Basic Information | |
---|---|
Family ID | F066092 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 43 residues |
Representative Sequence | MLECLAEGMSLEDIDQSFDHAFPHEALPEVLKVASELADSFHVAA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.02 % |
% of genes near scaffold ends (potentially truncated) | 78.74 % |
% of genes from short scaffolds (< 2000 bps) | 80.31 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.039 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (16.535 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.157 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (34.646 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.73% β-sheet: 0.00% Coil/Unstructured: 60.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF02604 | PhdYeFM_antitox | 5.51 |
PF04255 | DUF433 | 3.94 |
PF05016 | ParE_toxin | 2.36 |
PF08972 | DUF1902 | 2.36 |
PF13744 | HTH_37 | 1.57 |
PF00072 | Response_reg | 0.79 |
PF00860 | Xan_ur_permease | 0.79 |
PF00583 | Acetyltransf_1 | 0.79 |
PF08281 | Sigma70_r4_2 | 0.79 |
PF00232 | Glyco_hydro_1 | 0.79 |
PF00459 | Inositol_P | 0.79 |
PF15919 | HicB_lk_antitox | 0.79 |
PF05015 | HigB-like_toxin | 0.79 |
PF04261 | Dyp_perox | 0.79 |
PF01402 | RHH_1 | 0.79 |
PF07992 | Pyr_redox_2 | 0.79 |
PF05746 | DALR_1 | 0.79 |
PF13507 | GATase_5 | 0.79 |
PF03544 | TonB_C | 0.79 |
PF01339 | CheB_methylest | 0.79 |
PF01609 | DDE_Tnp_1 | 0.79 |
PF07722 | Peptidase_C26 | 0.79 |
PF00665 | rve | 0.79 |
PF04461 | DUF520 | 0.79 |
PF13701 | DDE_Tnp_1_4 | 0.79 |
PF01558 | POR | 0.79 |
PF04455 | Saccharop_dh_N | 0.79 |
PF01850 | PIN | 0.79 |
PF01408 | GFO_IDH_MocA | 0.79 |
PF13692 | Glyco_trans_1_4 | 0.79 |
PF12543 | DUF3738 | 0.79 |
PF01695 | IstB_IS21 | 0.79 |
PF01128 | IspD | 0.79 |
PF13304 | AAA_21 | 0.79 |
PF01261 | AP_endonuc_2 | 0.79 |
PF04909 | Amidohydro_2 | 0.79 |
PF07589 | PEP-CTERM | 0.79 |
PF01053 | Cys_Met_Meta_PP | 0.79 |
PF10387 | DUF2442 | 0.79 |
PF13442 | Cytochrome_CBB3 | 0.79 |
PF03787 | RAMPs | 0.79 |
PF02781 | G6PD_C | 0.79 |
PF03109 | ABC1 | 0.79 |
PF13638 | PIN_4 | 0.79 |
PF01527 | HTH_Tnp_1 | 0.79 |
PF13237 | Fer4_10 | 0.79 |
PF05853 | BKACE | 0.79 |
PF07394 | DUF1501 | 0.79 |
PF13490 | zf-HC2 | 0.79 |
PF03061 | 4HBT | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 5.51 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 5.51 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 3.94 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.57 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.79 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.79 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.79 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.79 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.79 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.79 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.79 |
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.79 |
COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.79 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.79 |
COG1332 | CRISPR-Cas system type III CSM-effector complex subunit Csm5, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.79 |
COG1336 | CRISPR-Cas system type III CMR-effector complex subunit Cmr4, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.79 |
COG1337 | CRISPR-Cas system type III CSM-effector complex subunit Csm3, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.79 |
COG1367 | CRISPR-Cas system type III CMR-effector complex subunit Cmr1, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.79 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.79 |
