | MarR | 1.57 |
PF01370 | Epimerase | 1.57 |
PF04149 | DUF397 | 0.79 |
PF03055 | RPE65 | 0.79 |
PF12796 | Ank_2 | 0.79 |
PF00535 | Glycos_transf_2 | 0.79 |
PF04434 | SWIM | 0.79 |
PF13302 | Acetyltransf_3 | 0.79 |
PF01180 | DHO_dh | 0.79 |
PF00872 | Transposase_mut | 0.79 |
PF00005 | ABC_tran | 0.79 |
PF00877 | NLPC_P60 | 0.79 |
PF01638 | HxlR | 0.79 |
PF03721 | UDPG_MGDP_dh_N | 0.79 |
PF12773 | DZR | 0.79 |
PF00296 | Bac_luciferase | 0.79 |
PF02310 | B12-binding | 0.79 |
PF10442 | FIST_C | 0.79 |
PF13193 | AMP-binding_C | 0.79 |
PF13365 | Trypsin_2 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 4.72 |
COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 3.15 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.57 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.57 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.79 |
COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.79 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.79 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.79 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.79 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.79 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.79 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.79 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.79 |
COG3670 | Carotenoid cleavage dioxygenase or a related enzyme | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.79 |
COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.79 |
COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.18 % |
All Organisms | root | All Organisms | 48.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10060063 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300001356|JGI12269J14319_10071105 | Not Available | 1914 | Open in IMG/M |
3300001356|JGI12269J14319_10162335 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300001413|JGI20180J14839_1010208 | Not Available | 631 | Open in IMG/M |
3300005436|Ga0070713_102056822 | Not Available | 554 | Open in IMG/M |
3300005541|Ga0070733_10441692 | Not Available | 868 | Open in IMG/M |
3300005591|Ga0070761_10001261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15970 | Open in IMG/M |
3300005602|Ga0070762_10133700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1469 | Open in IMG/M |
3300005921|Ga0070766_10373399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. HLT2-17 | 930 | Open in IMG/M |
3300005995|Ga0066790_10316855 | Not Available | 665 | Open in IMG/M |
3300009029|Ga0066793_10240522 | Not Available | 1051 | Open in IMG/M |
3300009520|Ga0116214_1439287 | Not Available | 511 | Open in IMG/M |
3300009521|Ga0116222_1287157 | Not Available | 710 | Open in IMG/M |
3300009521|Ga0116222_1465619 | Not Available | 552 | Open in IMG/M |
3300009521|Ga0116222_1508930 | Not Available | 527 | Open in IMG/M |
3300009522|Ga0116218_1332069 | Not Available | 680 | Open in IMG/M |
3300009552|Ga0116138_1129093 | Not Available | 698 | Open in IMG/M |
3300009628|Ga0116125_1125410 | Not Available | 700 | Open in IMG/M |
3300009645|Ga0116106_1307094 | Not Available | 505 | Open in IMG/M |
3300009683|Ga0116224_10272015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
3300009698|Ga0116216_10019295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 4277 | Open in IMG/M |
3300009698|Ga0116216_10906022 | Not Available | 528 | Open in IMG/M |
3300009700|Ga0116217_10137923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1638 | Open in IMG/M |
3300009824|Ga0116219_10228684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1060 | Open in IMG/M |
