Metagenome Family F065900

Basic Information
Family ID	F065900
Family Type	Metagenome
Number of Sequences	127
Average Sequence Length	41 residues
Representative Sequence	GGTADVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Number of Associated Samples	117
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.79 %
% of genes near scaffold ends (potentially truncated)	98.43 %
% of genes from short scaffolds (< 2000 bps)	97.64 %
Associated GOLD sequencing projects	111
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (59.055 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (7.087 % of family members)
Environment Ontology (ENVO)	Unclassified (37.795 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (40.945 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF03951	Gln-synt_N	57.48
PF00581	Rhodanese	18.90
PF12625	Arabinose_bd	0.79
PF13188	PAS_8	0.79

COG ID	Name	Functional Category	% Frequency in 127 Family Scaffolds
COG0174	Glutamine synthetase	Amino acid transport and metabolism [E]	57.48

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	61.42 %
Unclassified	root	N/A	38.58 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	61.42 %
Unclassified	root	N/A	38.58 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.06 %
Unclassified	root	N/A	38.58 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.36 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	45.67 %
Unclassified	root	N/A	38.58 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.57 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	41.73 %
Unclassified	root	N/A	38.58 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	12.60 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	8.66 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.57 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	10.24 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	3.15 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.57 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.57 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.57 %
Azoarcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus	0.79 %
Azonexus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
unclassified Azoarcus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.58 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	10.24 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1.57 %
Paraburkholderia ribeironis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	1.57 %
Azospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	1.57 %
Azoarcus sp. KH32C	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	0.79 %
Azonexus hydrophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	0.79 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352025\|deepsgr__Contig_157842	Not Available	643	Open in IMG/M
3300000124\|BS_KBA_SWE12_21mDRAFT_c10133256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100305246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	532	Open in IMG/M
3300001213\|JGIcombinedJ13530_109575163	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300001664\|P5cmW16_1072325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	562	Open in IMG/M
3300003859\|Ga0031653_10019860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1903	Open in IMG/M
3300004000\|Ga0055458_10263946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Azonexus → Azonexus hydrophilus	537	Open in IMG/M
3300004643\|Ga0062591_100134296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1688	Open in IMG/M
3300005167\|Ga0066672_10711086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	642	Open in IMG/M
3300005180\|Ga0066685_10307946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1097	Open in IMG/M
3300005337\|Ga0070682_100390339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1050	Open in IMG/M
