NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065576

Metagenome / Metatranscriptome Family F065576

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065576
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 38 residues
Representative Sequence MKRLIASVVLAIALLTSGAVVTQSSLVGTAYADSGGGE
Number of Associated Samples 77
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.61 %
% of genes near scaffold ends (potentially truncated) 18.11 %
% of genes from short scaffolds (< 2000 bps) 73.23 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(22.047 % of family members)
Environment Ontology (ENVO) Unclassified
(34.646 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.370 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00496SBP_bac_5 33.91
PF02954HTH_8 18.26
PF02776TPP_enzyme_N 3.48
PF00072Response_reg 0.87
PF00989PAS 0.87
PF01609DDE_Tnp_1 0.87
PF00158Sigma54_activat 0.87
PF17203sCache_3_2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.87
COG3293TransposaseMobilome: prophages, transposons [X] 0.87
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.87
COG5421TransposaseMobilome: prophages, transposons [X] 0.87
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.87
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.12 %
UnclassifiedrootN/A44.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101806268All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051383Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101806268All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051383Open in IMG/M
3300000550|F24TB_12370845Not Available506Open in IMG/M
3300000956|JGI10216J12902_101816064All Organisms → cellular organisms → Bacteria5788Open in IMG/M
3300003319|soilL2_10310448All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300003996|Ga0055467_10042314All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300005332|Ga0066388_103828323Not Available768Open in IMG/M
3300005719|Ga0068861_102330602Not Available537Open in IMG/M
3300005719|Ga0068861_102330602Not Available537Open in IMG/M
3300005764|Ga0066903_100729387All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300005764|Ga0066903_101801589Not Available1169Open in IMG/M
3300005764|Ga0066903_107583924Not Available559Open in IMG/M
3300005840|Ga0068870_10156756All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051346Open in IMG/M
3300005981|Ga0081538_10211152Not Available782Open in IMG/M
3300005985|Ga0081539_10247087Not Available795Open in IMG/M
3300006797|Ga0066659_11159272Not Available646Open in IMG/M
3300006845|Ga0075421_100107255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3512Open in IMG/M
3300006845|Ga0075421_100780012All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1102Open in IMG/M
3300006845|Ga0075421_101733370All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300006846|Ga0075430_100652087All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05868Open in IMG/M
3300006852|Ga0075433_11652843Not Available552Open in IMG/M
3300006853|Ga0075420_100621357All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05932Open in IMG/M
3300007255|Ga0099791_10345755Not Available712Open in IMG/M
3300009012|Ga0066710_100194824All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052878Open in IMG/M