3300010361|Ga0126378_13096488 | Not Available | 529 | Open in IMG/M |
3300010379|Ga0136449_100433164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2316 | Open in IMG/M |
3300010379|Ga0136449_100600332 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
3300010379|Ga0136449_102397454 | Not Available | 761 | Open in IMG/M |
3300010379|Ga0136449_103591340 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300010876|Ga0126361_11152491 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300010880|Ga0126350_11365736 | Not Available | 573 | Open in IMG/M |
3300012356|Ga0137371_10436119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1014 | Open in IMG/M |
3300014159|Ga0181530_10314159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300014165|Ga0181523_10239600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
3300014493|Ga0182016_10652605 | Not Available | 594 | Open in IMG/M |
3300014501|Ga0182024_12109406 | Not Available | 620 | Open in IMG/M |
3300014838|Ga0182030_10143478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3065 | Open in IMG/M |
3300014838|Ga0182030_11040346 | Not Available | 716 | Open in IMG/M |
3300017926|Ga0187807_1012480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2611 | Open in IMG/M |
3300017928|Ga0187806_1016971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2082 | Open in IMG/M |
3300017928|Ga0187806_1181620 | Not Available | 706 | Open in IMG/M |
3300017932|Ga0187814_10016780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2785 | Open in IMG/M |
3300017932|Ga0187814_10048299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1568 | Open in IMG/M |
3300017932|Ga0187814_10155779 | Not Available | 852 | Open in IMG/M |
3300017933|Ga0187801_10099359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300017942|Ga0187808_10182487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
3300017946|Ga0187879_10138729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
3300017946|Ga0187879_10383811 | Not Available | 778 | Open in IMG/M |
3300017948|Ga0187847_10227094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1017 | Open in IMG/M |
3300017970|Ga0187783_11079902 | Not Available | 578 | Open in IMG/M |
3300018001|Ga0187815_10371565 | Not Available | 608 | Open in IMG/M |
3300018035|Ga0187875_10388450 | Not Available | 747 | Open in IMG/M |
3300018035|Ga0187875_10470425 | Not Available | 668 | Open in IMG/M |
3300018037|Ga0187883_10266659 | Not Available | 875 | Open in IMG/M |
3300018037|Ga0187883_10317690 | Not Available | 796 | Open in IMG/M |
3300018037|Ga0187883_10472773 | Not Available | 645 | Open in IMG/M |
3300018038|Ga0187855_10145606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1415 | Open in IMG/M |
3300018042|Ga0187871_10080625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1898 | Open in IMG/M |
3300018043|Ga0187887_10528320 | Not Available | 696 | Open in IMG/M |
3300018044|Ga0187890_10704737 | Not Available | 570 | Open in IMG/M |
3300018047|Ga0187859_10702248 | Not Available | 575 | Open in IMG/M |
3300018062|Ga0187784_10870830 | Not Available | 717 | Open in IMG/M |
3300018086|Ga0187769_10309801 | Not Available | 1181 | Open in IMG/M |
3300018086|Ga0187769_11088945 | Not Available | 605 | Open in IMG/M |
3300018090|Ga0187770_10462949 | Not Available | 1001 | Open in IMG/M |
3300019787|Ga0182031_1088006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
3300021407|Ga0210383_10560485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
3300021474|Ga0210390_10024999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4866 | Open in IMG/M |
