NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065244

Metagenome / Metatranscriptome Family F065244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065244
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 45 residues
Representative Sequence AAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR
Number of Associated Samples 108
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.94 %
% of genes near scaffold ends (potentially truncated) 95.31 %
% of genes from short scaffolds (< 2000 bps) 92.97 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.375 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(37.500 % of family members)
Environment Ontology (ENVO) Unclassified
(45.312 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.656 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00884Sulfatase 17.19
PF03631Virul_fac_BrkB 11.72
PF07080DUF1348 7.03
PF12697Abhydrolase_6 3.91
PF05721PhyH 2.34
PF03060NMO 2.34
PF00923TAL_FSA 1.56
PF04343DUF488 1.56
PF10006DUF2249 1.56
PF07676PD40 1.56
PF06197DUF998 1.56
PF07690MFS_1 1.56
PF00583Acetyltransf_1 0.78
PF08281Sigma70_r4_2 0.78
PF02374ArsA_ATPase 0.78
PF07992Pyr_redox_2 0.78
PF04972BON 0.78
PF03176MMPL 0.78
PF00248Aldo_ket_red 0.78
PF00685Sulfotransfer_1 0.78
PF03663Glyco_hydro_76 0.78
PF13237Fer4_10 0.78
PF12833HTH_18 0.78
PF16657Malt_amylase_C 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 11.72
COG3558Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamilyFunction unknown [S] 7.03
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 2.34
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 2.34
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 2.34
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 1.56
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 1.56
COG3371Uncharacterized membrane proteinFunction unknown [S] 1.56
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.78
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.78
COG4833Predicted alpha-1,6-mannanase, GH76 familyCarbohydrate transport and metabolism [G] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.38 %
UnclassifiedrootN/A40.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B01AT1VCAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
2189573004|GZGWRS401CMC7ANot Available500Open in IMG/M
3300001418|JGI20188J14859_1031562Not Available514Open in IMG/M
3300005332|Ga0066388_107516978All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005445|Ga0070708_100152126All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300005614|Ga0068856_100223599All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300006031|Ga0066651_10034755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2281Open in IMG/M
3300006049|Ga0075417_10127969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1169Open in IMG/M
3300006575|Ga0074053_12008685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300006606|Ga0074062_12988105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1292Open in IMG/M
3300006806|Ga0079220_10354109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia935Open in IMG/M
3300006903|Ga0075426_10066276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2580Open in IMG/M
3300006953|Ga0074063_10048825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300009012|Ga0066710_101738788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia946Open in IMG/M
3300009137|Ga0066709_104050249Not Available533Open in IMG/M
3300009147|Ga0114129_10094453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4141Open in IMG/M
3300009148|Ga0105243_11268972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia752Open in IMG/M
3300009520|Ga0116214_1102905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1051Open in IMG/M
3300010043|Ga0126380_10790970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300010048|Ga0126373_10232084All Organisms → cellular organisms → Bacteria1806Open in IMG/M
3300010048|Ga0126373_10235241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1795Open in IMG/M
