NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065539

Metagenome / Metatranscriptome Family F065539

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065539
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 37 residues
Representative Sequence MRTYERPTLTKAGSFKKVTGLGGSGPRDFAFRHQSL
Number of Associated Samples 83
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.33 %
% of genes near scaffold ends (potentially truncated) 18.11 %
% of genes from short scaffolds (< 2000 bps) 78.74 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.315 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil
(12.598 % of family members)
Environment Ontology (ENVO) Unclassified
(30.709 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.008 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.31%    β-sheet: 0.00%    Coil/Unstructured: 79.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00733Asn_synthase 19.69
PF12728HTH_17 2.36
PF00664ABC_membrane 1.57
PF05402PqqD 1.57
PF04203Sortase 1.57
PF08241Methyltransf_11 0.79
PF14344DUF4397 0.79
PF135632_5_RNA_ligase2 0.79
PF01569PAP2 0.79
PF01243Putative_PNPOx 0.79
PF00005ABC_tran 0.79
PF13471Transglut_core3 0.79
PF12838Fer4_7 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 1.57

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.31 %
UnclassifiedrootN/A19.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101D0Q0MAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus523Open in IMG/M
2199352024|deeps__Contig_164244Not Available715Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100488628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300000550|F24TB_12704278Not Available543Open in IMG/M
3300000559|F14TC_101524247Not Available796Open in IMG/M
3300000789|JGI1027J11758_12398341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia773Open in IMG/M
3300000956|JGI10216J12902_104435219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia913Open in IMG/M
3300000956|JGI10216J12902_104704209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1093Open in IMG/M
3300000956|JGI10216J12902_110186289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300004479|Ga0062595_101734378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces590Open in IMG/M
3300005548|Ga0070665_100188839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2061Open in IMG/M
3300005562|Ga0058697_10023333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2187Open in IMG/M
3300005562|Ga0058697_10023352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus2186Open in IMG/M
3300005562|Ga0058697_10034786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1857Open in IMG/M
3300005562|Ga0058697_10101560Not Available1194Open in IMG/M
3300005562|Ga0058697_10118119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1122Open in IMG/M
3300005562|Ga0058697_10164077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus980Open in IMG/M
3300005562|Ga0058697_10242615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces836Open in IMG/M
3300005562|Ga0058697_10296009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces770Open in IMG/M
3300005562|Ga0058697_10531640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces davaonensis605Open in IMG/M
3300005562|Ga0058697_10617856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces davaonensis568Open in IMG/M