3300021474|Ga0210390_10448058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. HLT2-17 | 1089 | Open in IMG/M |
3300023101|Ga0224557_1080584 | Not Available | 1380 | Open in IMG/M |
3300025527|Ga0208714_1007131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2988 | Open in IMG/M |
3300025625|Ga0208219_1067403 | Not Available | 853 | Open in IMG/M |
3300027002|Ga0209110_1050463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300027058|Ga0209111_1044879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300027096|Ga0208099_1008705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1315 | Open in IMG/M |
3300027110|Ga0208488_1023777 | Not Available | 1166 | Open in IMG/M |
3300027568|Ga0208042_1018283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1810 | Open in IMG/M |
3300027604|Ga0208324_1000564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16668 | Open in IMG/M |
3300027853|Ga0209274_10505108 | Not Available | 626 | Open in IMG/M |
3300027895|Ga0209624_10260923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
3300027908|Ga0209006_11032828 | Not Available | 652 | Open in IMG/M |
3300028566|Ga0302147_10300908 | Not Available | 532 | Open in IMG/M |
3300028781|Ga0302223_10326794 | Not Available | 508 | Open in IMG/M |
3300028808|Ga0302228_10457247 | Not Available | 564 | Open in IMG/M |
3300029882|Ga0311368_10039481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4403 | Open in IMG/M |
3300029907|Ga0311329_10070251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2985 | Open in IMG/M |
3300029910|Ga0311369_11281898 | Not Available | 561 | Open in IMG/M |
3300029943|Ga0311340_10613921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
3300029944|Ga0311352_10520250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
3300029951|Ga0311371_12478579 | Not Available | 529 | Open in IMG/M |
3300029999|Ga0311339_10494970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
3300029999|Ga0311339_11715152 | Not Available | 549 | Open in IMG/M |
3300030007|Ga0311338_10039375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6472 | Open in IMG/M |
3300030013|Ga0302178_10045690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2435 | Open in IMG/M |
3300030013|Ga0302178_10445579 | Not Available | 571 | Open in IMG/M |
3300030053|Ga0302177_10693734 | Not Available | 516 | Open in IMG/M |
3300030054|Ga0302182_10122928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300030494|Ga0310037_10003013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 8626 | Open in IMG/M |
3300030494|Ga0310037_10127720 | Not Available | 1165 | Open in IMG/M |
3300030494|Ga0310037_10193529 | Not Available | 905 | Open in IMG/M |
3300030520|Ga0311372_11614813 | Not Available | 789 | Open in IMG/M |
3300030617|Ga0311356_10201451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2034 | Open in IMG/M |
3300030622|Ga0265391_10320092 | Not Available | 522 | Open in IMG/M |
3300030677|Ga0302317_10525711 | Not Available | 513 | Open in IMG/M |
3300030707|Ga0310038_10063605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2031 | Open in IMG/M |
3300030738|Ga0265462_10821125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 763 | Open in IMG/M |
3300030741|Ga0265459_11062828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
3300030906|Ga0302314_11606352 | Not Available | 580 | Open in IMG/M |
3300031234|Ga0302325_10186936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3601 | Open in IMG/M |
3300031234|Ga0302325_11380828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300031236|Ga0302324_100031969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9908 | Open in IMG/M |