3300005340\|Ga0070689_100874495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	794	Open in IMG/M
3300005344\|Ga0070661_100511100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	962	Open in IMG/M
3300005344\|Ga0070661_100735226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	806	Open in IMG/M
3300005434\|Ga0070709_11411289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	564	Open in IMG/M
3300005458\|Ga0070681_11522333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	594	Open in IMG/M
3300005467\|Ga0070706_101329068	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300005543\|Ga0070672_100587787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	969	Open in IMG/M
3300005563\|Ga0068855_101265397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	765	Open in IMG/M
3300005719\|Ga0068861_101843504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	601	Open in IMG/M
3300005844\|Ga0068862_102021820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. KH32C	587	Open in IMG/M
3300005844\|Ga0068862_102645822	Not Available	513	Open in IMG/M
3300005921\|Ga0070766_11293748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	505	Open in IMG/M
3300006224\|Ga0079037_102458281	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300006237\|Ga0097621_101746054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	593	Open in IMG/M
3300006755\|Ga0079222_10095959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1543	Open in IMG/M
3300006796\|Ga0066665_10802501	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira	742	Open in IMG/M
3300006800\|Ga0066660_10142280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	1766	Open in IMG/M
3300006871\|Ga0075434_101691118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	641	Open in IMG/M
3300006904\|Ga0075424_101072027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	859	Open in IMG/M
3300006954\|Ga0079219_10137640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1279	Open in IMG/M
3300009101\|Ga0105247_11144501	Not Available	616	Open in IMG/M
3300009131\|Ga0115027_10908055	Not Available	682	Open in IMG/M
3300009162\|Ga0075423_11963373	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300009167\|Ga0113563_11009570	Not Available	958	Open in IMG/M
3300009174\|Ga0105241_10231564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1558	Open in IMG/M
3300009553\|Ga0105249_11843518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	677	Open in IMG/M
3300009553\|Ga0105249_12047045	Not Available	645	Open in IMG/M
3300010043\|Ga0126380_10433902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	987	Open in IMG/M
3300010358\|Ga0126370_10178794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1580	Open in IMG/M
3300010360\|Ga0126372_11503904	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300010398\|Ga0126383_13175564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	537	Open in IMG/M
3300010400\|Ga0134122_12525959	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300012198\|Ga0137364_11014628	Not Available	627	Open in IMG/M
3300012206\|Ga0137380_11070321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	688	Open in IMG/M
3300012227\|Ga0137449_1032517	Not Available	1037	Open in IMG/M
3300012349\|Ga0137387_11131727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	556	Open in IMG/M
3300012906\|Ga0157295_10130121	Not Available	730	Open in IMG/M
3300012961\|Ga0164302_11678076	Not Available	532	Open in IMG/M
3300012986\|Ga0164304_11106209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	634	Open in IMG/M
3300013100\|Ga0157373_10920272	Not Available	649	Open in IMG/M
3300013104\|Ga0157370_11688762	Not Available	568	Open in IMG/M
3300013232\|Ga0170573_11088651	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300013296\|Ga0157374_12681776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	526	Open in IMG/M