COG1567 | CRISPR-Cas system type III CSM-effector complex subunit Csm4, RAMP superfamily Cas5 group | Defense mechanisms [V] | 0.79 |
COG1604 | CRISPR/Cas system CMR subunit Cmr6, Cas7 group, RAMP superfamily | Defense mechanisms [V] | 0.79 |
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.79 |
COG1915 | Uncharacterized conserved protein AF1278, contains saccharopine dehydrogenase N-terminal (SDHN) domain | Function unknown [S] | 0.79 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.79 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.79 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.79 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.79 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.79 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.79 |
COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.79 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.79 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.79 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.79 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.79 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.79 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.79 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.79 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.79 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.04 % |
Unclassified | root | N/A | 14.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004635|Ga0062388_100314335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
3300005367|Ga0070667_100174276 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300005436|Ga0070713_100676852 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300005535|Ga0070684_100786149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 889 | Open in IMG/M |
3300005541|Ga0070733_10227209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
3300005583|Ga0049085_10075746 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1179 | Open in IMG/M |
3300006052|Ga0075029_100000936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16876 | Open in IMG/M |
3300006162|Ga0075030_100000181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 50159 | Open in IMG/M |
3300006172|Ga0075018_10759063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300009111|Ga0115026_10029386 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
3300009148|Ga0105243_13144604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300009156|Ga0111538_11106907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1001 | Open in IMG/M |
3300009166|Ga0105100_10824508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300009518|Ga0116128_1039205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1533 | Open in IMG/M |
3300009524|Ga0116225_1293237 | Not Available | 726 | Open in IMG/M |
3300009618|Ga0116127_1004005 | All Organisms → cellular organisms → Bacteria | 6506 | Open in IMG/M |
3300009621|Ga0116116_1054021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300009623|Ga0116133_1196620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 541 | Open in IMG/M |
3300009634|Ga0116124_1040759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
3300009639|Ga0116122_1056735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1315 | Open in IMG/M |
3300009646|Ga0116132_1018786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2499 | Open in IMG/M |
3300009760|Ga0116131_1221955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300009824|Ga0116219_10589068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300010048|Ga0126373_10087575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2854 | Open in IMG/M |