3300005563|Ga0068855_100269972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1892Open in IMG/M
3300005577|Ga0068857_100041741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4068Open in IMG/M
3300005764|Ga0066903_100009592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces9121Open in IMG/M
3300005764|Ga0066903_103485719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces848Open in IMG/M
3300005981|Ga0081538_10002448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia18155Open in IMG/M
3300005981|Ga0081538_10123684Not Available1236Open in IMG/M
3300005983|Ga0081540_1000634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia33445Open in IMG/M
3300005985|Ga0081539_10010810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7343Open in IMG/M
3300005985|Ga0081539_10269749All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300006031|Ga0066651_10237591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia966Open in IMG/M
3300006046|Ga0066652_101990428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces518Open in IMG/M
3300006804|Ga0079221_10375595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia870Open in IMG/M
3300006852|Ga0075433_10097976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2595Open in IMG/M
3300006854|Ga0075425_100110768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3129Open in IMG/M
3300009012|Ga0066710_100306629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2328Open in IMG/M
3300009137|Ga0066709_100269200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2294Open in IMG/M
3300009147|Ga0114129_10248786Not Available2387Open in IMG/M
3300009147|Ga0114129_10854078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1157Open in IMG/M
3300009789|Ga0126307_10023236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4708Open in IMG/M
3300009789|Ga0126307_10049135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces chartreusis3291Open in IMG/M
3300009789|Ga0126307_10201263Not Available1598Open in IMG/M
3300009789|Ga0126307_10544883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia937Open in IMG/M
3300009789|Ga0126307_11424585Not Available562Open in IMG/M
3300009789|Ga0126307_11428937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300009840|Ga0126313_10165455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1680Open in IMG/M
3300009840|Ga0126313_10649493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia852Open in IMG/M
3300009840|Ga0126313_10816872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus759Open in IMG/M
3300009840|Ga0126313_10973678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300010038|Ga0126315_10102096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces chartreusis1647Open in IMG/M
3300010041|Ga0126312_10079301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2223Open in IMG/M
3300010041|Ga0126312_11183612Not Available563Open in IMG/M
3300010042|Ga0126314_10249179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium1260Open in IMG/M
3300010045|Ga0126311_11562806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces554Open in IMG/M
3300010145|Ga0126321_1051757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus523Open in IMG/M
3300010145|Ga0126321_1137409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus502Open in IMG/M
3300010145|Ga0126321_1224816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300010147|Ga0126319_1164072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces588Open in IMG/M