3300013297\|Ga0157378_11960051	Not Available	635	Open in IMG/M
3300013306\|Ga0163162_11102513	Not Available	899	Open in IMG/M
3300014320\|Ga0075342_1123815	Not Available	689	Open in IMG/M
3300015203\|Ga0167650_1063643	All Organisms → cellular organisms → Bacteria → Proteobacteria	900	Open in IMG/M
3300015372\|Ga0132256_103826287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	506	Open in IMG/M
3300015374\|Ga0132255_105511813	Not Available	535	Open in IMG/M
3300016445\|Ga0182038_10348453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1226	Open in IMG/M
3300017787\|Ga0183260_10622461	Not Available	691	Open in IMG/M
3300017792\|Ga0163161_10988144	Not Available	718	Open in IMG/M
3300018075\|Ga0184632_10406061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	571	Open in IMG/M
3300018075\|Ga0184632_10441002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	541	Open in IMG/M
3300018476\|Ga0190274_10258188	Not Available	1586	Open in IMG/M
3300018482\|Ga0066669_10317216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1275	Open in IMG/M
3300019361\|Ga0173482_10508635	Not Available	586	Open in IMG/M
3300020583\|Ga0210401_10647468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	918	Open in IMG/M
3300021432\|Ga0210384_10885940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	792	Open in IMG/M
3300022756\|Ga0222622_11024066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	607	Open in IMG/M
3300025898\|Ga0207692_10836458	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	603	Open in IMG/M
3300025899\|Ga0207642_10037653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2086	Open in IMG/M
3300025900\|Ga0207710_10690147	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300025906\|Ga0207699_11070574	Not Available	597	Open in IMG/M
3300025910\|Ga0207684_11449732	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300025916\|Ga0207663_10693352	Not Available	806	Open in IMG/M
3300025920\|Ga0207649_10820970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	726	Open in IMG/M
3300025921\|Ga0207652_11023325	Not Available	725	Open in IMG/M
3300025928\|Ga0207700_11788425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	540	Open in IMG/M
3300025930\|Ga0207701_10500421	Not Available	1040	Open in IMG/M
3300025932\|Ga0207690_10024736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3763	Open in IMG/M
3300025932\|Ga0207690_10744341	Not Available	808	Open in IMG/M
3300025949\|Ga0207667_11941036	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300025960\|Ga0207651_11981863	Not Available	523	Open in IMG/M
3300025966\|Ga0210105_1005533	Not Available	1815	Open in IMG/M
3300026041\|Ga0207639_11023276	Not Available	774	Open in IMG/M
3300026041\|Ga0207639_11793692	All Organisms → cellular organisms → Eukaryota	574	Open in IMG/M
3300026088\|Ga0207641_10216040	Not Available	1775	Open in IMG/M
3300026088\|Ga0207641_10658655	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300027462\|Ga0210000_1080633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia ribeironis	534	Open in IMG/M
3300027683\|Ga0209392_1261535	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300027877\|Ga0209293_10106431	Not Available	1278	Open in IMG/M
3300027886\|Ga0209486_10253690	Not Available	1018	Open in IMG/M
3300027899\|Ga0209668_10313597	Not Available	1010	Open in IMG/M
3300028380\|Ga0268265_10372836	Not Available	1310	Open in IMG/M
3300030002\|Ga0311350_10819404	Not Available	834	Open in IMG/M
3300030294\|Ga0311349_10181038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1982	Open in IMG/M
3300031713\|Ga0318496_10789409	Not Available	523	Open in IMG/M
3300031726\|Ga0302321_100388679	Not Available	1516	Open in IMG/M
3300031824\|Ga0307413_11293194	Not Available	638	Open in IMG/M