3300031236|Ga0302324_100916022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1203 | Open in IMG/M |
3300031525|Ga0302326_12366504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
3300031525|Ga0302326_13433067 | Not Available | 528 | Open in IMG/M |
3300031708|Ga0310686_108685759 | Not Available | 1162 | Open in IMG/M |
3300031708|Ga0310686_113908158 | Not Available | 637 | Open in IMG/M |
3300031759|Ga0316219_1307504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 542 | Open in IMG/M |
3300031823|Ga0307478_11113922 | Not Available | 658 | Open in IMG/M |
3300032160|Ga0311301_10461847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1905 | Open in IMG/M |
3300032160|Ga0311301_10469608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1883 | Open in IMG/M |
3300032160|Ga0311301_10547791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1692 | Open in IMG/M |
3300032160|Ga0311301_10619498 | Not Available | 1552 | Open in IMG/M |
3300032783|Ga0335079_11224677 | Not Available | 754 | Open in IMG/M |
3300032895|Ga0335074_10184509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486 | 2574 | Open in IMG/M |
3300033158|Ga0335077_11602860 | Not Available | 619 | Open in IMG/M |
3300033818|Ga0334804_088024 | Not Available | 822 | Open in IMG/M |
3300034065|Ga0334827_190055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 21.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 18.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.15% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.15% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.36% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.36% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.36% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.57% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.79% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030622 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_100600631 | 3300001356 | Peatlands Soil | AAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITIS* |
JGI12269J14319_100711051 | 3300001356 | Peatlands Soil | PRRLGHMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRATNITIT* |
JGI12269J14319_101623352 | 3300001356 | Peatlands Soil | VLAGLLQPGAHYGTTAQDYTAWYTALRATNITIA* |
JGI20180J14839_10102082 | 3300001413 | Arctic Peat Soil | MLNDYITVANLLQPGPGYGTTPQDYAAWNAAMNASNISVS* |
Ga0070713_1020568222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QMLHKFITVANLLQPGAGYGTTAQDYTAWYAAMRASNITVW* |
Ga0070733_104416921 | 3300005541 | Surface Soil | PTEHRAAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITVA* |
Ga0070761_100012611 | 3300005591 | Soil | DFITVANLLQPGPDYGTTPQDYTAWNTALKASDITVW* |
Ga0070762_101337002 | 3300005602 | Soil | PALLPAVHRAEYTTMLNDFITVANLLQPGQGYGTTPQDYTAWYAALHASNITVA* |
Ga0070766_103733992 | 3300005921 | Soil | RAAYKQMLKDFITVANLLQPGPGYGTTPQDDVAWNTAMKASNITVW* |
Ga0066790_103168551 | 3300005995 | Soil | LNDFVTMANLLQPGAGYGTTPQDYVAWYQALHASNITVY* |
Ga0066793_102405222 | 3300009029 | Prmafrost Soil | QAAYKQMLNDFVTMANLLQPGPGYGTTPQDYVAWYQALHASNITVY* |
Ga0116214_14392871 | 3300009520 | Peatlands Soil | MLNDFITMADMLQPGAHYGTTAQDYTAWYTALRASNITVA* |
Ga0116222_12871571 | 3300009521 | Peatlands Soil | AVHRAAYVSMLNDFITVASMLQPGAHYGTTPQDYTAWYTALRASNITVA* |
Ga0116222_14656191 | 3300009521 | Peatlands Soil | LNDFIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW* |
Ga0116222_15089301 | 3300009521 | Peatlands Soil | LPAVHRAAYVSMLNDFITVASMLQPGAHYGTTPQDYTAWYTALRASNITVA* |
Ga0116218_13320692 | 3300009522 | Peatlands Soil | FITVANMLQPGAHYGTTPQDYTAWYTALRASNITVA* |