3300009012|Ga0066710_100194824All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052878Open in IMG/M
3300009012|Ga0066710_100285163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2410Open in IMG/M
3300009038|Ga0099829_10080889All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300009038|Ga0099829_10468513Not Available1045Open in IMG/M
3300009089|Ga0099828_10992057Not Available748Open in IMG/M
3300009090|Ga0099827_10036101All Organisms → cellular organisms → Bacteria3616Open in IMG/M
3300009090|Ga0099827_10040018All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis3460Open in IMG/M
3300009090|Ga0099827_10040018All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis3460Open in IMG/M
3300009090|Ga0099827_10098139All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300009090|Ga0099827_10525575All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1017Open in IMG/M
3300009094|Ga0111539_10008220All Organisms → cellular organisms → Bacteria13280Open in IMG/M
3300009094|Ga0111539_10008220All Organisms → cellular organisms → Bacteria13280Open in IMG/M
3300009094|Ga0111539_10217304All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300009137|Ga0066709_100133798All Organisms → cellular organisms → Bacteria3131Open in IMG/M
3300009143|Ga0099792_10552599Not Available728Open in IMG/M
3300009143|Ga0099792_10810723All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05614Open in IMG/M
3300009147|Ga0114129_12773117Not Available583Open in IMG/M
3300009444|Ga0114945_10029190All Organisms → cellular organisms → Bacteria2960Open in IMG/M
3300009444|Ga0114945_10852745Not Available560Open in IMG/M
3300009691|Ga0114944_1008823All Organisms → cellular organisms → Bacteria3287Open in IMG/M
3300009691|Ga0114944_1011574All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052936Open in IMG/M
3300009691|Ga0114944_1060331All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051402Open in IMG/M
3300009691|Ga0114944_1071625Not Available1296Open in IMG/M
3300009821|Ga0105064_1102781Not Available587Open in IMG/M
3300009822|Ga0105066_1070903Not Available747Open in IMG/M
3300010046|Ga0126384_11269117Not Available682Open in IMG/M
3300010047|Ga0126382_10142107Not Available1629Open in IMG/M
3300010047|Ga0126382_10400201All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051071Open in IMG/M
3300010047|Ga0126382_10564179Not Available929Open in IMG/M
3300010047|Ga0126382_11145355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria693Open in IMG/M
3300010047|Ga0126382_11591642Not Available605Open in IMG/M
3300010047|Ga0126382_12006360Not Available551Open in IMG/M
3300010360|Ga0126372_10317735All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300010362|Ga0126377_10076307All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052997Open in IMG/M
3300010366|Ga0126379_10438690All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300010366|Ga0126379_11059345Not Available916Open in IMG/M
3300010366|Ga0126379_11059345Not Available916Open in IMG/M
3300010392|Ga0118731_114614765Not Available544Open in IMG/M
3300010398|Ga0126383_10138431All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052251Open in IMG/M
3300010398|Ga0126383_10138431All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052251Open in IMG/M