3300010166|Ga0126306_11454833Not Available568Open in IMG/M
3300010401|Ga0134121_10415880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1219Open in IMG/M
3300011332|Ga0126317_10822736Not Available565Open in IMG/M
3300012206|Ga0137380_10238421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1642Open in IMG/M
3300012208|Ga0137376_11351747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus603Open in IMG/M
3300012209|Ga0137379_11570758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces davaonensis557Open in IMG/M
3300012224|Ga0134028_1028599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces davaonensis525Open in IMG/M
3300012350|Ga0137372_10035660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces4522Open in IMG/M
3300012350|Ga0137372_10042155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4102Open in IMG/M
3300012350|Ga0137372_10672184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces753Open in IMG/M
3300012350|Ga0137372_11151257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces davaonensis528Open in IMG/M
3300012351|Ga0137386_10584704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300012354|Ga0137366_10573077Not Available811Open in IMG/M
3300012469|Ga0150984_115701654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1351Open in IMG/M
3300012469|Ga0150984_121311606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces697Open in IMG/M
3300012937|Ga0162653_100043502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces chartreusis681Open in IMG/M
3300013307|Ga0157372_10518176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1390Open in IMG/M
3300014487|Ga0182000_10000175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11056Open in IMG/M
3300014487|Ga0182000_10018083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1827Open in IMG/M
3300014487|Ga0182000_10327093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus650Open in IMG/M
3300014487|Ga0182000_10482514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces572Open in IMG/M
3300014497|Ga0182008_10443968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus704Open in IMG/M
3300015077|Ga0173483_10995501Not Available502Open in IMG/M
3300015373|Ga0132257_100492985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1502Open in IMG/M
3300018075|Ga0184632_10170326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300018465|Ga0190269_12053539Not Available500Open in IMG/M
3300019254|Ga0184641_1361527Not Available540Open in IMG/M
3300019877|Ga0193722_1068219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces884Open in IMG/M
3300020081|Ga0206354_11218143All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300025915|Ga0207693_10235698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1437Open in IMG/M
3300025916|Ga0207663_10182409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300025920|Ga0207649_10238705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1304Open in IMG/M
3300025944|Ga0207661_10172011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1886Open in IMG/M
3300026535|Ga0256867_10009739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4207Open in IMG/M
3300027750|Ga0209461_10100183Not Available657Open in IMG/M
3300027809|Ga0209574_10351098Not Available515Open in IMG/M
3300028768|Ga0307280_10018605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1976Open in IMG/M