Ga0116138_11290931 | 3300009552 | Peatland | TVNRAGYQQMLNDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNVNVS* |
Ga0116125_11254101 | 3300009628 | Peatland | KRMLNDFITVANLLQPGPGYGTTHQDYVAWYKALNASNITVY* |
Ga0116106_13070942 | 3300009645 | Peatland | DFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNVNVS* |
Ga0116224_102720151 | 3300009683 | Peatlands Soil | IVANLLQPGPGYGTTPQDYTAWYTALQASNITIW* |
Ga0116216_100192951 | 3300009698 | Peatlands Soil | HRAAYVSMLNDFITVANILQPGAHYGTTPQDYTAWYTALRASNITVA* |
Ga0116216_109060221 | 3300009698 | Peatlands Soil | THHRAAYQHMLNDFIIVANLLQPGPGYGTTPQDYTAWYTALKASNITIW* |
Ga0116217_101379232 | 3300009700 | Peatlands Soil | ITVASMLQPGAHYGTTPQDYTAWYTALRASNITVA* |
Ga0116219_102286841 | 3300009824 | Peatlands Soil | HMLNDFIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW* |
Ga0126378_130964882 | 3300010361 | Tropical Forest Soil | HRAAYRAMLHDFITLANLLQPGPGYGTTAQDYTAWYTALRASNITVA* |
Ga0136449_1004331643 | 3300010379 | Peatlands Soil | LPATHRAAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITVA* |
Ga0136449_1006003321 | 3300010379 | Peatlands Soil | MLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITIS* |
Ga0136449_1023974541 | 3300010379 | Peatlands Soil | AAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRATDITIS* |
Ga0136449_1035913402 | 3300010379 | Peatlands Soil | VLAGLLQPGAHYGTTAQDYTAWYTALRATNITIS* |
Ga0126361_111524912 | 3300010876 | Boreal Forest Soil | HLAAYKGMPNDFIVVANLLQPGPGYGTTAQDYKAWYAALRASNISLS* |
Ga0126350_113657362 | 3300010880 | Boreal Forest Soil | FIVVANLLQPGPGYGTTPQDYTAWNTALRASNITVW* |
Ga0137371_104361192 | 3300012356 | Vadose Zone Soil | AAYKRMLNKFIIVANMLQPGPDYGTTAQDYAAWYAAMRASNITVW* |
Ga0181530_103141591 | 3300014159 | Bog | GYEQMLNDYIVVANLLQPGPGYGTRAQDEAAWAVAMNASDINVS* |
Ga0181523_102396003 | 3300014165 | Bog | VDRARYEQMLNDFIVVANLLQPGPDYGTTAQDDAAWAAAMNASNINVS* |
Ga0182016_106526052 | 3300014493 | Bog | VVANLLQPGPDYGTTAQDDAAWAVAMNASNINVS* |
Ga0182024_121094062 | 3300014501 | Permafrost | YKAMLTDFVTVANLLQPGPGYGTTPQDYTAWYTALHASNITVY* |
Ga0182030_101434783 | 3300014838 | Bog | PATNRGGYERMLKDFIVVANLLQPGPDYGTTAQDDTAWYTALSASNITVA* |
Ga0182030_110403462 | 3300014838 | Bog | RAAYTAMLTDFVTVANLLQPGADYGTTPQDYTAWYQALHASNITVY* |
Ga0187807_10124803 | 3300017926 | Freshwater Sediment | VNRAAYQHLLTDYIVVASLLQPGPGYGATPQDDTAWNAAMNASNI |
Ga0187806_10169714 | 3300017928 | Freshwater Sediment | THTNLLPTTGRAAYVTMLNDFITLANMLQPGAHYGTTAQDYTAWYTALRATNITVA |
Ga0187806_11816202 | 3300017928 | Freshwater Sediment | PALLPTQHRAAYVTILNDFITVANMLQPGADYGTTAQDYTAWYTALRASNITVA |
Ga0187814_100167801 | 3300017932 | Freshwater Sediment | NDFITVANMLQPGADYGTTAQDYTAWYTALRASNITVA |
Ga0187814_100482993 | 3300017932 | Freshwater Sediment | GRAAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRATNITVA |
Ga0187814_101557792 | 3300017932 | Freshwater Sediment | GRAAYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0187801_100993593 | 3300017933 | Freshwater Sediment | LNDFITVANMLQPGADYGTTAQDYTAWYTALRASNITVA |
Ga0187808_101824871 | 3300017942 | Freshwater Sediment | HRAAYVTMLNDFITVANMLQPGADYGTTAQDYTAWYTALRASNITVA |
Ga0187879_101387293 | 3300017946 | Peatland | LLPTVNRAGYQQMLNDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNVNVS |
Ga0187879_103838111 | 3300017946 | Peatland | NDFITVANLLQPGPGYGTTPQDDTAWNIALAASNIIVS |
Ga0187847_102270942 | 3300017948 | Peatland | LPTVNQAAHKRILNDFITLANLLQPGPGYGTTAQDYTAWYKALNASNINVS |
Ga0187783_110799021 | 3300017970 | Tropical Peatland | NDFITVANLLQPGPGYGTTTQDYTAWYTALRASNITIS |
Ga0187815_103715652 | 3300018001 | Freshwater Sediment | AAYVSMLNDFITLANMLQPGARYGTTAQDYTAWYTALRASNITVA |
