NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065916

Metagenome / Metatranscriptome Family F065916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065916
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 40 residues
Representative Sequence MLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF
Number of Associated Samples 93
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.76 %
% of genes near scaffold ends (potentially truncated) 38.58 %
% of genes from short scaffolds (< 2000 bps) 77.17 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.268 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(14.961 % of family members)
Environment Ontology (ENVO) Unclassified
(36.220 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(66.929 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.77%    β-sheet: 0.00%    Coil/Unstructured: 49.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00196GerE 5.51
PF00034Cytochrom_C 3.15
PF00668Condensation 3.15
PF03237Terminase_6N 2.36
PF12850Metallophos_2 2.36
PF13193AMP-binding_C 2.36
PF13545HTH_Crp_2 1.57
PF07486Hydrolase_2 1.57
PF13515FUSC_2 1.57
PF17201Cache_3-Cache_2 1.57
PF11391DUF2798 1.57
PF00106adh_short 0.79
PF00501AMP-binding 0.79
PF13493DUF4118 0.79
PF07386DUF1499 0.79
PF06078DUF937 0.79
PF01361Tautomerase 0.79
PF05227CHASE3 0.79
PF09361Phasin_2 0.79
PF10503Esterase_PHB 0.79
PF12576DUF3754 0.79
PF04298Zn_peptidase_2 0.79
PF03707MHYT 0.79
PF14342DUF4396 0.79
PF13683rve_3 0.79
PF02518HATPase_c 0.79
PF13442Cytochrome_CBB3 0.79
PF00171Aldedh 0.79
PF02148zf-UBP 0.79
PF03466LysR_substrate 0.79
PF12833HTH_18 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG1020EntF, seryl-AMP synthase component of non-ribosomal peptide synthetaseSecondary metabolites biosynthesis, transport and catabolism [Q] 3.15
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 1.57
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.79
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.79
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.79
COG2738Zn-dependent membrane protease YugPPosttranslational modification, protein turnover, chaperones [O] 0.79
COG3300MHYT domain, NO-binding membrane sensorSignal transduction mechanisms [T] 0.79
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.79
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.79
COG4446Uncharacterized conserved protein, DUF1499 familyFunction unknown [S] 0.79
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.79
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.27 %
UnclassifiedrootN/A41.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01DKYO3All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis527Open in IMG/M
3300002070|JGI24750J21931_1013102Not Available1106Open in IMG/M
3300004463|Ga0063356_101739889All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300004785|Ga0058858_1411625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales789Open in IMG/M
3300004799|Ga0058863_11808773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1198Open in IMG/M
3300005327|Ga0070658_10754964Not Available845Open in IMG/M
3300005329|Ga0070683_101069455Not Available775Open in IMG/M
3300005331|Ga0070670_100058933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3296Open in IMG/M
3300005332|Ga0066388_102182614All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300005339|Ga0070660_100107965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis2212Open in IMG/M
3300005354|Ga0070675_100486679Not Available1110Open in IMG/M
3300005356|Ga0070674_100227980All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300005435|Ga0070714_100291616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1518Open in IMG/M
3300005444|Ga0070694_101064547Not Available673Open in IMG/M
3300005457|Ga0070662_100087876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2328Open in IMG/M
3300005457|Ga0070662_100771048Not Available816Open in IMG/M
3300005544|Ga0070686_101804633Not Available521Open in IMG/M
3300005546|Ga0070696_100792308Not Available779Open in IMG/M
3300005547|Ga0070693_101266720Not Available569Open in IMG/M
3300005548|Ga0070665_100099218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2916Open in IMG/M
3300005548|Ga0070665_100800297Not Available956Open in IMG/M
3300005548|Ga0070665_102273934Not Available545Open in IMG/M
3300005549|Ga0070704_100785921Not Available850Open in IMG/M
3300005563|Ga0068855_101122594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis821Open in IMG/M
3300005564|Ga0070664_100062505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3174Open in IMG/M
3300005564|Ga0070664_100583379All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300005577|Ga0068857_100013551All Organisms → cellular organisms → Bacteria7102Open in IMG/M
3300005615|Ga0070702_100046446Not Available2461Open in IMG/M
3300005615|Ga0070702_100212444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1289Open in IMG/M
3300005713|Ga0066905_100127823All Organisms → cellular organisms → Bacteria → Proteobacteria1787Open in IMG/M
3300005718|Ga0068866_10071043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1840Open in IMG/M
3300005764|Ga0066903_103605711Not Available834Open in IMG/M