3300028875|Ga0307289_10049972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1671Open in IMG/M
3300028878|Ga0307278_10425205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces583Open in IMG/M
3300028880|Ga0307300_10129519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300030510|Ga0268243_1000092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria22665Open in IMG/M
3300030510|Ga0268243_1122235Not Available617Open in IMG/M
3300030511|Ga0268241_10201149Not Available506Open in IMG/M
3300030783|Ga0102752_1569067Not Available623Open in IMG/M
3300030903|Ga0308206_1155710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus553Open in IMG/M
3300030905|Ga0308200_1110794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces595Open in IMG/M
3300031091|Ga0308201_10371957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus530Open in IMG/M
3300031092|Ga0308204_10139076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus710Open in IMG/M
3300031228|Ga0299914_10062341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces3207Open in IMG/M
3300031548|Ga0307408_100799495Not Available856Open in IMG/M
3300031731|Ga0307405_10095042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1984Open in IMG/M
3300031731|Ga0307405_11615347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus572Open in IMG/M
3300031824|Ga0307413_10652655Not Available868Open in IMG/M
3300031901|Ga0307406_11433728Not Available606Open in IMG/M
3300031995|Ga0307409_100005542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7287Open in IMG/M
3300031995|Ga0307409_100185054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1848Open in IMG/M
3300031995|Ga0307409_100405875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1303Open in IMG/M
3300031995|Ga0307409_101111260Not Available812Open in IMG/M
3300032002|Ga0307416_100143051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2178Open in IMG/M
3300032002|Ga0307416_100151798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2126Open in IMG/M
3300032004|Ga0307414_11626079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300032126|Ga0307415_100201366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300032126|Ga0307415_100603058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia977Open in IMG/M
3300032126|Ga0307415_102301730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300032159|Ga0268251_10022227All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300032159|Ga0268251_10100197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1032Open in IMG/M
3300032159|Ga0268251_10362918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cupreus618Open in IMG/M
3300032174|Ga0307470_10042864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2256Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil12.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere11.81%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave11.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.15%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil3.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.57%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere1.57%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.79%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030783Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_011475802189573001Grass SoilMTPKGGAEMRTYERPTLTKAGSFKKVTGLGGSGPRDFAFRHQML