Ga0187875_103884501 | 3300018035 | Peatland | KFITVADLLQPGAGYGTTAQDYAAWYDAMRASNITVW |
Ga0187875_104704252 | 3300018035 | Peatland | FITVANLLQPGPRYGTTPQDDTAWNTALAASNLTVS |
Ga0187883_102666592 | 3300018037 | Peatland | NDFITVANLLQPGPGYGTTPQDDTAWYTALAASNITVA |
Ga0187883_103176901 | 3300018037 | Peatland | MLHKFSTVADLLQPGAGYGTTSQDYTAWWAALNASNITVS |
Ga0187883_104727732 | 3300018037 | Peatland | HQAAYKTMLNDFITVANLLQPGPGYGTTPQDDTAWYTALSASNITVS |
Ga0187855_101456061 | 3300018038 | Peatland | KTMLNDFITVANLLQPGPGYGTTPQDDTAWYTALAASNITVA |
Ga0187871_100806252 | 3300018042 | Peatland | MLKDFIVVANLLQPGPGYGTTAQDDTAWYAALSASNINVS |
Ga0187887_105283202 | 3300018043 | Peatland | YKVMLNDFITVANLLQPGPGYGTTPQDDTAWNTALAASNIIVA |
Ga0187890_107047371 | 3300018044 | Peatland | YEGMLNDFTVVANLLQPGPGYGTTPQDYAAWDMAMHATNINVS |
Ga0187859_107022481 | 3300018047 | Peatland | TVHRAAYKVMLNDFITVANLLQPGPGYGTTPQDDTAWNTALAASNIIVA |
Ga0187784_108708302 | 3300018062 | Tropical Peatland | FITVADMLQPGPHYGTTAQDYTAWYTALRASNITIS |
Ga0187769_103098011 | 3300018086 | Tropical Peatland | LADPALLPAVHRAAYVTMLNDFITVANMLQPGPQYGTTAQDYTAWYAALRASNITVA |
Ga0187769_110889451 | 3300018086 | Tropical Peatland | DFITVANMLQPGPQYGTTAQDYTAWYAALRASNITIS |
Ga0187770_104629491 | 3300018090 | Tropical Peatland | ATGRAAYRVMLDDFITVADMLQPGPDYGTTAQDYTAWYTALRASNITVS |
Ga0182031_10880063 | 3300019787 | Bog | TPALLPAHNRAAYTAMLTDFVTVANLLQPGADYGTTPQDYTAWYQALHASNITVY |
Ga0210383_105604852 | 3300021407 | Soil | AYVTMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0210390_100249996 | 3300021474 | Soil | RAAYQAMLTDFITLASILQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0210390_104480581 | 3300021474 | Soil | MLKDFITVANLLQPGPDYGTTPQDDAAWNTAMKASDITVW |
Ga0224557_10805841 | 3300023101 | Soil | NRAAYTAMLTDFVTVANLLQPGADYGTTPQDYTAWYQALHASNITVY |
Ga0208714_10071312 | 3300025527 | Arctic Peat Soil | MLNDYITVANLLQPGPGYGTTPQDYAAWNAAMNASNISVS |
Ga0208219_10674032 | 3300025625 | Arctic Peat Soil | LNDFITVANLLQPGPGYGTTAQDYTAWYKALHATNINVS |
Ga0209110_10504632 | 3300027002 | Forest Soil | NRAAYRQMLTDFITVANLLQPGPGYGTTGQDWDAWNTALAATNITVS |
Ga0209111_10448792 | 3300027058 | Forest Soil | LLPTVNRAGYEEMLRDFITVANLLQPGSGYGTTAQDWAAWNTALAASNIIVS |
Ga0208099_10087053 | 3300027096 | Forest Soil | ERMLNDFIRVANLLQPGPGYGTTSQDDTAWDAALIASNITVT |
Ga0208488_10237771 | 3300027110 | Forest Soil | VNRAAYKRMLNDFITVANLLQPGPGYGTTPQDDTAWYTALAASNLTVA |
Ga0208042_10182833 | 3300027568 | Peatlands Soil | YQHMLNDVIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW |
Ga0208324_10005641 | 3300027604 | Peatlands Soil | QHMLNDFIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW |
Ga0209274_105051081 | 3300027853 | Soil | DFISLAALLQPGAHYGTTAQDYTAWYTALRATNITVA |
Ga0209624_102609232 | 3300027895 | Forest Soil | QTMLNDFITVANLLQPGPGYGTTPQDYTAWYAALHASDITVA |
Ga0209006_110328282 | 3300027908 | Forest Soil | FITVANLLQPGPGYGTTPQDDTAWNTALAASNLTVS |
Ga0302147_103009081 | 3300028566 | Bog | EQMLDDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNINVS |
Ga0302223_103267942 | 3300028781 | Palsa | ITVANLLQPGPGYGTTAQDYTAWYKALNASNINVS |
Ga0302228_104572472 | 3300028808 | Palsa | RFITVADMLQPGADYGTTSQDYTAWWAALNASDIAVS |
Ga0311368_100394815 | 3300029882 | Palsa | MLKDFITVANLLQPGPGYGTTPQDDTAWYAALSASNVTVA |
Ga0311329_100702515 | 3300029907 | Bog | MLDDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNINVS |
Ga0311369_112818981 | 3300029910 | Palsa | YKLMLKDFITVANLLQPGPGYGTTPQDDTAWYAALSASNVTVA |
Ga0311340_106139212 | 3300029943 | Palsa | LNDFITVANLLQPGPGYGTTPQDDTAWYAALSASNITVS |
Ga0311352_105202502 | 3300029944 | Palsa | YERMLNDFITVANLLQPGPGYGTTTQDDTAWNAALTASNIIVT |