3300010301|Ga0134070_10320242Not Available595Open in IMG/M
3300010358|Ga0126370_10100828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1997Open in IMG/M
3300010358|Ga0126370_10843733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300010359|Ga0126376_10289045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1419Open in IMG/M
3300010359|Ga0126376_11343655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300010360|Ga0126372_10554860Not Available1092Open in IMG/M
3300010361|Ga0126378_11280931Not Available829Open in IMG/M
3300010361|Ga0126378_12613971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300010376|Ga0126381_101736356Not Available901Open in IMG/M
3300010376|Ga0126381_103599112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300010376|Ga0126381_104772380Not Available521Open in IMG/M
3300010376|Ga0126381_105128530Not Available501Open in IMG/M
3300011270|Ga0137391_10889756Not Available729Open in IMG/M
3300011271|Ga0137393_10876412Not Available766Open in IMG/M
3300012201|Ga0137365_10374494Not Available1051Open in IMG/M
3300012206|Ga0137380_11476012Not Available565Open in IMG/M
3300012359|Ga0137385_11362072Not Available573Open in IMG/M
3300012957|Ga0164303_10610164Not Available720Open in IMG/M
3300012971|Ga0126369_11927688Not Available679Open in IMG/M
3300016371|Ga0182034_11654593Not Available563Open in IMG/M
3300016387|Ga0182040_10275343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1276Open in IMG/M
3300016404|Ga0182037_11140885Not Available683Open in IMG/M
3300016404|Ga0182037_11224681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium660Open in IMG/M
3300016445|Ga0182038_10284124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1346Open in IMG/M
3300016445|Ga0182038_11315530Not Available646Open in IMG/M
3300016445|Ga0182038_11590421Not Available588Open in IMG/M
3300017966|Ga0187776_10084783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1861Open in IMG/M
3300018058|Ga0187766_10694634Not Available702Open in IMG/M
3300018086|Ga0187769_10938850Not Available655Open in IMG/M
3300020581|Ga0210399_11200276Not Available602Open in IMG/M
3300021403|Ga0210397_10003970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9092Open in IMG/M
3300021407|Ga0210383_11374206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300021432|Ga0210384_11901821Not Available501Open in IMG/M
3300021478|Ga0210402_11893976Not Available522Open in IMG/M
3300021560|Ga0126371_10324778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1670Open in IMG/M
3300021560|Ga0126371_10428928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1466Open in IMG/M
3300025878|Ga0209584_10012876All Organisms → cellular organisms → Bacteria2773Open in IMG/M
3300025912|Ga0207707_10482805All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300025929|Ga0207664_10268072Not Available1495Open in IMG/M
3300025931|Ga0207644_10790334Not Available794Open in IMG/M
3300026023|Ga0207677_10911509Not Available793Open in IMG/M
3300026023|Ga0207677_12182611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300027862|Ga0209701_10476453Not Available682Open in IMG/M
3300028782|Ga0307306_10169786Not Available614Open in IMG/M
3300028799|Ga0307284_10395273Not Available562Open in IMG/M
3300028811|Ga0307292_10464720Not Available541Open in IMG/M
3300028819|Ga0307296_10339492Not Available820Open in IMG/M
3300028885|Ga0307304_10178483Not Available899Open in IMG/M
3300031546|Ga0318538_10130766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1317Open in IMG/M
3300031549|Ga0318571_10220622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium686Open in IMG/M
3300031640|Ga0318555_10003212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6274Open in IMG/M
3300031640|Ga0318555_10245350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae967Open in IMG/M
3300031640|Ga0318555_10621560Not Available585Open in IMG/M
3300031668|Ga0318542_10199198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1010Open in IMG/M
3300031682|Ga0318560_10587371Not Available603Open in IMG/M