3300031896\|Ga0318551_10828771	Not Available	538	Open in IMG/M
3300031939\|Ga0308174_10590031	Not Available	918	Open in IMG/M
3300031996\|Ga0308176_10828621	Not Available	968	Open in IMG/M
3300032053\|Ga0315284_12101135	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300032067\|Ga0318524_10337039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	782	Open in IMG/M
3300032090\|Ga0318518_10373959	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300032163\|Ga0315281_10629351	Not Available	1126	Open in IMG/M
3300032164\|Ga0315283_11653267	Not Available	650	Open in IMG/M
3300032173\|Ga0315268_12134453	Not Available	574	Open in IMG/M
3300032174\|Ga0307470_10145435	Not Available	1441	Open in IMG/M
3300032180\|Ga0307471_103503399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	555	Open in IMG/M
3300032205\|Ga0307472_101408938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	676	Open in IMG/M
3300032421\|Ga0310812_10247724	Not Available	783	Open in IMG/M
3300032516\|Ga0315273_11761781	Not Available	747	Open in IMG/M
3300032516\|Ga0315273_13229443	Not Available	504	Open in IMG/M
3300032783\|Ga0335079_10024801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6869	Open in IMG/M
3300032828\|Ga0335080_12314103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	514	Open in IMG/M
3300033406\|Ga0316604_10677965	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300033413\|Ga0316603_11860618	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300033413\|Ga0316603_12104584	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300033418\|Ga0316625_102320493	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300033433\|Ga0326726_10653976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1013	Open in IMG/M
3300033483\|Ga0316629_10233720	Not Available	1194	Open in IMG/M
3300033521\|Ga0316616_101358003	Not Available	913	Open in IMG/M
3300033521\|Ga0316616_104527656	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300033803\|Ga0314862_0033644	All Organisms → cellular organisms → Bacteria → Proteobacteria	1059	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.08%
Host-Associated	Host-Associated	29.13%
Engineered	Engineered	0.79%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.76%
Plants	Host-Associated → Plants	29.13%
Aquatic	Environmental → Aquatic	17.32%
Wastewater	Engineered → Wastewater	0.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	49.61%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.54%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.81%
Freshwater	Environmental → Aquatic → Freshwater	11.02%
Marine	Environmental → Aquatic → Marine	3.15%
Sediment	Environmental → Aquatic → Sediment	3.15%
Peat	Environmental → Terrestrial → Peat	3.15%
Roots	Host-Associated → Plants → Roots	0.79%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.24%
Loam	Environmental → Terrestrial → Soil → Loam	9.45%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.66%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.30%
Lake	Environmental → Aquatic → Freshwater → Lake	4.72%
Wetlands	Environmental → Aquatic → Marine → Wetlands	3.15%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.15%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.15%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.36%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.57%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.57%
Ice	Environmental → Aquatic → Freshwater → Ice	0.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.79%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.79%