deeps_030275002199352024SoilMRTYERPTLTRAGSFKKLTGLGGSGPRDTLGRHQSP
INPhiseqgaiiFebDRAFT_10048862823300000364SoilMRTYERPTLTAAGSFVRLTGAGGSGPRDVLFKHQLI*
F24TB_1270427823300000550SoilMLPERRVSSVRIYERPTLLRAGSFRKVTGLGGSGPRDFAFRHQML*
F14TC_10152424723300000559SoilVRIYERPTLLRAGSFRKVTGLGGSGPRDFAFRHQML*
JGI1027J11758_1239834123300000789SoilMRTYERPTLTAAGSFVRLTGAGGXGPRDVLFKHQLI*
JGI10216J12902_10443521913300000956SoilRRPYERPTLTPAGSFKNVTGLGGSGPKDTLVRHQMF*
JGI10216J12902_10470420933300000956SoilMRTYERPTLTKAGSFKKVTGIGGSGPRDRLVRHQLT*
JGI10216J12902_11018628923300000956SoilRTYERPTLTKAGSFKKVTGLGGSGPRDFAFRHQSL*
Ga0062595_10173437823300004479SoilGTAMRTYERPTLTKAGSFKKLTGLGGSGPRDFAFRHQSL*
Ga0070665_10018883923300005548Switchgrass RhizosphereMRTYERPTLTRAGSFKQITGLGGSGPRDTLGRHQSL*
Ga0058697_1002333323300005562AgaveMRTYERPTLTPAGSFRRLTGESGWGPRDYILKHQRL*
Ga0058697_1002335253300005562AgaveMRPYERPTLTAAGSFKKVTGLGGHGPRDVTARHQML*
Ga0058697_1003478653300005562AgaveMRTYERPTLTPAGSFRRLTGLNGWGPRDSLYKHQML*
Ga0058697_1010156043300005562AgaveMRTYERPTLTPAGSFKELTGESGWGPRDVLCKHQRL*
Ga0058697_1011811923300005562AgaveMRTYERPTLTPAGSFKKLTGESGWGPRDYVLKHQRL*
Ga0058697_1016407723300005562AgaveMRTYERPTLTRLGSFKKVTGLGGSGPRDTLGRHQSL*
Ga0058697_1024261513300005562AgaveMRTYERPTLTKVGSFKKVTGEGGSGPRDFAVRHQLL*
Ga0058697_1029600923300005562AgaveMGTYERPTLTKVGSFKKLTGVGGSGPRDTLGRHQSF*
Ga0058697_1053164013300005562AgaveMRTYERPTLTPAGSFKRLTGESGWGPRDVLTKHQRL*
Ga0058697_1061785613300005562AgaveMRTYERPTLTPAGSFKKLTGESGWGPRDLLLKHQRL*
Ga0068855_10026997243300005563Corn RhizosphereMRTYERPTLTKAGSFKKITGLGGSGPRDFAFRHQML*
Ga0068857_10004174143300005577Corn RhizosphereMRTYERPTLTRAGNFTKVTGLGGSGPPDAVSKFQLL*
Ga0066903_10000959283300005764Tropical Forest SoilMRTYERPTLIKAGSFKKVTGLGGSGPRDFAFRHQML*
Ga0066903_10348571923300005764Tropical Forest SoilMRTYERPTLIKAGSFKKVTGLGGSGPRDFAFRHQSF*
Ga0081538_10002448103300005981Tabebuia Heterophylla RhizosphereMRTYERPTLTPAGSFKRLTGESGWGPRDLLLKHQRL*
Ga0081538_1012368413300005981Tabebuia Heterophylla RhizosphereMRTYERPTLTKAGSFAGTGLGGRGPRDPVAKHQLL
Ga0081540_100063463300005983Tabebuia Heterophylla RhizosphereMRTYERPTLTKAGSFKKVTGLGGSGPRDFAVRHQML*
Ga0081539_1001081023300005985Tabebuia Heterophylla RhizosphereMRTYERPTLTKAGSFKKVTGLGGSGPRDMTFRHQSL*
Ga0081539_1026974913300005985Tabebuia Heterophylla RhizosphereVRTYERPTLTRAGSFKKLTGLGGSGPRDTLGRHQSL*
Ga0066651_1023759123300006031SoilMTPKGGAEMRTYERPTLTKAGSFKKVTGLGGHGPRDVMFRHQ
Ga0066652_10199042823300006046SoilMRSYERPTLTKAGSFKKVTGLGGSGPRDFMFRHQSL*
Ga0079221_1037559523300006804Agricultural SoilMRTYERPTLIKAGSFKKVTGLGGSGPRDFAFRHQSL*
Ga0075433_1009797613300006852Populus RhizosphereTQKQEAAMRTYERPTLTRAGSFKQITGLGGSGPRDTLGRHQSL*
Ga0075425_10011076813300006854Populus RhizosphereMTPKGGAEMRTYERPTLTKAGSFKKVTGLGGHGPRDVMFR
Ga0066710_10030662923300009012Grasslands SoilMRTYERPTLTKAGSFKKVTGLGGHGPRDFAFRHQML
Ga0066709_10026920023300009137Grasslands SoilMRTYERPTLTKAGSFKKVTGLGGHGPRDFAFRHQML*
Ga0114129_1024878623300009147Populus RhizosphereVRTYERPTLIKAGSFKKVTGLSGHGPRDMILKHQLL*
Ga0114129_1085407813300009147Populus RhizosphereMRTYERPTLTPAGSFKRLTGESGWGPRDFILKHQRL*
Ga0126307_1002323633300009789Serpentine SoilMRTYERPTLTRAGNFTKVTGLSGSGPPDAVSRFQLL*
Ga0126307_1004913563300009789Serpentine SoilMLTYERPTLTKAGSFKKLTGESGSGPRDVLTRHQML*
Ga0126307_1020126313300009789Serpentine SoilTYERPTVTRVGSFTKVTGLGGSGPPDVLGRFQSL*
Ga0126307_1054488323300009789Serpentine SoilMRTYERPTLTAAGSFKRVTGESGWGPRDLLLKHQRL*
Ga0126307_1142458513300009789Serpentine SoilMRTYERPTVTRVGSFTKVTGLGGSGPPDTLGRFQSL*
Ga0126307_1142893713300009789Serpentine SoilMRTYERPMVTRVGSFTKVTGLGGSGPPDVLGRFQSL*
Ga0126313_1016545523300009840Serpentine SoilMRTYERPTLTAAGSFKKVTGLHGWGPRDMVMKHQFL*
Ga0126313_1064949313300009840Serpentine SoilMRTYERPTLTKLGSFKLTGVGGSGPRDRLVRHQLL*
Ga0126313_1081687243300009840Serpentine SoilMRTYERPTLTPAGSFKKLTGESGWGPRDYILKHQRL*
Ga0126313_1097367823300009840Serpentine SoilMRTYERPTLSAAGSFAKVTGILFSGPRELLAHGNLL*
Ga0126315_1010209623300010038Serpentine SoilMRTYERPTLTKAGAFKKVTGTSGWGPRDFLFKHQML*
Ga0126312_1007930123300010041Serpentine SoilMRTYERPTLTKAGSFKKVTGIGGSGPRDTIARHQAV*
Ga0126312_1118361213300010041Serpentine SoilMRTYERPTLTAAGSFRKVTGLHGWGPRDLVMKHQFL*
Ga0126314_1024917923300010042Serpentine SoilMRTYERPTVTRVGSFTKVTGLGGSGPPDTAGRHQSL*
Ga0126311_1156280613300010045Serpentine SoilRGHKQTMRTYERPTLTAAGSFKKVTGLHGFGPRDILMKHQLL*
Ga0126321_105175713300010145SoilMRTYERPTLTPAGSFKRLTGESGWGPRDLLLKHQR
Ga0126321_113740933300010145SoilMRTYERPTLTPAGSFKKVTGESGWGPRDVLCKHQRL*
Ga0126321_122481613300010145SoilMRPYERPTLTKVGSFKKVTGVSGHGPRDFLVKHQFL*
Ga0126319_116407223300010147SoilWGEVRTYERPTLTKVGSFKKITGLGGHGPRDVLVKHQMF*
Ga0126306_1145483323300010166Serpentine SoilMRTYERPTLTRVGSFITLTGLGGSGPPDVLGRFQSL*
Ga0134121_1041588013300010401Terrestrial SoilMRTYERPTLTKAGSFKKLTGLGGSGPRDFAFRHQSL*
Ga0126317_1082273633300011332SoilMRTYERPTLTPAGSFKRLTGESGWGPRDYILKHQRL*
Ga0137380_1023842123300012206Vadose Zone SoilMRTYERPTLTAAGSFKKLTGLSGHGPRDVLLKHQLL*
Ga0137376_1135174713300012208Vadose Zone SoilVRTYERPTLTRAGSFKKLTGLGGSGPRDVLVKHQMF*
Ga0137379_1157075813300012209Vadose Zone SoilMRTYERSTLTAAGSFKKLTGLSGHGPRDVLLKHQLL*
Ga0134028_102859913300012224Grasslands SoilMRTYERPTLTAAGSFLRLTGLTGRGPRDVLSRHQLL*
Ga0137372_1003566053300012350Vadose Zone SoilMRVYERPTLTLAGSFKKVTGLGGSGPRDVLTRHQSF*
Ga0137372_1004215543300012350Vadose Zone SoilMRTYERPTLTKAGSFKEVTGMGGSGPRDFVVRHQLL*
Ga0137372_1067218423300012350Vadose Zone SoilRVYERPTLTLAGSFKKVTGLGGSGPRDVVTRHQLL*
Ga0137372_1115125713300012350Vadose Zone SoilMRPYERPTLTAAGSFKKVTGLGGHGPRDVTARHKIL*
Ga0137386_1058470413300012351Vadose Zone SoilTYERPTLTAAGSFKKLTGLSGHGPRDVLLKHQLL*
Ga0137366_1057307713300012354Vadose Zone SoilMRTYERPTLTKAGSFKEVTGMGGSGPRDFAIRHQML*
Ga0150984_10545181323300012469Avena Fatua RhizosphereMRTYERPTLTAEGSFTKQTGLIVHGTPDLLSHGNIL*
Ga0150984_11570165413300012469Avena Fatua RhizosphereMRTYERPTLTKLGSFKKLTGLGGSGPRDFAFRHQSL*
Ga0150984_12131160623300012469Avena Fatua RhizosphereGLSMRTYERPTLTKLGKFKKLTGLGGSGPRDTLGRHQSL*
Ga0162653_10004350213300012937SoilMKLTYERPTLTAAGSFKKVTGVGGHGPKDFLVKKQSF*
Ga0157372_1051817613300013307Corn RhizosphereGTAMRTYERPTLTKAGSFKKITGLGGSGPRDFAFRHQML*
Ga0182000_1000017573300014487SoilMRPYERPTLMKIGSFKKVTGEGGSGPRDFAVRHQLL*
Ga0182000_1001808313300014487SoilMRTYERPTLMKVGSFKKVTGEGGSGPRDFAVRHQLL*
Ga0182000_1032709313300014487SoilRRYSKLMRTYERPTLTKAGAFKKVTGTSGWGPRDFLFKHQML*
Ga0182000_1048251423300014487SoilVRTYERPTLTKAGSFKKLTGLGGSGPRDYAFRHQSL*
Ga0182008_1044396823300014497RhizosphereMRTYERPTLTKAGSFKKLTGIGGSGPRDFAMRHQMF*
Ga0173483_1099550123300015077SoilMRSYERPTLTRAGNFTKITGLGGSGPRDTLGRHQSL*
Ga0132257_10049298513300015373Arabidopsis RhizosphereMRTYERPTLTKAGSFKKLTGLGGSGPRDFAFRHQML*
Ga0184632_1017032623300018075Groundwater SedimentMRNDERRTYERPTLTPAGSFKSITGLSGHGPKDMLLKHQLL