3300031708|Ga0310686_103798341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300031713|Ga0318496_10246752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae984Open in IMG/M
3300031719|Ga0306917_10716086Not Available786Open in IMG/M
3300031719|Ga0306917_11366327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300031723|Ga0318493_10188360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300031723|Ga0318493_10744285Not Available551Open in IMG/M
3300031724|Ga0318500_10592580Not Available561Open in IMG/M
3300031744|Ga0306918_10481938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea971Open in IMG/M
3300031748|Ga0318492_10167971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1112Open in IMG/M
3300031751|Ga0318494_10167320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1243Open in IMG/M
3300031754|Ga0307475_11227742Not Available583Open in IMG/M
3300031768|Ga0318509_10134295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1357Open in IMG/M
3300031770|Ga0318521_11017548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300031777|Ga0318543_10132988All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300031778|Ga0318498_10134895Not Available1123Open in IMG/M
3300031779|Ga0318566_10402552Not Available674Open in IMG/M
3300031780|Ga0318508_1202484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031781|Ga0318547_10231433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300031781|Ga0318547_10651638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis654Open in IMG/M
3300031794|Ga0318503_10077661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1039Open in IMG/M
3300031796|Ga0318576_10641882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300031797|Ga0318550_10162953Not Available1074Open in IMG/M
3300031832|Ga0318499_10098189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1132Open in IMG/M
3300031832|Ga0318499_10125423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia999Open in IMG/M
3300031833|Ga0310917_10606474Not Available743Open in IMG/M
3300031833|Ga0310917_10775010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300031845|Ga0318511_10033702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1974Open in IMG/M
3300031879|Ga0306919_10581918Not Available864Open in IMG/M
3300031894|Ga0318522_10128245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria951Open in IMG/M
3300031896|Ga0318551_10094754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1581Open in IMG/M
3300031912|Ga0306921_12287542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300031939|Ga0308174_10851270Not Available768Open in IMG/M
3300031942|Ga0310916_10907082All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300031947|Ga0310909_10452696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1077Open in IMG/M
3300031954|Ga0306926_10883686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300032001|Ga0306922_10643231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1120Open in IMG/M
3300032008|Ga0318562_10167280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1269Open in IMG/M
3300032009|Ga0318563_10645668Not Available569Open in IMG/M
3300032035|Ga0310911_10912224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium asiaticum507Open in IMG/M
3300032052|Ga0318506_10316567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300032052|Ga0318506_10515421Not Available530Open in IMG/M
3300032055|Ga0318575_10124644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1266Open in IMG/M
3300032065|Ga0318513_10623642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300032067|Ga0318524_10436789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia684Open in IMG/M
3300032068|Ga0318553_10359407Not Available762Open in IMG/M
3300032261|Ga0306920_103796476Not Available552Open in IMG/M
3300032770|Ga0335085_10271233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2027Open in IMG/M
3300032954|Ga0335083_10263593Not Available1533Open in IMG/M
3300033289|Ga0310914_11047098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium716Open in IMG/M