Mine Water	Engineered → Wastewater → Industrial Wastewater → Mine Water	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.24%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.30%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.51%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.15%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.15%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.15%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.36%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.57%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.57%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	1.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.79%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.79%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.79%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	7.09%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.51%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.15%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.15%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.15%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.94%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.36%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.36%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.36%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.36%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.36%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.36%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.57%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.57%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.57%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.57%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.57%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.57%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.79%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.79%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.79%
Marine	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine	0.79%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.79%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.79%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.79%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.79%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.79%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.79%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.79%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.79%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.79%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.79%
Sediment	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000124	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001664	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled	Environmental	Open in IMG/M
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental	Open in IMG/M
3300004000	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012227	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013232	Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1	Engineered	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300015203	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017787	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025966	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)	Host-Associated	Open in IMG/M
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F065900

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deepsgr_02611620	2199352025	Soil	DLSKGIPGGGEVPIKLFIDASATIQAGYTLYMFYP
BS_KBA_SWE12_21mDRAFT_101332561	3300000124	Marine	ADYASGIADTAKGIPANAEVPVKLFIDASATTQAGYRLYLFFP*
INPhiseqgaiiFebDRAFT_1003052462	3300000364	Soil	LQNGIAANGEAVVRLFIDASATSQAGYRLYLFYP*
JGIcombinedJ13530_1095751632	3300001213	Wetland	ADIAAGIPANGEVAVKLFIDASATTQAGYRLYLFYP*
P5cmW16_10723252	3300001664	Permafrost	DLDSGIAGNTELAVKLFIDASTTSQAGYQVYLFYP*
Ga0031653_100198601	3300003859	Freshwater Lake Sediment	ADYAGGTADVQQGIPPNGEVAVKVFIDASATTQAGYRLYMFYP*