Ga0311371_124785791 | 3300029951 | Palsa | YKVMLNDFITVANLLQPGPGYGTTPQDDTAWYAALGASNITVA |
Ga0311339_104949701 | 3300029999 | Palsa | YKTMLNDFITVANLLQPGPGYGTTPQDDTAWNTALAASNITVS |
Ga0311339_117151521 | 3300029999 | Palsa | MLNDYITVANLLQPDPGYGSTPQDDTAWYAALSASNITVA |
Ga0311338_100393751 | 3300030007 | Palsa | TVNRAAYKVMLNDFITVANLLQPGPGYGTTPQDDTAWYAALAASNITVA |
Ga0302178_100456904 | 3300030013 | Palsa | ATPALLPAVHQAAYKTMLNDFITVANLLQPGPGYGTTPQDDTAWFAALAASNITVS |
Ga0302178_104455793 | 3300030013 | Palsa | QGAYKVMLNDFITVANLLQPGPGYGTTPQDDTAWYAALSASNITVS |
Ga0302177_106937341 | 3300030053 | Palsa | RARYERMLKDFIVVADLLQPGPGYGTTAQDNTAWYAALNASNITVS |
Ga0302182_101229282 | 3300030054 | Palsa | PALLPTVNRAGYEQMLNDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNINVS |
Ga0310037_100030131 | 3300030494 | Peatlands Soil | MLNDFIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW |
Ga0310037_101277202 | 3300030494 | Peatlands Soil | HRAAYVSMLNDFITVANMLQPGAHYGTTPQDYTAWYTALRASNITVA |
Ga0310037_101935292 | 3300030494 | Peatlands Soil | MLNDFITVANMLQPGARYGTTAQDYTAWYTALRATNITIS |
Ga0311372_116148131 | 3300030520 | Palsa | MLNDFITVANLLQPGPGYGTTPQDDTAWYTALSASNITVS |
Ga0311356_102014511 | 3300030617 | Palsa | FITVANLLQPGPGYGTTPQDDTAWYAALAASNITVA |
Ga0265391_103200921 | 3300030622 | Soil | PALLPTEHRAAHVTKLNDFNNDANILQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0302317_105257111 | 3300030677 | Palsa | LLPTVNRAAYRQMLHRFITVADMLQPGADYGTTSQDYTAWWAALNASDIAVS |
Ga0310038_100636051 | 3300030707 | Peatlands Soil | HMLNDFIIVANLLQPGPGYGTTPQDYTAWYTALQASNITIW |
Ga0265462_108211251 | 3300030738 | Soil | DFITVANILQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0265459_110628281 | 3300030741 | Soil | HHAAYVTMLNDFITVANILQPGAHYGTTAQDYTAWYTALRASNITVA |
Ga0302314_116063523 | 3300030906 | Palsa | AGYEQMLNDFIVVANLLQPGPDYGTTAQDDAAWAAAMNASNINVS |
Ga0302325_101869365 | 3300031234 | Palsa | VNRAGYEQMLDDFIVVANLLQPGPDYGTTAQDDAAWAVAMNASNINVS |
Ga0302325_113808282 | 3300031234 | Palsa | DFITVANLLQPGPGYGTTPQDDTAWYAALSASNITVS |
Ga0302324_10003196910 | 3300031236 | Palsa | MLNDFITVANLLQPGPGYGTTPQDDTAWYAALAASNITVA |
Ga0302324_1009160221 | 3300031236 | Palsa | VNRARYERMLKDFIVVADLLQPGPGYGTTAQDNTAWYAALNASNITVS |
Ga0302326_123665041 | 3300031525 | Palsa | TMLNDFITVANLLQPGPGYGTTPQDDTAWYTALAASNITVA |
Ga0302326_134330672 | 3300031525 | Palsa | YKTMLNDFITVANLLQPGPGYGTTPQDDTAWYTALAASNITVS |
Ga0310686_1086857592 | 3300031708 | Soil | LPTEHLVAYVTMLNDFITLAGLLQPGAHYGTTAHDYTAWYTALRATNITVA |
Ga0310686_1139081582 | 3300031708 | Soil | AAYQTMLTDFINLASLLQPGTHYGTTAQDYTAWYTALRATNITVA |
Ga0316219_13075041 | 3300031759 | Freshwater | MLDDFITVANLLQPGPGYGTTPQDYTAWYAALHASNINVA |
Ga0307478_111139221 | 3300031823 | Hardwood Forest Soil | AAYVTMLNDFITLANMLQPGAHYGTTAQDYTAWYTALRATNITVA |
Ga0311301_104618472 | 3300032160 | Peatlands Soil | PATHRAAYVTMLNDFITVANMLQPGAGYGTTAQDYTAWYTALRATNITVA |
Ga0311301_104696081 | 3300032160 | Peatlands Soil | AAYLSMLNDFITVANMLQPGAHYGTTAQDYTAWYTALRASNITIA |
Ga0311301_105477912 | 3300032160 | Peatlands Soil | FITVANMLQPGAHYGTTPQDYTAWYTALRASNITVA |
Ga0311301_106194981 | 3300032160 | Peatlands Soil | GRSAYVTMLTDFITVANLLQPGARYGTTAQDYTAWYTALRATNITIS |
Ga0335079_112246772 | 3300032783 | Soil | MLKDFIVVANLLQPGPGYGTTPQDYAAWDVAMRASNITVS |
Ga0335074_101845093 | 3300032895 | Soil | DFITVANLLQPGPGYGTTAQDYTAWYAALHASNINVA |
Ga0335077_116028601 | 3300033158 | Soil | GQAAYKLMLNDFITVANLLQPGPGYGTTPQDDTAWYAALSASNITVA |
Ga0334804_088024_705_821 | 3300033818 | Soil | TDFVTVANLLQPGADYGTTPQDYTAWYQALHASNITIY |
Ga0334827_190055_6_128 | 3300034065 | Soil | MLKDFIVVANLLQPGPDYGTTAQDTTAWYTALSASNITVA |
⦗Top⦘ |