3300010341|Ga0074045_10865197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300010343|Ga0074044_10990693 | Not Available | 551 | Open in IMG/M |
3300010376|Ga0126381_100067529 | All Organisms → cellular organisms → Bacteria | 4448 | Open in IMG/M |
3300010376|Ga0126381_102489201 | Not Available | 742 | Open in IMG/M |
3300011110|Ga0138578_1217030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300011120|Ga0150983_15145571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300011271|Ga0137393_11796739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300012357|Ga0137384_10878671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300012357|Ga0137384_11511966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300012360|Ga0137375_10979791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300012929|Ga0137404_10210040 | Not Available | 1653 | Open in IMG/M |
3300013772|Ga0120158_10354634 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 689 | Open in IMG/M |
3300014153|Ga0181527_1171857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
3300014159|Ga0181530_10286646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
3300014162|Ga0181538_10726140 | Not Available | 514 | Open in IMG/M |
3300014164|Ga0181532_10456735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300014200|Ga0181526_11038469 | Not Available | 515 | Open in IMG/M |
3300014200|Ga0181526_11049272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300014489|Ga0182018_10427175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300014493|Ga0182016_10119195 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
3300014493|Ga0182016_10451256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300014493|Ga0182016_10582819 | Not Available | 638 | Open in IMG/M |
3300014838|Ga0182030_10002444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 39391 | Open in IMG/M |
3300014838|Ga0182030_10028353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema hofmannii | 10013 | Open in IMG/M |
3300014838|Ga0182030_10902989 | Not Available | 791 | Open in IMG/M |
3300014839|Ga0182027_11356000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300016422|Ga0182039_12049974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300017654|Ga0134069_1305776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300017929|Ga0187849_1010037 | All Organisms → cellular organisms → Bacteria | 6394 | Open in IMG/M |
3300017929|Ga0187849_1082658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
3300017931|Ga0187877_1019989 | All Organisms → cellular organisms → Bacteria | 3648 | Open in IMG/M |
3300017934|Ga0187803_10282545 | Not Available | 660 | Open in IMG/M |
3300017941|Ga0187850_10011529 | All Organisms → cellular organisms → Bacteria | 5627 | Open in IMG/M |
3300017961|Ga0187778_11091215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300017972|Ga0187781_10694747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300017975|Ga0187782_10329619 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300017996|Ga0187891_1007731 | All Organisms → cellular organisms → Bacteria | 6135 | Open in IMG/M |
3300018005|Ga0187878_1089272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1281 | Open in IMG/M |
3300018018|Ga0187886_1237806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300018020|Ga0187861_10494022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300018021|Ga0187882_1026080 | All Organisms → cellular organisms → Bacteria | 3121 | Open in IMG/M |
3300018022|Ga0187864_10493831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300018025|Ga0187885_10228071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 856 | Open in IMG/M |