3300005764|Ga0066903_108052179Not Available540Open in IMG/M
3300005841|Ga0068863_102333104Not Available545Open in IMG/M
3300005844|Ga0068862_100571743All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300006196|Ga0075422_10282593Not Available706Open in IMG/M
3300006804|Ga0079221_10457550Not Available813Open in IMG/M
3300006806|Ga0079220_11650073Not Available558Open in IMG/M
3300006844|Ga0075428_100397662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1477Open in IMG/M
3300006844|Ga0075428_100631559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1143Open in IMG/M
3300006845|Ga0075421_102338874Not Available561Open in IMG/M
3300006846|Ga0075430_100441672Not Available1074Open in IMG/M
3300006847|Ga0075431_100525456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae1172Open in IMG/M
3300006852|Ga0075433_10417326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1183Open in IMG/M
3300006852|Ga0075433_10675009Not Available905Open in IMG/M
3300006871|Ga0075434_100658252Not Available1065Open in IMG/M
3300006914|Ga0075436_100657046Not Available775Open in IMG/M
3300006954|Ga0079219_10134575Not Available1288Open in IMG/M
3300007076|Ga0075435_100060335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae3075Open in IMG/M
3300007076|Ga0075435_100346204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1274Open in IMG/M
3300007076|Ga0075435_100958648Not Available747Open in IMG/M
3300007076|Ga0075435_101568217Not Available578Open in IMG/M
3300007076|Ga0075435_101949889Not Available516Open in IMG/M
3300009011|Ga0105251_10053072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1928Open in IMG/M
3300009094|Ga0111539_11310221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187841Open in IMG/M
3300009148|Ga0105243_10179361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1841Open in IMG/M
3300009148|Ga0105243_11341984All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300009156|Ga0111538_11018736Not Available1047Open in IMG/M
3300009156|Ga0111538_11522360Not Available843Open in IMG/M
3300009162|Ga0075423_11134856All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009167|Ga0113563_12553933Not Available617Open in IMG/M
3300009553|Ga0105249_10362664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1471Open in IMG/M
3300009553|Ga0105249_10782510Not Available1017Open in IMG/M
3300010375|Ga0105239_12190483Not Available643Open in IMG/M
3300010396|Ga0134126_10363834All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300011119|Ga0105246_10003183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9975Open in IMG/M
3300011119|Ga0105246_10018371All Organisms → cellular organisms → Bacteria4456Open in IMG/M
3300011119|Ga0105246_11099523Not Available726Open in IMG/M
3300012489|Ga0157349_1030348All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria561Open in IMG/M
3300012899|Ga0157299_10012638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1465Open in IMG/M
3300012909|Ga0157290_10186181Not Available694Open in IMG/M
3300012911|Ga0157301_10113262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria815Open in IMG/M
3300012951|Ga0164300_10013227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2670Open in IMG/M
3300012951|Ga0164300_10506451Not Available691Open in IMG/M
3300012957|Ga0164303_10005015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4153Open in IMG/M
3300012957|Ga0164303_10014895All Organisms → cellular organisms → Bacteria2834Open in IMG/M
3300012957|Ga0164303_10016017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2766Open in IMG/M
3300012957|Ga0164303_11232845Not Available549Open in IMG/M
3300012958|Ga0164299_10091960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1553Open in IMG/M
3300012958|Ga0164299_10186918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium drakei1184Open in IMG/M
3300012958|Ga0164299_11302645Not Available556Open in IMG/M
3300012960|Ga0164301_10773550Not Available731Open in IMG/M
3300012960|Ga0164301_11145216All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium621Open in IMG/M
3300012984|Ga0164309_10048746All Organisms → cellular organisms → Bacteria2440Open in IMG/M
3300012985|Ga0164308_10873536Not Available790Open in IMG/M
3300012985|Ga0164308_11733567Not Available580Open in IMG/M
3300012988|Ga0164306_11206698Not Available635Open in IMG/M
3300013297|Ga0157378_11741786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300013306|Ga0163162_10030224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5368Open in IMG/M
3300013306|Ga0163162_10069206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3581Open in IMG/M
3300013306|Ga0163162_12298945All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300013307|Ga0157372_12934481Not Available546Open in IMG/M
3300015371|Ga0132258_10073131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7958Open in IMG/M
3300015371|Ga0132258_12218030All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP1871378Open in IMG/M
3300015373|Ga0132257_100119089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK6043065Open in IMG/M
3300015373|Ga0132257_100146618All Organisms → cellular organisms → Bacteria2761Open in IMG/M
3300015373|Ga0132257_102231785Not Available709Open in IMG/M
3300015374|Ga0132255_101864377All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300015374|Ga0132255_104899059Not Available567Open in IMG/M
3300017943|Ga0187819_10017311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4154Open in IMG/M
3300017955|Ga0187817_10077173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2080Open in IMG/M
3300018028|Ga0184608_10192734All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium891Open in IMG/M
3300018081|Ga0184625_10428474All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium680Open in IMG/M
3300022694|Ga0222623_10067249All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300024055|Ga0247794_10105189All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300025903|Ga0207680_10200783Not Available1359Open in IMG/M
3300025908|Ga0207643_10050019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2369Open in IMG/M
3300025908|Ga0207643_10584500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300025911|Ga0207654_10018001All Organisms → cellular organisms → Bacteria → Proteobacteria3704Open in IMG/M
3300025916|Ga0207663_10023143All Organisms → cellular organisms → Bacteria → Proteobacteria3561Open in IMG/M
3300025919|Ga0207657_10000470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi42653Open in IMG/M
3300025933|Ga0207706_10882720Not Available756Open in IMG/M
3300025936|Ga0207670_10457295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300025938|Ga0207704_10678268Not Available851Open in IMG/M
3300025949|Ga0207667_10095101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3076Open in IMG/M
3300025972|Ga0207668_11237050Not Available671Open in IMG/M
3300026035|Ga0207703_10669640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria985Open in IMG/M
3300026067|Ga0207678_10285733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1416Open in IMG/M
3300027703|Ga0207862_1018327Not Available2084Open in IMG/M
3300028379|Ga0268266_10148957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2107Open in IMG/M
3300031944|Ga0310884_10579305Not Available668Open in IMG/M
3300032180|Ga0307471_100942522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1031Open in IMG/M
3300032180|Ga0307471_103218793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium579Open in IMG/M
3300032205|Ga0307472_100975442Not Available792Open in IMG/M
3300032205|Ga0307472_101154872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria737Open in IMG/M
3300032829|Ga0335070_10252035All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300033551|Ga0247830_11711743Not Available504Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.57%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.57%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.79%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004785Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_004891802170459010Grass SoilGVPKRMENQKMLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF
JGI24750J21931_101310223300002070Corn, Switchgrass And Miscanthus RhizosphereMENKKMLKRXFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0063356_10173988923300004463Arabidopsis Thaliana RhizosphereMLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILFGAALLHWLAQF*
Ga0058858_141162523300004785Host-AssociatedMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0058863_1180877343300004799Host-AssociatedMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0070658_1075496423300005327Corn RhizosphereMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0070683_10106945523300005329Corn RhizosphereMENQKMLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0070670_10005893343300005331Switchgrass RhizosphereMENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0066388_10218261413300005332Tropical Forest SoilMGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAVFLNWVAHL*
Ga0070660_10010796523300005339Corn RhizosphereMLDGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070675_10048667923300005354Miscanthus RhizosphereMENQKMLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0070674_10022798033300005356Miscanthus RhizosphereMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAHF*
Ga0070714_10029161613300005435Agricultural SoilKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0070694_10106454713300005444Corn, Switchgrass And Miscanthus RhizosphereMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVALSNQLKFAF
Ga0070662_10008787613300005457Corn RhizosphereRDAWMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070662_10077104823300005457Corn RhizosphereTSAKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070686_10180463313300005544Switchgrass RhizosphereKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070696_10079230813300005546Corn, Switchgrass And Miscanthus RhizosphereKKMFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070693_10126672013300005547Corn, Switchgrass And Miscanthus RhizosphereMKQDQCDAWIGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070665_10009921823300005548Switchgrass RhizosphereMFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF*
Ga0070665_10080029723300005548Switchgrass RhizosphereMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0070665_10227393413300005548Switchgrass RhizosphereMLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF*
Ga0070704_10078592123300005549Corn, Switchgrass And Miscanthus RhizosphereQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0068855_10112259413300005563Corn RhizosphereDGESKMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0070664_10006250593300005564Corn RhizosphereMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070664_10058337923300005564Corn RhizosphereMLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF*
Ga0068857_10001355123300005577Corn RhizosphereMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0070702_10004644613300005615Corn, Switchgrass And Miscanthus RhizosphereAKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0070702_10021244413300005615Corn, Switchgrass And Miscanthus RhizosphereENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0066905_10012782313300005713Tropical Forest SoilMEKKMLRRIVPYLKRPDVDFALDCVSFILFSVVFLYWVAHL*
Ga0068866_1007104343300005718Miscanthus RhizosphereMLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0066903_10360571113300005764Tropical Forest SoilPPMGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAAFLNWVAHL*
Ga0066903_10805217913300005764Tropical Forest SoilMLRGVFPSLKRPDVEFALECASFIFFCAVFLHWIA
Ga0068863_10233310423300005841Switchgrass RhizosphereMEDQKMLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF*
Ga0068862_10057174333300005844Switchgrass RhizosphereMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0075422_1028259323300006196Populus RhizosphereMLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF*
Ga0079221_1045755013300006804Agricultural SoilMENQKMLKRIFPYLNRPDVEFVFSAIFLNWVAHF*
Ga0079220_1165007313300006806Agricultural SoilMENKKMLRRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0075428_10039766213300006844Populus RhizosphereMLRRVFPYFKRPDVEFVLECVSFILFSVVFMHWVAHF*
Ga0075428_10063155943300006844Populus RhizosphereLTQGAKQMLKRVFPFLKRSDVEFTLECTSFILFCAAALRWVAQF*
Ga0075421_10233887413300006845Populus RhizosphereKQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF*
Ga0075430_10044167223300006846Populus RhizosphereMFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL*
Ga0075431_10052545613300006847Populus RhizosphereKMFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL*
Ga0075433_1041732623300006852Populus RhizosphereMENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF*
Ga0075433_1067500943300006852Populus RhizosphereRDAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVFLNWVAHF*
Ga0075434_10065825223300006871Populus RhizosphereMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0075436_10065704613300006914Populus RhizosphereKMLKRIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF*
Ga0079219_1013457513300006954Agricultural SoilMENQKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0075435_10006033543300007076Populus RhizosphereMFRHMFPFLMRPDLEFALDCASFIFFCAALLHWIAQL*
Ga0075435_10034620433300007076Populus RhizosphereDAWMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0075435_10095864813300007076Populus RhizosphereMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0075435_10156821713300007076Populus RhizosphereKMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF*
Ga0075435_10194988923300007076Populus RhizosphereRVKQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF*
Ga0105251_1005307213300009011Switchgrass RhizosphereNKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF*
Ga0111539_1131022123300009094Populus RhizosphereMLAQARSQGEKQMLRRVFPLLKRPDVEFMLDCASFILFGAALLHWVAQF*
Ga0105243_1017936113300009148Miscanthus RhizosphereMENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWV
Ga0105243_1134198423300009148Miscanthus RhizosphereMLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF*
Ga0111538_1101873613300009156Populus RhizosphereNQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF*
Ga0111538_1152236013300009156Populus RhizosphereMFRHMFPFLMRPDVEFALHCASFIFFCAALLHWIAQL
Ga0075423_1113485623300009162Populus RhizosphereMLRRVFPYLKRPDVEFTLECASFILFCAAFLRWIAQF*
Ga0113563_1255393323300009167Freshwater WetlandsMLRRVFPLLKRPDVEFTLECASFVLFCAALLHWIAQF*
Ga0105249_1036266443300009553Switchgrass RhizosphereDAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF*
Ga0105249_1078251033300009553Switchgrass RhizosphereRIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF*
Ga0105239_1219048323300010375Corn RhizosphereGLPKSTENQKMLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF*
Ga0134126_1036383423300010396Terrestrial SoilMLRRIFPYFKRPDVEFVLEYVSFILFSVVFVHWVAHF*
Ga0105246_1000318313300011119Miscanthus RhizosphereMLKRIFPYLNRPNVEFVLEYVSFILFCGVFLHWVAHF*
Ga0105246_1001837173300011119Miscanthus RhizosphereMLKRIFPYLNRPDVEFALECASSILFSAVFLNWVAQF*
Ga0105246_1109952313300011119Miscanthus RhizosphereMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVF
Ga0157349_103034813300012489Unplanted SoilMLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF*
Ga0157299_1001263813300012899SoilASLIELRDAGMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0157290_1018618113300012909SoilQKMLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0157301_1011326233300012911SoilAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVVLNWVAHF*