Ga0055458_102639461	3300004000	Natural And Restored Wetlands	REYAGGTADLARGIPANADVAIKLFIDASATAQAGYRLYLFYG*
Ga0062591_1001342962	3300004643	Soil	YAGGTTDLSRGIAANGEVALKVFIDASATSQAGYRLYMFYP*
Ga0066672_107110862	3300005167	Soil	EYISGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP*
Ga0066685_103079461	3300005180	Soil	SGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP*
Ga0070682_1003903391	3300005337	Corn Rhizosphere	AGGTADIGGGIPANGESVVRLFIDASATQQAGYRLYLFYP*
Ga0070689_1008744951	3300005340	Switchgrass Rhizosphere	PADYAGGTADLQKGIASNAEVAVKIFIDASATTQAGYRLYMFYP*
Ga0070661_1005111001	3300005344	Corn Rhizosphere	PAEYASGSADLAAGIPPNGEHVVRMFLDASATQQAGYRVYLFYP*
Ga0070661_1007352262	3300005344	Corn Rhizosphere	GEYAAAGADPARGIPANGENVVTLFVDASETSQAGYRLYLFYP*
Ga0070709_114112891	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	AFEPGDYAAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP*
Ga0070681_115223331	3300005458	Corn Rhizosphere	AEYASGSADLAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP*
Ga0070706_1013290681	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	ASGTADTAAGIGRNGEVPVKLFIDASATSQAGYRLYLFFP*
Ga0070672_1005877872	3300005543	Miscanthus Rhizosphere	SGTADITNGIPANGEVLVKLFIDASATNQAGYRLYLFYP*
Ga0068855_1012653971	3300005563	Corn Rhizosphere	VEYAGGTADLGAGIAANSEVLIKMFLDASATSQAGYRLYLFYL*
Ga0068861_1018435041	3300005719	Switchgrass Rhizosphere	PSEYAGGTADFAHGIAANGEAVVRLFIDASATTQAGYRLYLFYP*
Ga0068862_1020218201	3300005844	Switchgrass Rhizosphere	DRVVVRRALGPTDYAAGTADIARGIAGQAEISLKVFIDASATTQAGYRLYMFYP*
Ga0068862_1026458222	3300005844	Switchgrass Rhizosphere	GGTADLQRGIGPNAEASIKMFIDASASAQAGYRLYMFYP*
Ga0070766_112937481	3300005921	Soil	VNGAADLGNGIAGGGELNVKLFIDASATTQAGYQVYLFYP*
Ga0079037_1024582812	3300006224	Freshwater Wetlands	GTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP*
Ga0097621_1017460542	3300006237	Miscanthus Rhizosphere	AGGTANLGAGIQANSEVLVKMFIDASATTQAGYRLYLFYP*
Ga0079222_100959591	3300006755	Agricultural Soil	ARGTSELAAGIPANGEVLVKLFIDASATSQAGYRLSFFYP*
Ga0066665_108025012	3300006796	Soil	RRVLTPSEYAGGTLDLSKGIPANGEVPIKLFIDASATTQAGYTVYMFYP*
Ga0066660_101422803	3300006800	Soil	APGEYISGAADPAIGIAGNTELQVKLFIDASATTQAGYQVYLFYP*
Ga0075434_1016911181	3300006871	Populus Rhizosphere	YASGSLNFATGFPANSEVLVKTFIDASATTQAGYRLYLYYP*
Ga0075424_1010720272	3300006904	Populus Rhizosphere	NEYASGTAEIAGGIPANGEVLVKLFIDASATMQAGYRLYLFYP*
Ga0079219_101376401	3300006954	Agricultural Soil	TADIAGGIPANGEAVVRLFIDASATQQAGYRLYLFYP*
Ga0105247_111445011	3300009101	Switchgrass Rhizosphere	TTNTGAGIGANGEVPVKLFIDASATSQAGYRLYLFFP*
Ga0115027_109080551	3300009131	Wetland	YIGATLDPGRGIPANGEVAVRVFVDASATVQSGYRVYLFYP*
Ga0075423_119633732	3300009162	Populus Rhizosphere	GGTVDFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP*
Ga0113563_110095702	3300009167	Freshwater Wetlands	ALAPPEYAGGTVDVASGIARNGEVAVKLFVDASATSQAGYRVYLFYP*
Ga0105241_102315643	3300009174	Corn Rhizosphere	GEYLSGAANLDGGIAGNAELTVKLFIDASTTSQAGYQVYLFYP*
Ga0105249_118435181	3300009553	Switchgrass Rhizosphere	ADLGAGIAANSEVLIKMFLDASATSQAGYRLYLFYL*
Ga0105249_120470451	3300009553	Switchgrass Rhizosphere	APTDYAGGTTDLSRGIAANGEVALKVFIDASTTSQAGYRLYMFYP*
Ga0126380_104339021	3300010043	Tropical Forest Soil	LESGIRGNAELSIKLFIDASATTQAGYQVYLFYP*
Ga0126370_101787941	3300010358	Tropical Forest Soil	SPQEYVGGTVDLDSGIPANGELNVKLFIDASATTQAGYQVYLFYP*
Ga0126372_115039041	3300010360	Tropical Forest Soil	DYAGGTSDLQRGIAPNAEVAVKMFIDASATTQAGYRLYMFYP*
Ga0126383_131755642	3300010398	Tropical Forest Soil	VDLASGMPGNGELNVKLFIDASATTQAGYQVYLFYP*
Ga0134122_125259592	3300010400	Terrestrial Soil	YVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP*
Ga0137364_110146282	3300012198	Vadose Zone Soil	IANGIPANGEVLVKLFVDASATTQAGYRLYLFYP*
Ga0137380_110703212	3300012206	Vadose Zone Soil	VSGAADIDSGLPPNAELNVKLFIDASATTQAGYQVYLFYP*