3300018026|Ga0187857_10011560 | All Organisms → cellular organisms → Bacteria | 5416 | Open in IMG/M |
3300018026|Ga0187857_10027181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3113 | Open in IMG/M |
3300018030|Ga0187869_10035299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2728 | Open in IMG/M |
3300018033|Ga0187867_10522571 | Not Available | 652 | Open in IMG/M |
3300018034|Ga0187863_10842030 | Not Available | 521 | Open in IMG/M |
3300018035|Ga0187875_10523789 | Not Available | 628 | Open in IMG/M |
3300018038|Ga0187855_10325044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
3300018042|Ga0187871_10842165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300018044|Ga0187890_10198942 | Not Available | 1136 | Open in IMG/M |
3300018044|Ga0187890_10526897 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300019785|Ga0182022_1289839 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
3300020582|Ga0210395_11283631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300020583|Ga0210401_11132811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300021171|Ga0210405_10860490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300021406|Ga0210386_10254889 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300021420|Ga0210394_10109943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2385 | Open in IMG/M |
3300025448|Ga0208037_1020265 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300025506|Ga0208937_1104302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 624 | Open in IMG/M |
3300025507|Ga0208188_1061908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 911 | Open in IMG/M |
3300027842|Ga0209580_10106844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 1357 | Open in IMG/M |
3300027882|Ga0209590_10760695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300027898|Ga0209067_10296346 | Not Available | 888 | Open in IMG/M |
3300028653|Ga0265323_10000102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 48958 | Open in IMG/M |
3300028776|Ga0302303_10209876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300028779|Ga0302266_10038375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2237 | Open in IMG/M |
3300028785|Ga0302201_10179433 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300029911|Ga0311361_10366860 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300029911|Ga0311361_10929185 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300030007|Ga0311338_10169302 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
3300030011|Ga0302270_10723086 | Not Available | 502 | Open in IMG/M |
3300030057|Ga0302176_10123711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
3300030503|Ga0311370_10516071 | Not Available | 1459 | Open in IMG/M |
3300030520|Ga0311372_11949087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300030706|Ga0310039_10141883 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300031232|Ga0302323_100537624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
3300031235|Ga0265330_10115299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1146 | Open in IMG/M |
3300031236|Ga0302324_100626465 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300031250|Ga0265331_10328716 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031524|Ga0302320_12040414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300031525|Ga0302326_10483322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1884 | Open in IMG/M |
3300031525|Ga0302326_10913809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