3300033803|Ga0314862_0091076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300034818|Ga0373950_0085904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil37.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.34%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.34%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300001418Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_005483202170459023Grass SoilAVTAQLEREGVSSFCDSYHQLLACIEHKLTAVSARP
FG2_086844602189573004Grass SoilEGSEKTLADASAAGINLANVTGELEREGVQSFCDSYHQLLDCIESKLGVVAAS
JGI20188J14859_103156223300001418Arctic Peat SoilAAAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0066388_10751697823300005332Tropical Forest SoilAAEAGLDLAAITSQLEHEGVRSFCDSYHQLLGCIERKLAAVGR*
Ga0070708_10015212613300005445Corn, Switchgrass And Miscanthus RhizosphereAAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0068856_10022359913300005614Corn RhizosphereSITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR*
Ga0066651_1003475513300006031SoilERMLAAAAAAGLDLSVISAELEREGVRSLCDSYHQLLACIEHKVAA*
Ga0075417_1012796923300006049Populus RhizosphereGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP*
Ga0074053_1200868523300006575SoilAERMLAAAAVAGLDLAAVTAELEREGVSSFCDSYHQLLACIEHKLAAVGARL*
Ga0074062_1298810513300006606SoilEAERILAAAAVAGLDLAAVTAQLEREGVSSFCDSYHELLGCIEHKLTAVSARP*
Ga0079220_1035410913300006806Agricultural SoilAGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLAAVSARP*
Ga0075426_1006627623300006903Populus RhizosphereGVDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLAAVGARP*
Ga0074063_1004882513300006953SoilTAQLEREGVSSFCDSYHELLGCIEHKLAAVSARP*
Ga0066710_10173878823300009012Grasslands SoilAAAAAGGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLTAVGARP
Ga0066709_10405024913300009137Grasslands SoilTLADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0114129_1009445383300009147Populus RhizosphereGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP*
Ga0105243_1126897223300009148Miscanthus RhizosphereQPRRCGTDAHTAAAAGLDLSVITAELEREGVSSFCDSYHQLLACIEHKLAAVGARP*
Ga0116214_110290513300009520Peatlands SoilAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0126380_1079097013300010043Tropical Forest SoilAAASGVDLAAVTGQLEREGVSSFCDSYHQLLACIEHKLEAVGARP*
Ga0126373_1023208413300010048Tropical Forest SoilTVTAGLEREGVRSFCDSYHALLDCIERKLAGGAAL*
Ga0126373_1023524133300010048Tropical Forest SoilAAITAQLEREGVRSFCDSYHQLLDCIERKVATMDAASGR*
Ga0134070_1032024213300010301Grasslands SoilRMIAGAAAAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0126370_1010082813300010358Tropical Forest SoilLTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG*
Ga0126370_1084373313300010358Tropical Forest SoilAVTDQLEREGVSSFCDSYHQLLACIEHKLTAVGARP*
Ga0126376_1028904533300010359Tropical Forest SoilLDADQGAADRTLAAAAADGTDLADITAQLEREGVRAFCDSYHQLLDCIERKLALI*
Ga0126376_1134365513300010359Tropical Forest SoilAAAAAEIDLAALTAQLEREGVSSFCDSYHRLLGCIERKLAAGAAASAG*
Ga0126372_1055486013300010360Tropical Forest SoilLTALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG*
Ga0126378_1128093113300010361Tropical Forest SoilTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG*
Ga0126378_1261397113300010361Tropical Forest SoilGGLDLGAVTAQLEREGVSSFCDSYHELLGCIEHKLAAVAPSPG*
Ga0126381_10173635613300010376Tropical Forest SoilGLGLAAITVQLEREGVRSFCDSYRQLLGCIGRQIAAGAAQ*
Ga0126381_10359911213300010376Tropical Forest SoilGLDLGAVTAQLEREGVSSFCDSYHELLGCIEHKLAAVAPSAG*
Ga0126381_10477238023300010376Tropical Forest SoilAAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAATSQG*
Ga0126381_10512853013300010376Tropical Forest SoilAAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASQG*
Ga0137391_1088975613300011270Vadose Zone SoilDAAQRTLAAAAAAGIDLATLTAQLDREGARSFCDSYHQLLDCIERKLAAIATR*
Ga0137393_1087641213300011271Vadose Zone SoilRTLAAAAAAGIDLATLTAQLEREGVRSFCDSYHQLLDCIERKLAAIATR*
Ga0137365_1037449413300012201Vadose Zone SoilAAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0137380_1147601213300012206Vadose Zone SoilGAAAAGLDLAAVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0137385_1136207213300012359Vadose Zone SoilMLAGAAAAGLDLAAVTAKLEREGVRSFCDSYHQLLGCIERKIAAGAAR*
Ga0164303_1061016413300012957SoilEIAGLELAQVTSQLEREGVRSFCESYGSLLACIEGKLAGAAA*
Ga0126369_1192768813300012971Tropical Forest SoilLAALTAQLEREGVSSFCDSYHQLLGCIERKLAAGAAASAG*
Ga0157369_1163190523300013105Corn RhizosphereVTAQLERAGVRSFCDSYQQLLARIQTTLALPLATS*
Ga0182034_1165459313300016371SoilEPADAERILAAAAAEIDLAALTAQLEREGVSSFCDSYHQLLGCI
Ga0182040_1027534313300016387SoilGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0182037_1114088513300016404SoilQAAARTLDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIARKLAADAAR
Ga0182037_1122468113300016404SoilAGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR
Ga0182038_1028412413300016445SoilVAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG
Ga0182038_1131553023300016445SoilARTLDAEPADAERILAAAAAEIDLAALTAQLEREGVSSFCDSYHQLLGCIERKLTAGAA
Ga0182038_1159042113300016445SoilAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG
Ga0187776_1008478313300017966Tropical PeatlandMLAAAAASGADLAAVTDQLEREGVSSFCDSYHQLLACIEHKLTAVGARP
Ga0187766_1069463413300018058Tropical PeatlandEAAGIDLTAVTTELEREGVDSFYDSYDQLLRCIESKLYVVAGSGG
Ga0187769_1093885023300018086Tropical PeatlandLAAAAAAGIDLASLTSQLEREGVRSFCDSYHELLDCIERKLAAGAP
Ga0210399_1120027613300020581SoilAGVDLAALTAELEREGVSSFCDSYHRLLDCIGRKVAAGAAR
Ga0210397_1000397013300021403SoilVIAVTALLEPEGVRSFCDSYYQLLGCIERKIAAGAGR
Ga0210383_1137420613300021407SoilAADRILAAAAGAGIDLGAITAELERAGVRSFCDSYHQLLDCIERKLTAIAAR
Ga0210384_1190182123300021432SoilAAERTLADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIECKIAAGAR
Ga0210402_1189397613300021478SoilDAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIECKIAAGAR
Ga0126371_1032477813300021560Tropical Forest SoilEIDLAALTAQLEREGVSSFCDSYHRLLGCIERKLAAGAAASAG
Ga0126371_1042892813300021560Tropical Forest SoilAERTLAVAAEAGLDLAAITAQLEREGVRSFCDSYHRLLSCIERKVATMDAASGG
Ga0209584_1001287623300025878Arctic Peat SoilVTVTLEREAVRSFCDSYHELLDCIEGKLGALAAGGSTGPA
Ga0207707_1048280513300025912Corn RhizosphereELSSITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR
Ga0207664_1026807223300025929Agricultural SoilAALTAQLEREGVRSFCDSYHQLLGCIERKLAAGAAAGAG
Ga0207644_1079033423300025931Switchgrass RhizosphereAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAA
Ga0207677_1091150913300026023Miscanthus RhizospherePSITAALEREGVTAFCDSYRELLDCIEHKLEALASVGR
Ga0207677_1218261113300026023Miscanthus RhizosphereAALGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP
Ga0209701_1047645323300027862Vadose Zone SoilAAAAAAGIDLATLTAQLEREGVRSFCDSYHQLLDCIERKLAAIATR
Ga0307306_1016978613300028782SoilADAAAAGLDLAAVTAQLEREGVRSFCDSYHQLLGCIERKIAAGAAR
Ga0307284_1039527313300028799SoilGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP
Ga0307292_1046472013300028811SoilGLDLAAVTAQLEREGVSSFCDSYDQLLGCIEHKLTAVGARP
Ga0307296_1033949213300028819SoilVGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTAVGARP
Ga0307304_1017848313300028885SoilVGGLDLAAVTAQLEREGVSAFCDSYHQLLACIEHKLTTVSARP
Ga0318538_1013076613300031546SoilVAGLDLAAVTAQLEREGVSSFCDSYHQLLGCIEHKLTAVGARP
Ga0318571_1022062213300031549SoilPQAAERKLAAAAAAGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR
Ga0318555_1000321273300031640SoilAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG
Ga0318555_1024535033300031640SoilLDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIARKLAADAAR
Ga0318555_1062156013300031640SoilAGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG
Ga0318542_1019919823300031668SoilAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR
Ga0318560_1058737113300031682SoilIDLGAVTAELERDGVRSFCDSYHQLLDCIARRLTTVAAG
Ga0310686_10379834113300031708SoilDAAATAGIDLAALTAQLEREGVRSFCDSYRRLLDCIGRKLTAGAGR
Ga0318496_1024675213300031713SoilVRAAGIDLAALTAELEREGVQSFCDSYHRLLDCIGRKLAADAAR
Ga0306917_1071608613300031719SoilTLTAAAAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS
Ga0306917_1136632713300031719SoilVTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP
Ga0318493_1018836023300031723SoilLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0318493_1074428513300031723SoilRTLADAAAEIDLASLTAQLEREGVSSFCDSYHQLLGCIERKLTAGAA