Ga0137449_10325171	3300012227	Soil	ADLEGGIAPNGEIAFKVFIDASATTQAGYRLYMFYP*
Ga0137387_111317271	3300012349	Vadose Zone Soil	DEYASGAADISSGISANSELAVKVFIDASATTQAGYQVYLFYP*
Ga0157295_101301212	3300012906	Soil	DFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP*
Ga0164302_116780761	3300012961	Soil	PREGIPANGERLVKLFIDASATQQAGYQLYLFYP*
Ga0164304_111062092	3300012986	Soil	GEYLSGAANLDSGIAGNAELTVKLFIDASTTSQAGYQVYLFYP*
Ga0157373_109202722	3300013100	Corn Rhizosphere	YAPARAGGIAGNGEFVVTLFLDASATSQAGYRLYLFYP*
Ga0157370_116887621	3300013104	Corn Rhizosphere	IRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP*
Ga0170573_110886512	3300013232	Sediment	MCLSPQVDVVAGIAPNTEAPIKLFIDASATTQAGYRLYAFYP*
Ga0157374_126817761	3300013296	Miscanthus Rhizosphere	ADAAGGIAGNGELAVKLFIDASATTQAGYQVYLFYP*
Ga0157378_119600511	3300013297	Miscanthus Rhizosphere	ADYAGGTADLQRGIASNGEAAVKVFIDASATAQAGYRLYMFYP*
Ga0163162_111025132	3300013306	Switchgrass Rhizosphere	VRLALAPTEYAGGTTDLASGIPGNSEFAIKLFIDASATSQAGYTVVLFYP*
Ga0075342_11238151	3300014320	Natural And Restored Wetlands	YAGGTADVAGGIPANAEVVVRLFVDASATRQAGYRLFLFYP*
Ga0167650_10636431	3300015203	Glacier Forefield Soil	IWVRGHARRVDYPGAVATLLRGISANGEMLVKLFIDASATTQAGYRLYLFYP*
Ga0132256_1038262871	3300015372	Arabidopsis Rhizosphere	SGTVNTVTGIPANGEIPVKLFIDASATVQAGYRLYLFFP*
Ga0132255_1055118131	3300015374	Arabidopsis Rhizosphere	LQRGIASNGEASIKVFIDASATAQAGYRLYMFYP*
Ga0182038_103484531	3300016445	Soil	PQEYVGGTVDLASGIPGNGELNVKLFIDASATTQAGYQVYVFYP
Ga0183260_106224611	3300017787	Polar Desert Sand	RALAPPDYMRGIVDLTHGIPGNGEAQVKLFVDASATTQAGYRLYLFFP
Ga0163161_109881442	3300017792	Switchgrass Rhizosphere	SPTDYVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP
Ga0184632_104060611	3300018075	Groundwater Sediment	SEYISGAADPALGIAGNTELPVKLFIDASATTQAGYQVYLFYP
Ga0184632_104410021	3300018075	Groundwater Sediment	GAADLGSGLAGNAELNVKLFIDASATTQAGYQVYLFYP
Ga0190274_102581881	3300018476	Soil	NAAVGIPGNGEVPVRLFIDASATSQAGYRLYLFFP
Ga0066669_103172163	3300018482	Grasslands Soil	SGAANLDSGVAGNAELTVKLFIDASTTSQAGYQVYLFYP
Ga0173482_105086352	3300019361	Soil	ASGSADIAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP
Ga0210401_106474683	3300020583	Soil	PQEYVSGAANLDNGIPGNGELNVKLFIDASATSQAGYQVYLFYP
Ga0210384_108859401	3300021432	Soil	DLESGIPGNAELSVKLFIDASATTQAGYQVYLFYP
Ga0222622_110240661	3300022756	Groundwater Sediment	GTADLATGIAGNAEVGIKLFIDASATTQAGYQVYLFYP
Ga0207692_108364581	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	DPAAGIPGNGENVVKLFLDASTTAQAGYRLYLFYP
Ga0207642_100376531	3300025899	Miscanthus Rhizosphere	NLDAGIAGNAELTVKLFIDASTTSQAGYQVYLFYP
Ga0207710_106901471	3300025900	Switchgrass Rhizosphere	TTNTGAGIGANGEVPVKLFIDASATSQAGYRLYLFFP
Ga0207699_110705741	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	AFEPGDYAAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP
Ga0207684_114497321	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	ASGTADTAAGIGRNGEVPVKLFIDASATSQAGYRLYLFFP
Ga0207663_106933521	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	LPRLYAGGTADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP
Ga0207649_108209702	3300025920	Corn Rhizosphere	LSGAANLDSGIAGNAELTVKLFIDASTTSQAGYQVYLFYP
Ga0207652_110233252	3300025921	Corn Rhizosphere	RASDPAAGIPGNGENVVKLFLDASTTAQAGYRLYLFYP
Ga0207700_117884252	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	AAADIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP
Ga0207701_105004212	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	AGGTADPHQGIPPNGERIIRMFLDASATQQAGYRLYLFYP
Ga0207690_100247365	3300025932	Corn Rhizosphere	TADIGGGIPANGESVVRLFIDASATQQAGYRLYLFYP
Ga0207690_107443411	3300025932	Corn Rhizosphere	YAAAGADPARGIPANGENVVTLFVDASETSQAGYRLYLFYP
Ga0207667_119410362	3300025949	Corn Rhizosphere	LAPTEYARGTSELAAGIPANGEVLVKLFIDASATSQAGYRLSFFYP
Ga0207651_119818632	3300025960	Switchgrass Rhizosphere	ALAPADYAGGTADLQRGIAPNAEASIKVFIDASASTQAGYRLYMFYP