3300010398|Ga0126383_13361031Not Available523Open in IMG/M
3300011269|Ga0137392_11486912Not Available536Open in IMG/M
3300011440|Ga0137433_1016638Not Available2141Open in IMG/M
3300012189|Ga0137388_10598734Not Available1025Open in IMG/M
3300012204|Ga0137374_10014581All Organisms → cellular organisms → Bacteria → Proteobacteria9093Open in IMG/M
3300012205|Ga0137362_10247130All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300012206|Ga0137380_10145242All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300012207|Ga0137381_10071412All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis2903Open in IMG/M
3300012209|Ga0137379_10060067All Organisms → cellular organisms → Bacteria → Proteobacteria3661Open in IMG/M
3300012209|Ga0137379_10178678All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300012356|Ga0137371_10279713Not Available1301Open in IMG/M
3300012356|Ga0137371_10871218Not Available685Open in IMG/M
3300012361|Ga0137360_11201431Not Available656Open in IMG/M
3300012930|Ga0137407_12215225Not Available525Open in IMG/M
3300012944|Ga0137410_10225660All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300012948|Ga0126375_10726616Not Available776Open in IMG/M
3300012948|Ga0126375_11120150Not Available650Open in IMG/M
3300012948|Ga0126375_11417090Not Available590Open in IMG/M
3300012948|Ga0126375_11827956Not Available531Open in IMG/M
3300013306|Ga0163162_10357228All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300013308|Ga0157375_12248055All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300015241|Ga0137418_10032104Not Available4862Open in IMG/M
3300018056|Ga0184623_10034658All Organisms → cellular organisms → Bacteria2282Open in IMG/M
3300018063|Ga0184637_10079821All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300018079|Ga0184627_10652262Not Available521Open in IMG/M
3300018082|Ga0184639_10262602All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300019232|Ga0180114_1284915Not Available604Open in IMG/M
3300019232|Ga0180114_1284915Not Available604Open in IMG/M
3300019249|Ga0184648_1234667Not Available616Open in IMG/M
3300019249|Ga0184648_1234667Not Available616Open in IMG/M
3300019249|Ga0184648_1365637Not Available552Open in IMG/M
3300019259|Ga0184646_1047203Not Available619Open in IMG/M
3300019259|Ga0184646_1213050All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051256Open in IMG/M
3300020063|Ga0180118_1212083Not Available730Open in IMG/M
3300020065|Ga0180113_1122301All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05727Open in IMG/M
3300022563|Ga0212128_10030856All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D053452Open in IMG/M
3300022563|Ga0212128_10030856All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D053452Open in IMG/M
3300022563|Ga0212128_10099938All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300022563|Ga0212128_10101394All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051859Open in IMG/M
3300022563|Ga0212128_10128589All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051635Open in IMG/M
3300022563|Ga0212128_10243260All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300022563|Ga0212128_10273717All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1064Open in IMG/M
3300022563|Ga0212128_10298026All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300022563|Ga0212128_10454780Not Available787Open in IMG/M
3300022563|Ga0212128_10702436Not Available606Open in IMG/M
(restricted) 3300023208|Ga0233424_10164954Not Available912Open in IMG/M
3300025910|Ga0207684_10919005Not Available735Open in IMG/M
3300025961|Ga0207712_10873361Not Available794Open in IMG/M
3300025961|Ga0207712_10873361Not Available794Open in IMG/M
3300026035|Ga0207703_12189637Not Available529Open in IMG/M
3300027882|Ga0209590_10041884All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2500Open in IMG/M
3300027882|Ga0209590_10328073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria985Open in IMG/M
3300027909|Ga0209382_10348819All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300027961|Ga0209853_1008730All Organisms → cellular organisms → Bacteria → Proteobacteria3137Open in IMG/M
3300028536|Ga0137415_10378788All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1219Open in IMG/M
3300030592|Ga0247612_1027108All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300030619|Ga0268386_10104134All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D052194Open in IMG/M
3300031094|Ga0308199_1004755All Organisms → cellular organisms → Bacteria1791Open in IMG/M
3300031421|Ga0308194_10024633All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051357Open in IMG/M
3300031562|Ga0310886_10708282Not Available627Open in IMG/M
3300034643|Ga0370545_011787All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051336Open in IMG/M
3300034643|Ga0370545_011787All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051336Open in IMG/M
3300034659|Ga0314780_124506Not Available612Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.96%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs12.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.66%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment7.09%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.79%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.79%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10180626813300000364SoilRLIASVVVVVALLTSGVVVTQSRLVGTAYADSGGD*
INPhiseqgaiiFebDRAFT_10180626823300000364SoilMRRLIASVVIAIALLTSGAVVPQARLLGTAYADSGSE*
F24TB_1237084513300000550SoilRLVATIMLSIALLTSGAVVTQSSLVGTAYAEAAGGSE*
JGI10216J12902_10181606473300000956SoilMKRLIISVVLAIVLLTSGAVVPQSNLVSAAYADEGGGE*
soilL2_1031044823300003319Sugarcane Root And Bulk SoilMKRLVASVILAVALLASGVVVTQSGLVGIAYADDGGGSD*
Ga0055467_1004231423300003996Natural And Restored WetlandsMKRIFASILLAVALLTAGVTTTQYSLVGAAYADGDCGDF*
Ga0066388_10382832323300005332Tropical Forest SoilMKLLIVNILLAIALLTSGVVVPQSNLVGTAYAESDGGSD*
Ga0068861_10233060213300005719Switchgrass RhizosphereMKRLIASVVLAIALLTSGAVVPQASLVGTAYADGDGGGD*
Ga0068861_10233060223300005719Switchgrass RhizosphereMKRLIASVVVVVALLTSGAVVPQASLVGTAYADGDGGGD*
Ga0066903_10072938713300005764Tropical Forest SoilMKRLIASVVLAIALLTSGVVATQYTMVGTAYADSGGGD*
Ga0066903_10180158933300005764Tropical Forest SoilMKRLIASVVLAIALLTSGVVVTQYNMVGTAYADGSGE*
Ga0066903_10758392413300005764Tropical Forest SoilMIMKRLIASVVLAIALLTSGVVVTQYSMVGIAHADGGDGG*
Ga0068870_1015675613300005840Miscanthus RhizosphereKPQGELAMKRLITSVLLAVALLTSGLVVTHSGIVGMAYADDGGGE*
Ga0081538_1021115223300005981Tabebuia Heterophylla RhizosphereMKRFVASMLLAIALLTSGLVVTQYDMVGTAYADDGAGSD*
Ga0081539_1024708723300005985Tabebuia Heterophylla RhizosphereMKRLIVSVILAIVLFTSGAVVPQSSLVGTAYAEEGGSE*
Ga0066659_1115927223300006797SoilMKRLIVSVLLAIILVTSGAATTQHSMVGTAYADDGRGGD*
Ga0075421_10010725533300006845Populus RhizosphereVATIVLAIALLTSGMAVTQSSLVGTAYADEGGSD*
Ga0075421_10078001243300006845Populus RhizosphereMKRLVATIVLAIALLTSGMAVTQSSLVGTAYADEGG
Ga0075421_10173337013300006845Populus RhizosphereGTMKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE*
Ga0075430_10065208723300006846Populus RhizosphereMKRIIASILLALALLTSGAMGTQYNMTGIAYADAGGGDF*
Ga0075433_1165284313300006852Populus RhizosphereMKRLICGVVLAIVLLTSGAVVPQASLVGSAYADDCGGE
Ga0075420_10062135723300006853Populus RhizosphereMKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE*
Ga0099791_1034575513300007255Vadose Zone SoilMKRFMASVVLAIALLTSGVVVTQYSMVGTAYADGDSGD*
Ga0066710_10019482423300009012Grasslands SoilMKRLIASVLLAFTLLTSGMGVTQYNMVGTAYANGGE
Ga0066710_10019482433300009012Grasslands SoilMKRFIASVVLAIALLTSGVAVTQYSMVGTVYANGGE
Ga0066710_10028516323300009012Grasslands SoilMKRLILSVVLSIALLTSSMVATQSSLVGTAYADDGGGE
Ga0099829_1008088923300009038Vadose Zone SoilMKRLIASVVLAIALLTSGAVLTQHSMVGTAYADGCGD*
Ga0099829_1046851323300009038Vadose Zone SoilMKRLIASVVLAIALLTSGAVVTQSSLVGTAYADSGGGE*
Ga0099828_1099205723300009089Vadose Zone SoilMKRFITSVVLAIALLTSGVVVTQYSMVGTAYADGDDGA*
Ga0099827_1003610123300009090Vadose Zone SoilMKRLISIIVLAIALLTSGVVVTQSSLVGTAYAGNAAGGGD*
Ga0099827_1004001823300009090Vadose Zone SoilMKRFIASVVLAIALLTSGVVVTQYSMVGTAYADDGAD*
Ga0099827_1004001833300009090Vadose Zone SoilMKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGAD*
Ga0099827_1009813923300009090Vadose Zone SoilMKRLMASVVLAIALLTSGVVVTQYSIVGTAYADSDGGAE*
Ga0099827_1052557513300009090Vadose Zone SoilMKRLIASVVLAIALLTSGVVVTQHSMVGTAYADGSGE*
Ga0111539_10008220113300009094Populus RhizosphereMKRLIASVVVVVALLTSGVVVTQSSLVGTAYADGGGD*
Ga0111539_10008220123300009094Populus RhizosphereMKRLIASVVVVVALLTSGAVVTQSNLVGTAYADGGGD*
Ga0111539_1021730433300009094Populus RhizosphereAGTMKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE*
Ga0066709_10013379833300009137Grasslands SoilMKKLIVSVLLAITLLMSGMVVTQYNMVGTAYADGGGDC*
Ga0099792_1055259923300009143Vadose Zone SoilMKRLIASVVLAIALLTSGAVVSQSSLVGTAYADGGGGE*
Ga0099792_1081072313300009143Vadose Zone SoilRLIASVVLAIALLTSGVVVTQHSMVGTAYADGSGE*
Ga0114129_1277311713300009147Populus RhizosphereMKRLLASVVLAIVLLTSGAVVPQSGLVGSAYADDCGGE*
Ga0114945_1002919023300009444Thermal SpringsMKRLIVSVVLAIALLTSGVVVTQHSMVGAAYADDSDGGG*
Ga0114945_1085274523300009444Thermal SpringsMNGDMIMKRLIASVVLAIALLTSGVVVTQSSLVGTAYADDSGD*
Ga0114944_100882323300009691Thermal SpringsMKRFIASVVLAIALLTSGVVVTQYNMVGTAYADDDPGE*
Ga0114944_101157433300009691Thermal SpringsMKRLIASVVLAIALLTSGVVVSQYSMIGTAYADDAAGD*
Ga0114944_106033123300009691Thermal SpringsMKRFIASVVLAIALLTSSAVVTQYSMVGTAYADGDSGE*
Ga0114944_107162513300009691Thermal SpringsMKRLIASVVLAIALLTSGMVVTQYSMVGTVYADDGGGM*
Ga0105064_110278113300009821Groundwater SandMKRFMASVVLAIALLTSSVVVTQYSMVGTAYADDSCGSD*
Ga0105066_107090323300009822Groundwater SandMKRFMASVVLAIVLLTSSVVVTQYSIVGTAYADGDAGAE*
Ga0126384_1126911713300010046Tropical Forest SoilMKGLVISVVLVIALFTTGAMVTQSSLVGTAYAESDGGS*
Ga0126382_1014210723300010047Tropical Forest SoilMKRLIASVVLAIALLTSGVVVTQYSMVGIAHADGGDGG*
Ga0126382_1040020123300010047Tropical Forest SoilLIASVVLAIALLTSSAVVTQFSLVGIAYADDGGGE*
Ga0126382_1056417923300010047Tropical Forest SoilMKILVVRIMLVIALLTSGGVVTQSRLVGTAYAGEGGGE*
Ga0126382_1114535523300010047Tropical Forest SoilMKRLIASVVVVVVLLTSGAVVTQSRLVGTAYAESGGGGD*
Ga0126382_1159164223300010047Tropical Forest SoilMKQFIVSVVLAIALLTSGVVVTQDPMVGVAYADGDGGE*
Ga0126382_1200636013300010047Tropical Forest SoilMKRFIASVLLAIALLTSGVVVTQYSMIGTAHADSGDGG*
Ga0126372_1031773523300010360Tropical Forest SoilRTSMKRLIASMLLAIALLTSGAVVTQSSLVGTAYAEGGGD*
Ga0126377_1007630743300010362Tropical Forest SoilMKRLIASVVIAIALLTSGAVVTQSKLVGTAYASDSGGD*
Ga0126379_1043869013300010366Tropical Forest SoilMKKLVVSLALAIILITSGVVVTQHSLVGTAYADGCGD*
Ga0126379_1105934513300010366Tropical Forest SoilMKRLIVSVILAITLLTSGVVVTQYSMVSTAQADSGGE
Ga0126379_1105934523300010366Tropical Forest SoilMRRFVASVILAIALLTSGTVVTQYNMVGTAQADSGGE*
Ga0118731_11461476523300010392MarineMKRLIATIMLAVALLTSGALVGQFDMLGTAYADGDGGE*
Ga0126383_1013843123300010398Tropical Forest SoilMKKLVVSIALAIILITSGVVVTQHSLVGTAYADGCGD*
Ga0126383_1013843133300010398Tropical Forest SoilMKKLVVSIVLAIILITSGVVVTQHSLVGTAYADGCGD*
Ga0126383_1336103123300010398Tropical Forest SoilMKRLIVSVVLAIVLLTSGAMVPQSSLVGTAYADGDGGDC*
Ga0137392_1148691213300011269Vadose Zone SoilMKRLIASVVLAIALLTSGAVVSQSSLVGTAYAEAGGD*
Ga0137433_101663883300011440SoilMKRLIVSVVLAISLLTAGVVATQYGLVGTASADGDAGGC*
Ga0137388_1059873413300012189Vadose Zone SoilMKRLIASVVLAIALLTSGAVVSQSSLVGTAYADDGGGF*
Ga0137374_1001458133300012204Vadose Zone SoilMKRFMASVILAIALLTSSVVVTQYSMVGTAHADGDAGSD*
Ga0137362_1024713023300012205Vadose Zone SoilMKRLIASVVLAIALLTSGVVVTQHSMVGTAHADGSGE*
Ga0137380_1014524233300012206Vadose Zone SoilMKRFIASVVLAIALLTSGAVVSQFSMVGVAYADDSG
Ga0137381_1007141233300012207Vadose Zone SoilMKRFIASVVLAIALLTSGVAVTQYSMVGTVYANGGE*
Ga0137379_1006006733300012209Vadose Zone SoilMKRLIASVVLAIALLTSGMVVTQSSLVGTAYADCSGGE*
Ga0137379_1017867813300012209Vadose Zone SoilMKRFIASVVLAIALLTSGAVVSQFSMVGAAYADDGGE*
Ga0137371_1027971323300012356Vadose Zone SoilMKRLILSVVLSIALLTSSMVVTQSSLVGTAYADDGGGE*
Ga0137371_1087121813300012356Vadose Zone SoilMVLENPNRRTVMKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGA
Ga0137360_1120143113300012361Vadose Zone SoilMKRLIASVVLAIALLTSGAVVSQSSLVGTAYADGGGGE
Ga0137407_1221522513300012930Vadose Zone SoilMKRFMASVVLAIALLTSSVVVTQYSMVGTTYAEESGSDN*
Ga0137410_1022566023300012944Vadose Zone SoilMKRLIASVVLAIALLTSGVVVTQHSMVGTAYADGCGE*
Ga0126375_1072661613300012948Tropical Forest SoilMKRLVVVIVTVIALLTSGVAVTQHSTVGTAYADAGGD*
Ga0126375_1112015013300012948Tropical Forest SoilMKRLVASIVLAIALLTSGAVVTQSRLVGTAYAEAGGD*
Ga0126375_1141709013300012948Tropical Forest SoilMKKLIASVLLAIALLTSGTVVTQSSLVGTAYADDGCGGD*
Ga0126375_1182795623300012948Tropical Forest SoilMKRLIASVVLAIVLLTSGVVVPQSNLVGTAYAESDGGTD*
Ga0163162_1035722823300013306Switchgrass RhizosphereMKRLIASVVLAIALLTSGAMVTQSSLVGTAYADDSGGE*
Ga0157375_1224805523300013308Miscanthus RhizosphereCTMKRLIASVVVVVALLTSGAVVTQSNLIGTAYAEDSGD*
Ga0137418_1003210423300015241Vadose Zone SoilMKRLIASVVLAIALLTSGVVVTQHSMVGTAYADAGGE*
Ga0184623_1003465843300018056Groundwater SedimentMKRLIATVLIAIALLTSGVVVTQYSMVGTAYADDSGGE
Ga0184637_1007982123300018063Groundwater SedimentMKQLIVSALLAIALLTSGMMVTPYSMVGTAYADGGEGSE
Ga0184627_1065226213300018079Groundwater SedimentMKRMIVSVLIAIALLTSGVVVTQYGMVGTAHAEGGDGG
Ga0184639_1026260223300018082Groundwater SedimentMKRMIVSVLIAIALLTSGVVVTQYGMVGTAYADEGGGD
Ga0180114_128491513300019232Groundwater SedimentMKRLIVSVVLAIALLTSGVVVTQDSMVGTAYADDGGGN
Ga0180114_128491523300019232Groundwater SedimentMKRLIVGVVLAIALLTSGVVVTQDSMVSTAYADDGGGN
Ga0184648_123466713300019249Groundwater SedimentMIVSVLLAIALLTSGVVVTQYRMVGTAYADGGDGGT
Ga0184648_123466723300019249Groundwater SedimentMKRFVASVLIAIALLTSGVVVTQYSMVGTAYADGDDGG
Ga0184648_136563713300019249Groundwater SedimentMKRLIASVVLAIALLTSGTVVTQYRLAGTAYADDGGGSE
Ga0184646_104720313300019259Groundwater SedimentMKRLIASVLLAIALLTSGAAVTQSSMVGTAYADDGP
Ga0184646_121305013300019259Groundwater SedimentMVMKRFVASVLIAIALLTSGVVVTQYSMVGTAYADGGGGE
Ga0180118_121208313300020063Groundwater SedimentMKRLIASVLLAIALLTSGMVVTQYSMVGTVYADDGGGE
Ga0180113_112230123300020065Groundwater SedimentMKRFIASVLLAIALLTSGVVVTQYSMVGTAYADDGDGA
Ga0212128_1003085623300022563Thermal SpringsMQRLVVSMLVALALLASGVVVTQYSTVGTAYADDGDGGG
Ga0212128_1003085633300022563Thermal SpringsMKRLIASVVLAIALLTSGVVVSQYSMIGTAYADDAAGD
Ga0212128_1009993823300022563Thermal SpringsMKRFIASVVLAIALLTSGVVVTQYNMVGTAYADDDPGE
Ga0212128_1010139433300022563Thermal SpringsMKRLIVSVVLAIALLTSGVVVTQHSMVGAAYADDSDGGG
Ga0212128_1012858923300022563Thermal SpringsMKRFIASVVLAIALLTSSAVVTQYSMVGTAYADGDSGE
Ga0212128_1024326023300022563Thermal SpringsLIVSVVLAIALLTSGAVVTQHSMVGTAYADDGDGGT
Ga0212128_1027371723300022563Thermal SpringsMKRLIASVVLAIALLTSGMVVTQYSMVGTVYADDGGGM
Ga0212128_1029802613300022563Thermal SpringsMKRFVASVLLAIALLTSGVVVTQYSMVGTAHADGSDGG
Ga0212128_1045478023300022563Thermal SpringsMNGDMIMKRLIASVVLAIALLTSSVMVTQYNMVGTAYADDSGE
Ga0212128_1070243613300022563Thermal SpringsMKRFIASVLVVLALLMSGVVVTQYSMVGIAHADGDDGGG
(restricted) Ga0233424_1016495423300023208FreshwaterMKRLIVSIMVAMALLTAGIAGTQHSFVGTAYADGGDGGGD
Ga0207684_1091900523300025910Corn, Switchgrass And Miscanthus RhizosphereMKRFIASVVLAIALLTSGVVVTQYSMVGTAYADDGAD
Ga0207712_1087336113300025961Switchgrass RhizosphereMKRLIASVVLAIALLTSGAVVPQASLVGTAYADGDGGGD
Ga0207712_1087336123300025961Switchgrass RhizosphereMKRLIASVVVVVALLTSGAVVPQASLVGTAYADGDGGGD
Ga0207703_1218963713300026035Switchgrass RhizosphereMKRLIASVVLAIALLTSGVMVTQSSLVGTAYADDSGGEXYMLA
Ga0209590_1004188423300027882Vadose Zone SoilMKRLISIIVLAIALLTSGVVVTQSSLVGTAYAGNAAGGGD
Ga0209590_1032807313300027882Vadose Zone SoilMKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGAD
Ga0209382_1034881923300027909Populus RhizosphereKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE
Ga0209853_100873033300027961Groundwater SandMKRFMASVVIAIVLLTSSVVVTQYSIVGTAYADGDAG
Ga0137415_1037878823300028536Vadose Zone SoilMKRLIASVVLAIALLTSGVVVTQHSMVGTAYADAGGE
Ga0247612_102710823300030592SoilMKRLIASVVLAIALLTSGMVATQYGLVGTAYADDGGGTD
Ga0268386_1010413423300030619SoilMKKFVATVLLAVALLTSGVVVTQYGMVGTAHADDGGGEG
Ga0308199_100475523300031094SoilMKRLIASVFLALALLTSGVVVTQYSMVGIAYADDGGGN
Ga0308194_1002463323300031421SoilMKRLIVSVVLAIALLTSGLAVTQYSMVGTAYADGGAE
Ga0310886_1070828213300031562SoilMKRLIASVVVVVALLTSGAVVTQSNLVGTAYADGGGD
Ga0370545_011787_1101_12173300034643SoilMKRVIVSVLLAIALLTSGVVVTQYGMVGTAYADEGGGS
Ga0370545_011787_922_10383300034643SoilMKQFVASVLLAIALLTSGVVVTQYGMVGTAYAEDDGGG
Ga0314780_124506_491_6103300034659SoilCTMKRLIASVVVVVALLTSGAVVPQSRLLGMAYADSGSD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.