3300031525|Ga0302326_11060668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300031718|Ga0307474_10471791 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300031718|Ga0307474_11598318 | Not Available | 512 | Open in IMG/M |
3300031772|Ga0315288_10097019 | All Organisms → cellular organisms → Bacteria | 3379 | Open in IMG/M |
3300031792|Ga0318529_10404259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300031823|Ga0307478_11225935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 625 | Open in IMG/M |
3300031834|Ga0315290_10059094 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
3300031879|Ga0306919_10001382 | All Organisms → cellular organisms → Bacteria | 11601 | Open in IMG/M |
3300031952|Ga0315294_10895911 | Not Available | 752 | Open in IMG/M |
3300031999|Ga0315274_10800392 | Not Available | 999 | Open in IMG/M |
3300032055|Ga0318575_10716798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300032069|Ga0315282_10287800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
3300032069|Ga0315282_10548271 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300032118|Ga0315277_11003967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300032805|Ga0335078_10192294 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
3300033402|Ga0326728_10231654 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
3300033419|Ga0316601_100224423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1668 | Open in IMG/M |
3300033977|Ga0314861_0376889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300034091|Ga0326724_0683662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 16.54% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 8.66% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.09% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.51% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.72% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.72% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 4.72% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.15% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.57% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.57% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.57% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.79% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.79% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062388_1003143354 | 3300004635 | Bog Forest Soil | LILECLASGMSLDDIDQSFGGSFPHQALPEVLKVASEITDSFHVAA* |
Ga0070667_1001742761 | 3300005367 | Switchgrass Rhizosphere | MLLSLNALILESLANGMSLDEIDAAFDHSFPRESLPEILEVASELTDSFHVAA* |
Ga0070713_1006768523 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GGMSLEEINDSFDSAFPSEALPEVLKVASELADSFHVAA* |
Ga0070684_1007861491 | 3300005535 | Corn Rhizosphere | AGGMSLGDIDEAFDNAFPHEAVPEVLKVASELTDSFHVAA* |
Ga0070733_102272094 | 3300005541 | Surface Soil | GMSLADIDQSFNNAFPHEALPEVLKVASELADSFHVAA* |
Ga0049085_100757464 | 3300005583 | Freshwater Lentic | VALILECLANDMDMAEIDAAFGGAFPHEALPEVLKVASELADVAA* |
Ga0075029_1000009368 | 3300006052 | Watersheds | LSVSLILECLANGMSRDDIDSAFNRVFPHEALPEVLKVAAELADSIHVAA* |
Ga0075030_10000018126 | 3300006162 | Watersheds | VSLILECLANGMSRDDIDSAFNRVFPHEALPEVLKVAAELADSIHVAA* |
Ga0075018_107590631 | 3300006172 | Watersheds | ESLANGMSLDEIDAAFDHSFPREALPEVLKVASELTDSFHVVA* |
Ga0115026_100293861 | 3300009111 | Wetland | MTLDDIDESFERTFPREALSEIMKVASELAGAVHAAA* |
Ga0105243_131446042 | 3300009148 | Miscanthus Rhizosphere | DEIDSAFDHAFPRESLPEVLKVASELTDSFHVAA* |
Ga0111538_111069072 | 3300009156 | Populus Rhizosphere | VGAGVAGGMSLKGIEEAFDHAFPHEALPEVLKVASELTNAFRVAA* |
Ga0105100_108245082 | 3300009166 | Freshwater Sediment | LAGGMSLEEINDSFDSAFPPEALPEVLKVASELAGSFHVAA* |
Ga0116128_10392054 | 3300009518 | Peatland | SLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116225_12932371 | 3300009524 | Peatlands Soil | LECLASGMSFEEINESFDGAFPPDALPEVLQVASELADSFHVAA* |
Ga0116127_10040051 | 3300009618 | Peatland | TRLSVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116116_10540213 | 3300009621 | Peatland | GGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116133_11966201 | 3300009623 | Peatland | CLAGGMSLEEINDSFDCAFPPEALPEVLKVASELTGSFHVAA* |
Ga0116124_10407594 | 3300009634 | Peatland | GMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116122_10567353 | 3300009639 | Peatland | SLEDIDQAFDGAFPHDALAEVLKVASELTGSFHVAA* |
Ga0116132_10187861 | 3300009646 | Peatland | ECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116131_12219551 | 3300009760 | Peatland | LAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA* |
Ga0116219_105890682 | 3300009824 | Peatlands Soil | SLILECLAAGMSLEEIDQAFDRAFPHEAMPEVLKVAAELTNSIHVAA* |
Ga0126373_100875752 | 3300010048 | Tropical Forest Soil | MSLEDIDQSFDHAFPHEALPEVLKVASEQADSFHVAA* |
Ga0074045_108651971 | 3300010341 | Bog Forest Soil | TLQDIDEAFDRAFPREALPEVLKVAAEVTNSIHVAA* |
Ga0074044_109906931 | 3300010343 | Bog Forest Soil | SLADIDQSFNNAFPHEALPEVLKVASELANSFHVAA* |
Ga0126381_1000675295 | 3300010376 | Tropical Forest Soil | MANGMSLEDIDEAFDCAFPHEALPEVLKVASEVTDRFHVAA* |
Ga0126381_1024892012 | 3300010376 | Tropical Forest Soil | MLECLAEGMSLEDIDQSFDHAFPHEALPEVLKVASELADSFHVAA* |
Ga0138578_12170301 | 3300011110 | Peatlands Soil | LSVALILECLAAGMTLAEIDEAFDRAFPHEALPEVLKVASELTNSVHVAA* |
Ga0150983_151455711 | 3300011120 | Forest Soil | LILECLASGMSLDDIDQSFDCDFPRQALPEVLKVASEFTDCFRVAA* |
Ga0137393_117967391 | 3300011271 | Vadose Zone Soil | ILESQTVSLDEIDSAFDRSFPHEALPEVLKVASELTDSFHVAA* |
Ga0137384_108786713 | 3300012357 | Vadose Zone Soil | MAGGMSLEDIDESFDCDFPREALPEVLKVASEFTDSFHVAA* |
Ga0137384_115119662 | 3300012357 | Vadose Zone Soil | LILECLSGGMSLDDIDQSFGGSFPLQALPEVLKVASEITDSFHVAA* |
Ga0137375_109797913 | 3300012360 | Vadose Zone Soil | TRLSVALILECLANGMTLRDIDDSFAAAFPHEALPEVLKVAAELAATYRVAA* |
Ga0137404_102100401 | 3300012929 | Vadose Zone Soil | VLAGFFASGISLDDIDESFSGTFPRLALPEVLKVASEITDSFHVAA* |
Ga0120158_103546342 | 3300013772 | Permafrost | LILECLGEGMSLAEIDESFGGVFPTEALPEVLKVASELADTTHVAS* |
Ga0181527_11718572 | 3300014153 | Bog | RLSVSLILECLAAGMSLEDIDQAFDRVFPHEAMPEVLKVAAELTNSIHVAA* |
Ga0181530_102866461 | 3300014159 | Bog | MSLDDIDESFDGAFPRTALPEVLKVASELTGSFLVAA* |
Ga0181538_107261401 | 3300014162 | Bog | TRRAVSLILECLASGMSLDDIDESFDGAFPRTALPEVLKVASELTGSFLVAA* |
Ga0181532_104567351 | 3300014164 | Bog | MSLEEINDSFDSAFPPEALPEVLKVASELAGSFHVAA* |
Ga0181526_110384691 | 3300014200 | Bog | LANGMSLEDIDEAFQGAFPRAALPEVLKVASEFADSFHVAA* |
Ga0181526_110492722 | 3300014200 | Bog | ECLANGMSLNDIDESFNHAFPHAALPEVLKVASEFADSFHVAA* |
Ga0182018_104271751 | 3300014489 | Palsa | ILESLANGMSLDEIDSAFDHCFPHEALPEVLKVASELTDSFHVAA* |
Ga0182016_101191955 | 3300014493 | Bog | TRLSVELILECLSNGMTLDDIDDAFAHAFPREALPEVLKVASEFTGSFHVAA* |
Ga0182016_104512561 | 3300014493 | Bog | TRLSVELILECLSNGMSLGDIDESFHNAFPHAALHEVLKVASEFADSFHVAA* |
Ga0182016_105828192 | 3300014493 | Bog | LSVELILESLANGMSLADIDESFHNAFPRAALHEVLKIASEFAGSFHVAA* |
Ga0182030_1000244432 | 3300014838 | Bog | MSLQDIDDAFAHAFPHEALPEVFKVASELADSFNPLA* |
Ga0182030_100283536 | 3300014838 | Bog | MANGMSLEDINEAFGGAFTPDAIPEVMRVASAFADAFHVAA* |
Ga0182030_109029893 | 3300014838 | Bog | TLDDIDDAFAHAFPREALPEVLKVASEFTGSFHVAA* |
Ga0182027_113560001 | 3300014839 | Fen | LEEIDDSFDSAFPSEALPEVLKVASELAGSFHVAA* |
Ga0182039_120499742 | 3300016422 | Soil | MLECLAEGMSLEDIDQSFDHAFPHEALPEVLKVASELADSFHVAA |
Ga0134069_13057762 | 3300017654 | Grasslands Soil | VAQILECLANGMTLDDIDESFDHSFPREALPEVLKVASELASAVHVAA |
Ga0187849_101003714 | 3300017929 | Peatland | LSVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA |
Ga0187849_10826584 | 3300017929 | Peatland | LSVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADVTNSVHAAA |
Ga0187877_10199891 | 3300017931 | Peatland | ILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA |
Ga0187803_102825453 | 3300017934 | Freshwater Sediment | GMSLDDIDEAFDRAFPHEALPEVLKVASQLTNSFHVAA |
Ga0187850_100115291 | 3300017941 | Peatland | SVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA |
Ga0187778_110912152 | 3300017961 | Tropical Peatland | SLILECLSAGMSLADIDDSFDNAFPHEALPEVLKVAAELTNSVHVAA |
Ga0187781_106947472 | 3300017972 | Tropical Peatland | SNASGMSLEEIGETFDCPFPHEALPEVLKVAAELTNSVHVAA |
Ga0187782_103296193 | 3300017975 | Tropical Peatland | SVSLILECLAAGMSLVEIDGALEGAFSHEALPEVLKAAAERPNSVKMRHVWKWN |
Ga0187891_10077311 | 3300017996 | Peatland | LPEIDEAFDRAFPHEALPEVLRVAAELTNYVHVAA |
Ga0187878_10892724 | 3300018005 | Peatland | GTRLSLSLILESLAGGMYLAEIDEAFDCAFPHEALPEVLKVAAELTNSVHVAA |
Ga0187886_12378061 | 3300018018 | Peatland | LAVSLILECLASGMSLEDIDQSFAHAFPHDALPEVLKVASELTGSFHVAA |
Ga0187861_104940221 | 3300018020 | Peatland | LAAGMSLEDIDQAFDRAFPHEAMPEVLKVAAELTNSIHVAA |
Ga0187882_10260801 | 3300018021 | Peatland | TRLSVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADVTNSVHAAA |
Ga0187864_104938311 | 3300018022 | Peatland | TRLSVSLILECLAAGMSLEDIDQAFDRVFPHEAMPEVLKVAAELTNSIHVAA |
Ga0187885_102280713 | 3300018025 | Peatland | LAEIDEAFDCAFPHEALPEVLKVAAELTNSVHVAA |
Ga0187857_100115607 | 3300018026 | Peatland | LSVSLILECLAGGMSLAEIDEAFDRAFPHEALPEVLRVAAEVTNSVHVAA |
Ga0187857_100271816 | 3300018026 | Peatland | LECLAGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA |
Ga0187869_100352995 | 3300018030 | Peatland | AGGMSLAEIDEAFDRAFPHEALPEVLKVAADLTNSVHVAA |
Ga0187867_105225711 | 3300018033 | Peatland | VSLILECLAAGMTLQDIDEAFDRAFPQEALPEVLKVAAEVTNSVHVAA |
Ga0187863_108420302 | 3300018034 | Peatland | VSLILECLASGMSFDDIDQSFGGTFPRQALPEVLRVASEITDSFHVAA |
Ga0187875_105237893 | 3300018035 | Peatland | ANGMSLEDIDEAFQGAFPRAALPEVLKVASEFADSFHVAA |
Ga0187855_103250441 | 3300018038 | Peatland | LECLAAGMTLQDIDESFDRAFPPEALPEVLKVAAEVTNSIHVAA |
Ga0187871_108421651 | 3300018042 | Peatland | AVSLILECLASGMTLEDIDQSFDHAFPHEALAEVLKVASELTDSFHVAA |
Ga0187890_101989422 | 3300018044 | Peatland | LECLSSGMSLEDIDQSFDYAFPHEALPEVLKVASELPMLDATS |
Ga0187890_105268971 | 3300018044 | Peatland | ECLAGGMSLEEINDSFDSAFPPEALPEVLKVASELAGSFHVAA |
Ga0182022_12898395 | 3300019785 | Fen | MSLDDIDQSFDCDFPRQALPEVLKVASEFTDSYHVAA |
Ga0210395_112836311 | 3300020582 | Soil | LAGGMSLADIDQSFNNAFPHEALPEVLKVASELADPFHVAA |
Ga0210401_111328113 | 3300020583 | Soil | GMSLDDIDQSFDCDFPRQALPEVLKVASEFTDCFRVAA |
Ga0210405_108604902 | 3300021171 | Soil | LLSPADIDEAFDHAFPRAALAEVLKVACKLTNSFHVAA |
Ga0210386_102548892 | 3300021406 | Soil | MSLADIDQSFNNAFPHEALPEVLKVASELADPFHVAA |
Ga0210394_101099433 | 3300021420 | Soil | MSLDDIEQSFGGTFPRQALPEVLKVASEITDSFHVAA |
Ga0208037_10202654 | 3300025448 | Peatland | SVSLILECLAGGMSLAEIDGAFDRAFPHEALPEVLRVAAELTNSVHVAA |
Ga0208937_11043021 | 3300025506 | Peatland | ILECLAGGMSLEEINDSFDSAFPPEALPEVLKVASELAGSFHVAA |
Ga0208188_10619083 | 3300025507 | Peatland | LAGGMSLEEINDSFDSAFPPEALPEVLKVASELAGSFHVAA |
Ga0209580_101068441 | 3300027842 | Surface Soil | SVSQILECLASGMSLADIDEAFDHAFPQEALPEVLKVASELTDSFHVAA |
Ga0209590_107606951 | 3300027882 | Vadose Zone Soil | LSVSLILECLAGGMSLEDIDEAFDGAFPREALPEVLKVASEFTDSFHVAA |
Ga0209067_102963461 | 3300027898 | Watersheds | VSLILECLANGMSRDDIDSAFNRVFPHEALPEVLKVAAELADSIHVAA |
Ga0265323_1000010234 | 3300028653 | Rhizosphere | MSLGEIDDSFGIDFPREALPEVLRVASELTKSFHVAA |
Ga0302303_102098761 | 3300028776 | Palsa | MSLDDIDQSFGGDFPREALPEVLKVASEITDAFHVAA |
Ga0302266_100383751 | 3300028779 | Bog | AVSLILECLAGGMSLEEINDSFDCAFPPEALPEVLKVASELTGSFHVAA |
Ga0302201_101794332 | 3300028785 | Bog | VSLILECLAGGMSLEEINDSFDCAFPPEALPEVLKVASELTGSFHVAA |
Ga0311361_103668602 | 3300029911 | Bog | MSLADIDESFHHGFPHAALPEVLKVAAEFAGSFHAAA |
Ga0311361_109291852 | 3300029911 | Bog | MRASGMSLDDIVESFGGTFPRQALPEVLKVASEITGSFH |
Ga0311338_101693024 | 3300030007 | Palsa | MSLQDIDEAFDHAFPHEALPEVLKVASELAGSFHVAA |
Ga0302270_107230861 | 3300030011 | Bog | CLANGMSLTDIDESFHNSFPHAALHEVLKVASEFAGSFALPA |
Ga0302176_101237111 | 3300030057 | Palsa | ILECLASGMSLDDIDQSFGGDFPREALPEVLKVASEITDLFHVAA |
Ga0311370_105160712 | 3300030503 | Palsa | SLILECLASGMSLDDIDQSFDCDFPRQALPEVLKVASEFTDSFHVAA |
Ga0311372_119490871 | 3300030520 | Palsa | GMSLDDIDESFGGTFPRQAMPEILKVASEITDSFHVAA |
Ga0310039_101418833 | 3300030706 | Peatlands Soil | TRLSVALILECLAAGMTLAEIDEAFDRAFPHEALPEVLKVASELTNSVHVAA |
Ga0302323_1005376243 | 3300031232 | Fen | STRLSVSLILECLASGMTLKDIDESFDNGFPHEALPEVLKVASELTDSFHVAA |
Ga0265330_101152993 | 3300031235 | Rhizosphere | WPFAAPGGMSLGEIDDSFGIDFPREALPEVLRVASELTKSFHVAA |
Ga0302324_1006264651 | 3300031236 | Palsa | LSNGMSLGDIDESFHNTFPHAALHEVLKVASEFGGSFPFAGELADF |
Ga0265331_103287163 | 3300031250 | Rhizosphere | NGMSLDEIDSAFDHCFPHDALPEVLKVASELTDSFHVAV |
Ga0302320_120404142 | 3300031524 | Bog | MSFDDIDQSFGGTFPRQALPEVLKVASEITDSFHVAA |
Ga0302326_104833221 | 3300031525 | Palsa | LDDIDQSFGGDFPREALPEVLKVASEITDLFHVAA |
Ga0302326_109138091 | 3300031525 | Palsa | SVELILECLSNGMSLGDIDESFHNMFPHAALHEVLKVASEFAGSFHVAA |
Ga0302326_110606681 | 3300031525 | Palsa | LANGMSLSDIDEAFAHAFPHAALGEVLKVASEFTGSFHVAA |
Ga0307474_104717913 | 3300031718 | Hardwood Forest Soil | IRGTRLSVGLILECMVNGMSLQDIDEAFHDAFPHAALPEILKVASEFADSFHVAA |
Ga0307474_115983182 | 3300031718 | Hardwood Forest Soil | RLSVSLILECLASGMSLDDIDQSFGGTFPRQAFPEVLKVASEITDSFHVAA |
Ga0315288_100970195 | 3300031772 | Sediment | MTLADIDESFGHTFPHEALPEVLKVASELAESVPVAA |
Ga0318529_104042591 | 3300031792 | Soil | SVSLILECLAGGMSLREIDDAFDSTFPHEALPEILRVASELADSFHVAA |
Ga0307478_112259352 | 3300031823 | Hardwood Forest Soil | ECLSNGMSLEDIDSAFANVFPHEALPEVLKVASELTDSFHVAA |
Ga0315290_100590941 | 3300031834 | Sediment | TLDDIDENFDRAFPREALSEVLKVASELAGAVHVTA |
Ga0306919_100013824 | 3300031879 | Soil | MSLREIDDAFDSAFPHEALPEILRVASELADSFHVAA |
Ga0315294_108959111 | 3300031952 | Sediment | MSLEEINDSFDSAFPSEALPEVLKVASELAGSFHVAA |
Ga0315274_108003922 | 3300031999 | Sediment | LAGGMSLEEINDSFDSAFPSEALPEVLKVASELAGSFHVAA |
Ga0318575_107167981 | 3300032055 | Soil | AGGMSLREIDDAFDSTFPHEALPEILRVASELADSFHVAA |
Ga0315282_102878001 | 3300032069 | Sediment | TRLSVSLILECLANGMTLDDIDESFDRTFPHEALSEILKVASKLAGAVHVAA |
Ga0315282_105482713 | 3300032069 | Sediment | RLAVSLILECLASGMSLEDIDQSFGHAFPHDALPEVLKVASELTGSFHVAA |
Ga0315277_110039671 | 3300032118 | Sediment | ECLSNGMTLDDIDESFDRSFPHEALPEVLKVASELVGSIHVAA |
Ga0335078_101922941 | 3300032805 | Soil | MSLQDIDEALDRAFPHEALPEVLKVASELTDSFHVAA |
Ga0326728_102316541 | 3300033402 | Peat Soil | GMSLEEIDEAFDNTFPHEALPEVLKVAAERANSAKMAHVWK |
Ga0316601_1002244233 | 3300033419 | Soil | ANGMTLDDIDESFERTFPREALSEILKVASELAGAVHAAA |
Ga0314861_0376889_3_122 | 3300033977 | Peatland | AGMTLLDIDEAFDHAFPHEALPEVLKVAAELTNSVHVAA |
Ga0326724_0683662_1_129 | 3300034091 | Peat Soil | CLATGMSLEEIDGAFDRAFPHEALPEVLRVAAEVTNSVHVAA |
⦗Top⦘ |