Ga0190269_1205353913300018465SoilMRTYERPTLTPVGSFKKVTGMSGTGPKDVALKHQML
Ga0184641_136152713300019254Groundwater SedimentMRTYERPTLTPAGSFKELTGESGWGPRDVLCKHQRL
Ga0193722_106821923300019877SoilMRTYERPTLTKAGSFKKVTGLGGSGPRDFAFRHQSL
Ga0206354_1121814333300020081Corn, Switchgrass And Miscanthus RhizosphereMRTYERPTLTRAGSFKQITGLGGSGPRDTLGRHQSL
Ga0207693_1023569813300025915Corn, Switchgrass And Miscanthus RhizosphereMRTYERPTLTKAGSFKKLTGLGGSGPRDFAFRHQSL
Ga0207663_1018240933300025916Corn, Switchgrass And Miscanthus RhizosphereMRTYERPTLTKAGSFKKITGLGGSGPRDFAFRHQML
Ga0207649_1023870523300025920Corn RhizosphereMRTYERPTLTRAGNFTKVTGLGGSGPPDAVSKFQLL
Ga0207661_1017201123300025944Corn RhizosphereMRTYERPTLTRAGNFTKATGLGGSGPRDISGRHQSF
Ga0256867_1000973953300026535SoilMPEGGNDVRIYERPTLTRLGSFKKLTGLGGSGPKDTLVRHQSL
Ga0209461_1010018313300027750AgaveLEGGDPMRTYERPTLMKVGSFKKVTGEGGSGPRDFAVRHQLL
Ga0209574_1035109813300027809AgaveMRTYERPTLTKLGNFKKLTGLGGGGPRDTLGRHQSL
Ga0307280_1001860523300028768SoilRTYERPTLTKAGSFKKVTGLGGSGPRDFAFRHQSL
Ga0307289_1004997223300028875SoilSQDEERETYERPTLTLAGSFTSMTGLNGTGPRDTLDKHQLL
Ga0307278_1042520513300028878SoilGGVAMRTYERPTLTKAGSFKKVTGIGGSGPRDLTFRHQSV
Ga0307300_1012951923300028880SoilMRPYERPTLTAAGSFKKITGLGGSGPKDTLGKHQSL
Ga0268243_1000092113300030510SoilMRPYERPTLMKIGSFKKVTGEGGSGPRDFAVRHQLL
Ga0268243_112223513300030510SoilMRTYERPTLTPAGSFRRLTGESGWGPRDYILKHQRL
Ga0268241_1020114933300030511SoilMRTYERPTLTPVGSFKKVTGESGWGPRDHLLKHQML
Ga0102752_156906733300030783SoilMRTYERPTLTPAGSFKNLTGESGWGPRDYILKHQRL
Ga0308206_115571033300030903SoilMRTYERPTLTPAGSFKKVTGESGWGPRDLLLKHQRL
Ga0308200_111079413300030905SoilQTYERPTLTSAGSFKKVTGTGGSGPKDFLVKKQML
Ga0308201_1037195713300031091SoilVKEGYTETMQNYERPTLTAAGSFKKVTGMGGHGPRDVIARHQAV
Ga0308204_1013907623300031092SoilMQNYERPTLTAAGSFKKVTGMGGHGPRDVIARHQAV
Ga0299914_1006234143300031228SoilMPEGGNDVRIYERPTLTRLGSFKKLTGIGGSGPKDTLVRHQAL
Ga0307408_10079949523300031548RhizosphereMRTYERPTLTPAGSFKKLTGESGWGPRDVLCKHQRL
Ga0307405_1009504223300031731RhizosphereMRTYERPTLTPAGSFKRLTGESGWGPRDFILKHQRL
Ga0307405_1161534713300031731RhizosphereMRTYERPTLTKAGSFKKVTGLGGSGPRDITFRHQSF
Ga0307413_1065265523300031824RhizosphereMRTYERPTLTPAGSFKKLTGESGWGPRDYILKHQRL
Ga0307406_1143372823300031901RhizosphereMRTYERPTLTPAGSFKRLTGESGWGPRDFILKHQRF
Ga0307409_10000554273300031995RhizosphereMRTYERPTLTPAGSFKKLTGESGWGPRDFILKHQRL
Ga0307409_10018505423300031995RhizosphereMRTYERPTLTPAGSFKKLTGESGWGPRDFLFKHQRL
Ga0307409_10040587523300031995RhizosphereMRTYERPTLTAAGSFKRVTGESGWGPRDLLLKHQRL
Ga0307409_10111126033300031995RhizosphereMRTYERPTLTPAGSFKKMTGESGWGPRDHLLKHQMF
Ga0307416_10014305123300032002RhizosphereMRTYERPTLTPAGSFKRLTGESGWGPRDVLTKHQRL
Ga0307416_10015179823300032002RhizosphereMRTYERPTLTPAGSFKNMTGESGWGPRDVLCKHQRL
Ga0307414_1162607913300032004RhizosphereRGVAMRTYERPTLTPAGSFKKMTGESGWGPRDHLLKHQMF
Ga0307415_10020136623300032126RhizosphereMRTYERPTLTKAGSFKKVTGIGGSGPRDTIARHQAV
Ga0307415_10060305823300032126RhizosphereMRTYERPTLTAAGSFKKVTGLHGWGPRDMVMKHQFL
Ga0307415_10230173023300032126RhizosphereQATMRTYERPTLTAAGSFKRVTGLHGWGPRDLVMKHQFL
Ga0268251_1002222723300032159AgaveMRTYERPTLMKVGSFKKVTGEGGSGPRDFAVRHQLL
Ga0268251_1010019713300032159AgaveMRTYERPTLTKVGSFKKVTGEGGSGPRDFAVRHQLL
Ga0268251_1036291813300032159AgaveLEGGDPMGTYERPTLTKVGSFKKLTGVGGSGPRDTLGRHQSF
Ga0307470_1004286423300032174Hardwood Forest SoilMRTYERPTLTKAGSFKKITGLGGSGPRDFGFGHQML

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.