Ga0164300_1001322743300012951SoilMLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164300_1050645123300012951SoilMLRRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF*
Ga0164303_1000501563300012957SoilMLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHL*
Ga0164303_1001489533300012957SoilMLSRVFPFLKKPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164303_1001601723300012957SoilMLRRTFPYLKRPDVEFVLERTSFIFFSVIFLHWVAHF*
Ga0164303_1123284513300012957SoilKQMLRRMFPLLKRPDVEFMLDCASFILFGAALLHWVAQF*
Ga0164299_1009196033300012958SoilMLRRMFPYLNRPDVEIVLDCTSFIFFSVVFLRWVAHF*
Ga0164299_1018691833300012958SoilMLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164299_1130264523300012958SoilMVRPVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF*
Ga0164301_1077355013300012960SoilMLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF*
Ga0164301_1114521623300012960SoilRRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF*
Ga0164309_1004874613300012984SoilLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL*
Ga0164308_1087353613300012985SoilKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0164308_1173356713300012985SoilRVLTQGVKQMLRRVFPFLKRPDIEFTLECASFILFSAAFLHWVAQL*
Ga0164306_1120669823300012988SoilMVRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF*
Ga0157378_1174178613300013297Miscanthus RhizosphereKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF*
Ga0163162_1003022413300013306Switchgrass RhizosphereGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL*
Ga0163162_1006920673300013306Switchgrass RhizosphereMLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF*
Ga0163162_1229894523300013306Switchgrass RhizosphereRVFPLLKRPGVEFMLECASFVLFCAALLHWVAQF*
Ga0157372_1293448113300013307Corn RhizosphereMLSRVFPFLKRPDVEFTLECASFILFCAAFLHWGAQL*
Ga0132258_1007313143300015371Arabidopsis RhizosphereMFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF*
Ga0132258_1221803023300015371Arabidopsis RhizosphereMLRRVFPLLKRPDVEFMLECASFILFCTALLHWVARF*
Ga0132257_10011908923300015373Arabidopsis RhizosphereMLRRVFPYLKRPDVEFMLECASFILFCAAFLRWIAQF*
Ga0132257_10014661823300015373Arabidopsis RhizosphereMLRRVFPFLKRPDIEFTLECASFILFCAAFLHWVAQF*
Ga0132257_10223178523300015373Arabidopsis RhizosphereMSAQASSQGEKQMLRRVFPLLKRPDVEFMLECASFVLFCAALLHWIAQF*
Ga0132255_10186437723300015374Arabidopsis RhizosphereMLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF*
Ga0132255_10489905923300015374Arabidopsis RhizosphereMLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHF*
Ga0187819_1001731123300017943Freshwater SedimentMLRRAFPLLKRSDVEFTLECASFVLFCAAFLHWVAQI
Ga0187817_1007717323300017955Freshwater SedimentMLKRAFPPLKRPDVEFTLECASFILFCAAFLHWVAQI
Ga0184608_1019273423300018028Groundwater SedimentMLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQ
Ga0184625_1042847423300018081Groundwater SedimentMLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL
Ga0222623_1006724913300022694Groundwater SedimentMLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF
Ga0247794_1010518933300024055SoilMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAH
Ga0207680_1020078333300025903Switchgrass RhizosphereQRKRAMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF
Ga0207643_1005001933300025908Miscanthus RhizosphereMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF
Ga0207643_1058450023300025908Miscanthus RhizosphereMLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF
Ga0207654_1001800123300025911Corn RhizosphereMFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF
Ga0207663_1002314343300025916Corn, Switchgrass And Miscanthus RhizosphereMLRRIFPYFKRPDVEFVLECVSFILFSAVFVHWVAHF
Ga0207657_10000470503300025919Corn RhizosphereWMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207706_1088272023300025933Corn RhizosphereMLKRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF
Ga0207670_1045729523300025936Switchgrass RhizosphereMFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL
Ga0207704_1067826823300025938Miscanthus RhizosphereENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207667_1009510143300025949Corn RhizosphereMFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF
Ga0207668_1123705023300025972Switchgrass RhizosphereMLRRLFPYLKRPDIEIFLDCAAFIFFIVAFLHWVARF
Ga0207703_1066964023300026035Switchgrass RhizosphereKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF
Ga0207678_1028573333300026067Corn RhizosphereMLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF
Ga0207862_101832723300027703Tropical Forest SoilMVKRMFPFLKWPNVEFTLECASFVFFCVAFLHWVAHF
Ga0268266_1014895713300028379Switchgrass RhizosphereMLKRIFPYLNRPDVEFVLEYVSFILFCGVFLHWVAHF
Ga0310884_1057930523300031944SoilKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL
Ga0307471_10094252223300032180Hardwood Forest SoilMLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL
Ga0307471_10321879323300032180Hardwood Forest SoilMLRRVFPLLKRPDVEFMLECTSFILFCAAFLRWIAQF
Ga0307472_10097544223300032205Hardwood Forest SoilMLRRLFPYLKRPDVEIFLDCVSFIFFSVAFLHWVAHF
Ga0307472_10115487233300032205Hardwood Forest SoilQGVKQMLRRVFPLLKRPDVEFMLECASFILFCAALLHWVAQF
Ga0335070_1025203523300032829SoilMLRHVFPILKRRDVELTLECTSFLLLCAAFLHWVAVG
Ga0247830_1171174313300033551SoilMLRRTFPYLKRPDVEFALDCTSLIIFSVIFLHWVVHF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.