Ga0318500_1059258013300031724SoilDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS
Ga0306918_1048193813300031744SoilEPGDAERTLAAAAAEIDLASLTAQLEREGVSSFCDSYHQLLGCIERKLAA
Ga0318492_1016797133300031748SoilIPAALTAQLEREGVESFCDSYHRLLDCIARKLAAGAAR
Ga0318494_1016732023300031751SoilDPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0307475_1122774213300031754Hardwood Forest SoilAERTLAEARDAGIDLAAVTAELEREGVRSFCDSYHELLDCIDSKLGTVV
Ga0318509_1013429523300031768SoilVKASPAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0318521_1101754813300031770SoilERALAAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS
Ga0318543_1013298823300031777SoilDPDTAEQAVAAAAAGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLNAG
Ga0318498_1013489513300031778SoilAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS
Ga0318566_1040255223300031779SoilAALTAELEREGVQSFCDSYHRLLDCIGRKLAADAAR
Ga0318508_120248413300031780SoilTAEQAVAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLSTGDACR
Ga0318547_1023143323300031781SoilLAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR
Ga0318547_1065163823300031781SoilERTLAAAVAEIDLTALTAQLEREGVSSFCDSYHQLLGCIERKLAT
Ga0318503_1007766113300031794SoilIDLAALTAQLEREGVESFCDSYHRLLDCIARKLAAGAAR
Ga0318576_1064188223300031796SoilDLGAVTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP
Ga0318550_1016295313300031797SoilTQQTLTAAAAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS
Ga0318499_1009818913300031832SoilPALTAELEREGVSSFCDSYHRLLDCIGRKVAAGAAR
Ga0318499_1012542323300031832SoilIDLAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR
Ga0310917_1060647413300031833SoilEQAVAAAVTGIDLAAVTAQLEREGVRSFCESYRQLLDCVERKLGAG
Ga0310917_1077501013300031833SoilERILAAAAMAGLDLGAVTAQLEREGVSSFCDSYHELLDCIEHKLTAVAARP
Ga0318511_1003370213300031845SoilPQAAERKLAAAAGAGLDLAAITSQLEREGVRSFCDSYHQLLACIERKVATMDAASGR
Ga0306919_1058191813300031879SoilDRILAAAAGAGIDLGAVTAELERDGVRSFCDSYHQLLDCIARRLTTVAAG
Ga0318522_1012824523300031894SoilLADLAGAGVDLAAVDSELEREGVQSFCDSYHQLLGCIEHKLGALARPGS
Ga0318551_1009475413300031896SoilLDTDPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASG
Ga0306921_1228754213300031912SoilAAAAVAGLDLGAVTAQLEREGVSSFCDSYHELLSCIEHKLTAVAARP
Ga0308174_1085127013300031939SoilMIAGAAAAGLDLAVVTARLEREGVRSFCDSYHQLLGCIERKIAAGAAR
Ga0310916_1090708213300031942SoilAARTLDAAATAGIDLADLTAQLEREGVQSFCDSYHRLLDCIGQKVSADAAR
Ga0310909_1045269623300031947SoilTDPLAAERMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0306926_1088368623300031954SoilDPDTAEQAVAAAAAGIDLAAITAQLEREGVRSFCESYRQLLDCVERKLSTGDACR
Ga0306922_1064323123300032001SoilAAAAAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATLDAASGR
Ga0318562_1016728013300032008SoilMLAAAAGAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATMDAASGR
Ga0318563_1064566813300032009SoilQRTLDAAAAAGVDLAALTAGLEREGVSSFCDSYHRLLDCIERKLAAGAAR
Ga0310911_1091222413300032035SoilDLAGAGVDLAAVDSELEREGVQSFCDSYHQLLGCIEHKLGALARPGS
Ga0318506_1031656713300032052SoilTLADLAGAGVDLAAVDSELEREGVRSFCDSYHQLLGCIEHKLGALARPGS
Ga0318506_1051542123300032052SoilAAAGIDLTALTSQLEREGVRSFCDSYHELLDCIERKLAAMAS
Ga0318575_1012464423300032055SoilAAGLDLAAITSQLEREGVRSFCDSYHRLLDCIERKVATLDAASGR
Ga0318513_1062364223300032065SoilRALAAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS
Ga0318524_1043678913300032067SoilAAAAAEVDLAALTAQLEREGVSSFCDSYHQLLSCIERKLAAGSDVRSS
Ga0318553_1035940713300032068SoilDPAVADRILAAAAGAGIDLGAVTAELERDGVRSFCDSYHQLLNCIARRLTAVAAG
Ga0306920_10379647613300032261SoilAEQAVAAAAAGIGLAAVTAQLEREGVRSFCESYRQLLDCVERKLSAG
Ga0335085_1027123323300032770SoilNPDDAERMLAAAAVAGLDLAAVTAQLEREGVSSFCDSYHQLLACIEHKLTAVGVRP
Ga0335083_1026359323300032954SoilAERMLAAAAAGGVDLAAVTAGLEREGVSPFCDSYHRLLACIEHKLTAGGARP
Ga0310914_1104709813300033289SoilTSQLEREGVRSFCDSYHRLLDCIVRKVATMDAASGR
Ga0314862_0091076_2_1393300033803PeatlandAAAGGVDLAAVTAGLEREGVSSFCDSYHQLLARIEHKLTAVGARP
Ga0373950_0085904_556_6633300034818Rhizosphere SoilVTAQLEREGVSSFCDSYHQLLACIEHKLAAVSARP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.