Ga0210105_10055332	3300025966	Natural And Restored Wetlands	GGTVDVGAGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0207639_110232762	3300026041	Corn Rhizosphere	ADFHAGIAVNGERLVKLFIDASATQQAGYQLYLFYP
Ga0207639_117936922	3300026041	Corn Rhizosphere	DIRQGIAGNGEQVVTLVLDASATLQAGYRLYLFYP
Ga0207641_102160402	3300026088	Switchgrass Rhizosphere	TADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP
Ga0207641_106586553	3300026088	Switchgrass Rhizosphere	YASGTVDVSRGILGGSEMPIKMFVDASATSQAGYRLYLFYP
Ga0210000_10806332	3300027462	Arabidopsis Thaliana Rhizosphere	EYASGSADLAAGIPANGEHVVRMFLDASATQQAGYRVYLFYP
Ga0209392_12615351	3300027683	Freshwater Sediment	ALAPPEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0209293_101064311	3300027877	Wetland	PEYAGGTVDVESGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0209486_102536901	3300027886	Agricultural Soil	PAEYAGGTANVRAGIAGNGELAVKLFIDASATTQSGYRVYLFYP
Ga0209668_103135972	3300027899	Freshwater Lake Sediment	AGGTADLGGGIAPNGEIALKVFIDASATSQAGYRLYMFYP
Ga0268265_103728362	3300028380	Switchgrass Rhizosphere	PTDYVSGTANAAAGIGANGEVPVKLFIDASATTQAGYRLFLFFP
Ga0311350_108194041	3300030002	Fen	GEYAGGTADLATGIPANGEAAVKLFIDASATTQAGYRLYLFYP
Ga0311349_101810383	3300030294	Fen	AADPRAGIPGNTELAVKLFVDASATSQAGYQVYLFYP
Ga0318496_107894091	3300031713	Soil	DIANGIAGNGEVVVKLFIDASATTQSGYLLYLFYP
Ga0302321_1003886791	3300031726	Fen	APADYAGALDLAKGIPPDGEIPIKLFIDASATTQAGYYLYMFYP
Ga0307413_112931941	3300031824	Rhizosphere	SDYAGGTADVAGGIAANGEALVRLFIDASATTQAGYRLYLFYP
Ga0318551_108287711	3300031896	Soil	YVSGTADIANGIAGNGEVVVKLFIDASATTQSGYLLYLFYP
Ga0308174_105900312	3300031939	Soil	GTADLAAGMAANGERLVKLFIDASATQQAGYQLYLFYP
Ga0308176_108286211	3300031996	Soil	SEYAGGTADVATGIAANGEAVVRLFIDASATSQAGYRLYLFYP
Ga0315284_121011352	3300032053	Sediment	ADLGGGIAANEEVAFKVFIDASATTQAGYRLYMFYP
Ga0318524_103370392	3300032067	Soil	RAFTPQEYVGGTVDLENGIAGNGELNVKLFIDASATTQAGYQVYLFYP
Ga0318518_103739591	3300032090	Soil	DYAGGTADLQRGIAPNAEASVKVFIDASATTQAGYRLYMFYP
Ga0315281_106293512	3300032163	Sediment	VRRALAPVDYAGGTADLLRGIGPNGEVALKVFIDASATTQAGYRLYMFYP
Ga0315283_116532671	3300032164	Sediment	SEYAGGTADLTAGIPANGEVAIKVFIDASATAQAGYRVYLFYA
Ga0315268_121344532	3300032173	Sediment	DLEGGIAPNGEVAFKVFIDASATSQAGYRLYMFYP
Ga0307470_101454352	3300032174	Hardwood Forest Soil	ADYVGGTTDLSRGIAANGEVALKVFIDASATSQAGYRLYMFYP
Ga0307471_1035033991	3300032180	Hardwood Forest Soil	DLDNGIPGNGELNVKLFVDASATTQAGYQVYLFYP
Ga0307472_1014089382	3300032205	Hardwood Forest Soil	PQEYVSAAADLDNGIPGNGELNVKLFVDASATTQAGYQVYLFYP
Ga0310812_102477242	3300032421	Soil	ADFQQGIAANGERLVKLFIDASATQQAGYQLYLFYP
Ga0315273_117617811	3300032516	Sediment	SDYAGGAADLTKGIAPNAEVPVKLFIDASATSQAGYYLYMFYP
Ga0315273_132294431	3300032516	Sediment	YAGGTADLQRGISPNGEVAVKVFIDASATSQAGYRLYMFYP
Ga0335079_100248018	3300032783	Soil	TPQEYLSGTVDLASGIPANAEVNVKLFIDASATTQAGYQVYLFYP
Ga0335080_123141032	3300032828	Soil	QEYLSGKVDLASGIPGNGELNVKLFIDASATNQAGYQVYLFYP
Ga0316604_106779651	3300033406	Soil	LAPPEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0316603_118606181	3300033413	Soil	APQEYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0316603_121045841	3300033413	Soil	GGTVDVGAGIGRNGEVAVKLFVDASATTQAGYRVYLFYP
Ga0316625_1023204931	3300033418	Soil	VVRRALTPAEYVGGTVDLARGIPANSDIAVKLFIDASATTQAGYRLFLFYG
Ga0326726_106539761	3300033433	Peat Soil	EYVSGAADLDSGLRGNAELNIKLFIDASATTQAGYQVYLFYP
Ga0316629_102337202	3300033483	Soil	GGTADVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0316616_1013580032	3300033521	Soil	VVVRRALAPPEYAGGTVDVVSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0316616_1045276561	3300033521	Soil	EYAGGTVDVGSGIARNGEVAVKLFIDASATTQAGYRVYLFYP
Ga0314862_0033644_914_1036	3300033803	Peatland	LSGAADPGNGFAANSELAIKLFIDASATSQAGYQVYLFYP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign