Basic Information | |
---|---|
Family ID | F065148 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 47 residues |
Representative Sequence | HQKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAVIAIATAR |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.25 % |
% of genes near scaffold ends (potentially truncated) | 92.97 % |
% of genes from short scaffolds (< 2000 bps) | 97.66 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.469 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.531 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.906 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.969 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF04140 | ICMT | 7.81 |
PF00171 | Aldedh | 7.03 |
PF13449 | Phytase-like | 3.91 |
PF00210 | Ferritin | 2.34 |
PF00753 | Lactamase_B | 2.34 |
PF13527 | Acetyltransf_9 | 1.56 |
PF06224 | HTH_42 | 1.56 |
PF01022 | HTH_5 | 1.56 |
PF13936 | HTH_38 | 1.56 |
PF02518 | HATPase_c | 1.56 |
PF07883 | Cupin_2 | 1.56 |
PF13191 | AAA_16 | 0.78 |
PF00196 | GerE | 0.78 |
PF08281 | Sigma70_r4_2 | 0.78 |
PF05235 | CHAD | 0.78 |
PF12695 | Abhydrolase_5 | 0.78 |
PF00892 | EamA | 0.78 |
PF01243 | Putative_PNPOx | 0.78 |
PF09037 | Sulphotransf | 0.78 |
PF00561 | Abhydrolase_1 | 0.78 |
PF08450 | SGL | 0.78 |
PF08327 | AHSA1 | 0.78 |
PF01590 | GAF | 0.78 |
PF05988 | DUF899 | 0.78 |
PF01381 | HTH_3 | 0.78 |
PF09365 | DUF2461 | 0.78 |
PF05145 | AbrB | 0.78 |
PF09995 | MPAB_Lcp_cat | 0.78 |
PF16655 | PhoD_N | 0.78 |
PF14534 | DUF4440 | 0.78 |
PF10282 | Lactonase | 0.78 |
PF13230 | GATase_4 | 0.78 |
PF01914 | MarC | 0.78 |
PF00881 | Nitroreductase | 0.78 |
PF07730 | HisKA_3 | 0.78 |
PF03466 | LysR_substrate | 0.78 |
PF07885 | Ion_trans_2 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 7.03 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 7.03 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 7.03 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.56 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.78 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.78 |
COG3180 | Uncharacterized membrane protein AbrB, regulator of aidB expression | General function prediction only [R] | 0.78 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.78 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.78 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.78 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.78 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.78 |
COG4424 | LPS sulfotransferase NodH | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.78 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.78 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.47 % |
Unclassified | root | N/A | 19.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0599488 | Not Available | 843 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2285551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
3300004153|Ga0063455_101020003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
3300004156|Ga0062589_102563443 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300004157|Ga0062590_101828173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 624 | Open in IMG/M |
3300004479|Ga0062595_100106471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1508 | Open in IMG/M |
3300005093|Ga0062594_101328526 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300005093|Ga0062594_101799884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300005093|Ga0062594_102035113 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005181|Ga0066678_10658506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
3300005329|Ga0070683_101412017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 669 | Open in IMG/M |
3300005329|Ga0070683_101966150 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005336|Ga0070680_101460470 | Not Available | 592 | Open in IMG/M |
3300005356|Ga0070674_101281159 | Not Available | 653 | Open in IMG/M |
3300005440|Ga0070705_100169363 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300005441|Ga0070700_100709526 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300005459|Ga0068867_101590414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300005578|Ga0068854_101676517 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005615|Ga0070702_100898293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300005713|Ga0066905_100474192 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300005937|Ga0081455_10078172 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
3300005937|Ga0081455_10215573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1427 | Open in IMG/M |
3300005985|Ga0081539_10428307 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006046|Ga0066652_101415707 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300006163|Ga0070715_10743771 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006575|Ga0074053_10001871 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300006575|Ga0074053_11494139 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006606|Ga0074062_10019157 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300006844|Ga0075428_100598776 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300006846|Ga0075430_100543935 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300006852|Ga0075433_10630697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
3300006853|Ga0075420_100904670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
3300006894|Ga0079215_11012710 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006953|Ga0074063_10056755 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300006953|Ga0074063_14170640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
3300006969|Ga0075419_10403920 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300009094|Ga0111539_12684966 | Not Available | 577 | Open in IMG/M |
3300009098|Ga0105245_11969719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300009100|Ga0075418_12501554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300009147|Ga0114129_11193173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
3300009162|Ga0075423_10195225 | Not Available | 2123 | Open in IMG/M |
3300009162|Ga0075423_11825582 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300009176|Ga0105242_10321462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1419 | Open in IMG/M |
3300009553|Ga0105249_11879850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
3300009789|Ga0126307_10055565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3098 | Open in IMG/M |
3300009840|Ga0126313_10144732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1790 | Open in IMG/M |
3300009840|Ga0126313_10722153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 808 | Open in IMG/M |
3300009840|Ga0126313_11854745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300010036|Ga0126305_10583395 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300010037|Ga0126304_10259619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1145 | Open in IMG/M |
3300010037|Ga0126304_10997780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300010039|Ga0126309_10269735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
3300010040|Ga0126308_10264234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1122 | Open in IMG/M |
3300010166|Ga0126306_10129126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1858 | Open in IMG/M |
3300010166|Ga0126306_10916050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
3300010166|Ga0126306_11463352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300010166|Ga0126306_11655474 | Not Available | 534 | Open in IMG/M |
3300010396|Ga0134126_12433493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
3300010401|Ga0134121_10225912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1628 | Open in IMG/M |
3300011119|Ga0105246_10825372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300011412|Ga0137424_1059952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
3300012354|Ga0137366_10399437 | Not Available | 1001 | Open in IMG/M |
3300012477|Ga0157336_1007783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300012684|Ga0136614_10780788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300012891|Ga0157305_10041883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
3300012910|Ga0157308_10236565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300012958|Ga0164299_10843392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300012989|Ga0164305_11825167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300014325|Ga0163163_10452569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
3300014326|Ga0157380_13486061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 504 | Open in IMG/M |
3300015372|Ga0132256_100516299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
3300015372|Ga0132256_103173247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
3300015372|Ga0132256_103364869 | Not Available | 538 | Open in IMG/M |
3300015374|Ga0132255_102712212 | Not Available | 757 | Open in IMG/M |
3300017965|Ga0190266_10838411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300018000|Ga0184604_10157114 | Not Available | 754 | Open in IMG/M |
3300018028|Ga0184608_10327058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
3300018072|Ga0184635_10061393 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300018073|Ga0184624_10368300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
3300018076|Ga0184609_10232268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300018422|Ga0190265_11630076 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300018429|Ga0190272_10872885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
3300018465|Ga0190269_10923699 | Not Available | 648 | Open in IMG/M |
3300019361|Ga0173482_10500385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300019377|Ga0190264_12084134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f | 523 | Open in IMG/M |
3300019767|Ga0190267_11393105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300022756|Ga0222622_10594080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
3300025927|Ga0207687_10391334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
3300025934|Ga0207686_11441976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300025936|Ga0207670_10513492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300025937|Ga0207669_11175926 | Not Available | 649 | Open in IMG/M |
3300025941|Ga0207711_11971982 | Not Available | 527 | Open in IMG/M |
3300025961|Ga0207712_10660164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter | 909 | Open in IMG/M |
3300025961|Ga0207712_11339603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300025972|Ga0207668_11746220 | Not Available | 562 | Open in IMG/M |
3300027561|Ga0209887_1039431 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300027637|Ga0209818_1245258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300027880|Ga0209481_10196305 | Not Available | 1007 | Open in IMG/M |
3300028590|Ga0247823_11500578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300028710|Ga0307322_10053406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
3300028771|Ga0307320_10073745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
3300028771|Ga0307320_10318737 | Not Available | 619 | Open in IMG/M |
3300028796|Ga0307287_10085353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
3300028796|Ga0307287_10164210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
3300028796|Ga0307287_10362012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
3300028799|Ga0307284_10148795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300028807|Ga0307305_10101320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1331 | Open in IMG/M |
3300028809|Ga0247824_10641639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300028819|Ga0307296_10669953 | Not Available | 567 | Open in IMG/M |
3300028876|Ga0307286_10226884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
3300028878|Ga0307278_10318505 | Not Available | 687 | Open in IMG/M |
3300028885|Ga0307304_10110891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
3300030336|Ga0247826_10514441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300030511|Ga0268241_10081225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300031170|Ga0307498_10009878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1881 | Open in IMG/M |
3300031170|Ga0307498_10472521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
3300031740|Ga0307468_100620767 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300031740|Ga0307468_102149033 | Not Available | 539 | Open in IMG/M |
3300031901|Ga0307406_10915768 | Not Available | 747 | Open in IMG/M |
3300031901|Ga0307406_11263837 | Not Available | 643 | Open in IMG/M |
3300031901|Ga0307406_11925994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300031903|Ga0307407_11686207 | Not Available | 504 | Open in IMG/M |
3300032002|Ga0307416_102914921 | Not Available | 572 | Open in IMG/M |
3300032126|Ga0307415_100729759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300032205|Ga0307472_102338977 | Not Available | 541 | Open in IMG/M |
3300032261|Ga0306920_101215873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
3300033290|Ga0318519_10605475 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300033550|Ga0247829_10168521 | Not Available | 1719 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.53% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 10.16% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.12% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.34% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.34% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.78% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_05994881 | 2228664021 | Soil | GSMALSIPLLIVAAIFTGLAGVIVICLALAVIAIATAR |
ICChiseqgaiiDRAFT_22855511 | 3300000033 | Soil | SLRRKREHQKEMVLGAMALSIPLXXXAAIFTGLAGVIVXXXALAVIAIATAR* |
Ga0063455_1010200031 | 3300004153 | Soil | KEMVLGSMAISIPLLAIAAIFTGIAGVIAVCVALAVIAITTAR* |
Ga0062589_1025634432 | 3300004156 | Soil | KRKRDHQKEMVLGAMGISIPLLGIAAVFAGLAGVIVVCAALAVIAVASSR* |
Ga0062590_1018281733 | 3300004157 | Soil | KEMVLGAMALSIPLFALAAIFTGLAGVIVVCGALAVIAIVTAR* |
Ga0062595_1001064713 | 3300004479 | Soil | LGAMALSIPLFALAAIFTGLAGVIVVCAALAVIAIATTR* |
Ga0062594_1013285262 | 3300005093 | Soil | SLKRKRDHQKEMVLGAMGISIPMLAIAAIFAGLAGVIVVCAALAVIAVVASR* |
Ga0062594_1017998842 | 3300005093 | Soil | QSLRRKREHQKEMVLGAMALSIPLFAMAAIFTGLAGVIVVCAALGVIAIVASR* |
Ga0062594_1020351132 | 3300005093 | Soil | LILGAMGISIPLLAIAAIFTGLAGVIVVCAALAVIAYVSTR* |
Ga0066678_106585061 | 3300005181 | Soil | EQALKRKRDHQREMVLGGMAISVPLFALAAIFVGLAGILVVCGALAVIAIVSTRS* |
Ga0070683_1014120173 | 3300005329 | Corn Rhizosphere | REHQKEMVLGSMGVGVPLLLIAAIFTGFAGVLVVSAAVALIAVVSAIRA* |
Ga0070683_1019661501 | 3300005329 | Corn Rhizosphere | HQKEMVLGAMGISIPMLAIAAIFAGLAGVIVVCAALAVIAVASSR* |
Ga0070680_1014604702 | 3300005336 | Corn Rhizosphere | KREHQKEMVLGSIALSIPLFAMAAIFTGLAGVIVVCAALGVIAIVTSR* |
Ga0070674_1012811592 | 3300005356 | Miscanthus Rhizosphere | KREHQKEMVLGAMALSIPLFAMAAIFTGLAGVIVVCAALVVIAVVASR* |
Ga0070705_1001693633 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RKEMVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAVATAR* |
Ga0070700_1007095262 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | REHQKEMVLGSMAISIPLLAIAAAFTGLAGVIAVCVALVAIAILTNRG* |
Ga0068867_1015904142 | 3300005459 | Miscanthus Rhizosphere | MVLGAMALSIPLFAMAAIFTGLAGVIVVCAALAVIAVVASR* |
Ga0068854_1016765171 | 3300005578 | Corn Rhizosphere | RKRDHQKEMVLGAMGISIPMLAIAAIFAGLAGVIVVCAALAVIAVASSR* |
Ga0070702_1008982931 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | WSSGDRGWALQQQREHQKETILGSMAISIPLFAIAAVFAGFPGVVAVLVALVIIAVVSTKT* |
Ga0066905_1004741921 | 3300005713 | Tropical Forest Soil | QSLRRKREHQKEMVLGSMGLSIPLLLVAAIFTGLAGVIVVCGALAVIAIATARS* |
Ga0081455_100781721 | 3300005937 | Tabebuia Heterophylla Rhizosphere | EMVRGAMGISVPLLALAAIFTGVAGVVVVCSALVLIAVVSAR* |
Ga0081455_102155734 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGIAIPLLAIAAIFTGLAGVIVVCAALAVVVVAGTR* |
Ga0081539_104283072 | 3300005985 | Tabebuia Heterophylla Rhizosphere | QSEMALKRKRDHQKEMVLGGMAISVPLMAIAAIFTGLPGVVAVCLALAVIAIVSARDD* |
Ga0066652_1014157072 | 3300006046 | Soil | MGISIPLLAIAAIFTGLAGVIVVCAALAVIAVVSAR* |
Ga0070715_107437712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EDERALQQRRDHQKEMVLGAMGISVPLLAIAAIFTGLAGVVVVCAALAVIALVSAR* |
Ga0074053_100018713 | 3300006575 | Soil | KEMVLGAMALSIPLVIVAAIFTGLAGVIVVCGALAVIAIVTAR* |
Ga0074053_114941392 | 3300006575 | Soil | HQKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAVIAIATAR* |
Ga0074062_100191571 | 3300006606 | Soil | QKEMVLGAMALSIPLVIVAAIFTGLAGVIVVCGALAVIAIVTAR* |
Ga0075428_1005987761 | 3300006844 | Populus Rhizosphere | EMVLGAMALSIPLMAIAAIFTGLAGVIAVCAAIAVIAIVTARQS* |
Ga0075430_1005439353 | 3300006846 | Populus Rhizosphere | TREREKALKHKREHQQEMVLGAMGISIPLLALAAIFTGLAGVIVVCSALVLIAVVSAR* |
Ga0075433_106306972 | 3300006852 | Populus Rhizosphere | KRKREHQKEMVLGAMAISIPLLAIAAIFTGLAGVIAVCAALAVIAIASRR* |
Ga0075420_1009046702 | 3300006853 | Populus Rhizosphere | SIPLMAIAAIFTGLAGVIAVCAAIAVVAIVTARQS* |
Ga0079215_110127103 | 3300006894 | Agricultural Soil | LGAMGISVPLFALAAIFTGLPGVLAVCAALAVIAITASR* |
Ga0074063_100567551 | 3300006953 | Soil | REHQKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAVIAIATAR* |
Ga0074063_141706401 | 3300006953 | Soil | ESEQSLRRKREHQKEMVLGAMALSIPLFALAAIFTGLAGVIVVCGALVVIAIVTAR* |
Ga0075419_104039202 | 3300006969 | Populus Rhizosphere | EKALKRKRDHQKEMVLGAMALSIPLMAIAAIFTGLAGVIAVCAAIGVVAIVTARQS* |
Ga0111539_126849661 | 3300009094 | Populus Rhizosphere | AMALSIPLMAIAAIFTGLAGVIAVCAAIGVVAIVTARQS* |
Ga0105245_119697192 | 3300009098 | Miscanthus Rhizosphere | LGSMAISIPLLAIAAIFTGLAGVIAVCVALVVIAAITARS* |
Ga0075418_125015541 | 3300009100 | Populus Rhizosphere | DREERALKRKRDHEKEMVLGSMAISVPLFAIAAVFTGLAGVVAVLVALVIIAAITARQD* |
Ga0114129_111931731 | 3300009147 | Populus Rhizosphere | HQKEMLLGAMGISVPLFVVAAIFTGLAGVIAVCVMLGVVAATTARSV* |
Ga0075423_101952253 | 3300009162 | Populus Rhizosphere | MVLGAMALSIPLFALAAIFTGLAGVIVVCGALAVIAIATAR* |
Ga0075423_118255821 | 3300009162 | Populus Rhizosphere | QREMVLGAMGISIPLLAIAAIFTGLAGVIVVCAALAVIAVVSAR* |
Ga0105242_103214621 | 3300009176 | Miscanthus Rhizosphere | KREHQKEMVLGAMALSIPLFALAAIFTGLAGVIVVCATLAVIAAVTSR* |
Ga0105249_118798502 | 3300009553 | Switchgrass Rhizosphere | REHQKEMVLASMALSIPLMAIAAIFTGLAGVITVCVALCVIAIVTSR* |
Ga0126307_100555656 | 3300009789 | Serpentine Soil | GSMGIAVPLLAIAAIFTGLPGVVAVCVALAVIAIVSSR* |
Ga0126313_101447321 | 3300009840 | Serpentine Soil | KEMVLGAMGISVPLFIFAAIFTGLAGVIAVCAVLGVIALATTRSP* |
Ga0126313_107221531 | 3300009840 | Serpentine Soil | MGVSIPFFVVAAIFTGLAGVIVVCAALVAIAVVSAR* |
Ga0126313_118547452 | 3300009840 | Serpentine Soil | ERALRQRREHQKELILGSMGIAVPLFVVAAIFTGLAGIIVVCAALAVIAIAATRAP* |
Ga0126305_105833951 | 3300010036 | Serpentine Soil | QKEMVLGAMAISVPLFIFAAIFTGLAGVIAVCAVLGVIALATTRSP* |
Ga0126304_102596192 | 3300010037 | Serpentine Soil | KEMVLGAMALSIPMLVVAGIFTGLAGVIVVCAALVTIAVVSSR* |
Ga0126304_109977802 | 3300010037 | Serpentine Soil | SIPLMAIAAIFTGLAGVIAVCVAIAVVAIVSARQS* |
Ga0126309_102697353 | 3300010039 | Serpentine Soil | LERKRDHQKEMVLGSMGIAIPLLAIAAIFTGLAGVIVVCAALAVIALATTRS* |
Ga0126308_102642342 | 3300010040 | Serpentine Soil | SMALGIPLMAIAAIFTGLAGVIVVCAAIVVVALATAR* |
Ga0126306_101291262 | 3300010166 | Serpentine Soil | NHQKEMVLGSMGIGVPFFVIAAIFTGLPGVIAVCVALVAIAVVTTRD* |
Ga0126306_109160503 | 3300010166 | Serpentine Soil | RALKRKRDHQREMVLGSMGISVPLLAIAAIFTGIEGVIAVCVALAVIAIVTAR* |
Ga0126306_114633522 | 3300010166 | Serpentine Soil | GAMGISVPLLAIAAIFTGLAGVLVVCGALAVIVYVSTR* |
Ga0126306_116554741 | 3300010166 | Serpentine Soil | LQKGVLLGAMGIPVPLLAIAAIFTGLAGVIAVCVALGLIAIVSARS* |
Ga0134126_124334931 | 3300010396 | Terrestrial Soil | EMVLGAMGISIPLLAIAAIFTGLAGVIVVCAALAVIAVASGR* |
Ga0134121_102259121 | 3300010401 | Terrestrial Soil | HQKEMVLGAMGISVPLLAVAAIFTGLAGVLVVCAALAVIAVATAR* |
Ga0105246_108253721 | 3300011119 | Miscanthus Rhizosphere | LKRKRDHQKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAVIAIATAR* |
Ga0137424_10599521 | 3300011412 | Soil | NEQALKRKREHQKEMVLGAMGISVPLFALAAIFAGLAGVIVVSLALVVIAVVSTR* |
Ga0137366_103994372 | 3300012354 | Vadose Zone Soil | MVLGAMGISVPVFVVAAIFTGLPGVLAICAVLAVIAIASSR* |
Ga0157336_10077831 | 3300012477 | Arabidopsis Rhizosphere | KREHQKEMVLGGMALSIPLFALAAIFTGLAGVIVVCGALVVIAIVTAR* |
Ga0136614_107807881 | 3300012684 | Polar Desert Sand | HQKEMVLGSMGISVPLLAFAAIFTGLPGVIVVCVALVVIAVVSSRS* |
Ga0157305_100418833 | 3300012891 | Soil | LGAMAISIPLFALAAVFAGLAGIIVVCGTLVVIAIASTRS* |
Ga0157308_102365651 | 3300012910 | Soil | KEMVLGAMAISIPLFALAAVFAGLAGIIVVCGTLVVIAIASTRS* |
Ga0164299_108433922 | 3300012958 | Soil | MVLGSMALSIPLFIGAAIFTGLAGVIVVCAALVVIA |
Ga0164305_118251671 | 3300012989 | Soil | KEMVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAVATAR* |
Ga0163163_104525691 | 3300014325 | Switchgrass Rhizosphere | KGADQFAIERKREHQKEMVLGSMAISIPLLAIAAIFTGLAGVIAVCVALVMIAAITARN* |
Ga0157380_134860612 | 3300014326 | Switchgrass Rhizosphere | ISIPLLAIAAIFTGLAGVIAVCVALVVIAAITARG* |
Ga0132256_1005162993 | 3300015372 | Arabidopsis Rhizosphere | IVGSMGISIPLLAIAAIFTGLAGVIGVCAALAVIAVVVSR* |
Ga0132256_1031732471 | 3300015372 | Arabidopsis Rhizosphere | RLSERKELDEKALKRRREHQKEMVLGSMGIGVPLLLIAAIFTGFAGVLVVSAAVTLIAVVSAIRA* |
Ga0132256_1033648691 | 3300015372 | Arabidopsis Rhizosphere | HQKEMVLGGMALSIPLFALAAIFTGLVGVIVVCSALVVIAVVTAS* |
Ga0132255_1027122121 | 3300015374 | Arabidopsis Rhizosphere | KEMVLGSMALSIPLLICAAIFTGLAGVIVVCAALVVIAVVTAR* |
Ga0190266_108384111 | 3300017965 | Soil | YIPLMAIAAIFTGLAGVIAVCVAIGVVAIVVTRQS |
Ga0184604_101571141 | 3300018000 | Groundwater Sediment | REMVLGAMAISIPLFAIAAIFVGVGGILVVCGALAVIAVVSTRS |
Ga0184608_103270581 | 3300018028 | Groundwater Sediment | KGKRALAHKREHQKEMTLGSMAISIPLFAIAAVFTGLAGVITVCAVLAVIAIVSSR |
Ga0184635_100613933 | 3300018072 | Groundwater Sediment | HQKEMVLGAMALSIPLFALAAIFTGLAGVIVVCGVLAVIAIVTSR |
Ga0184624_103683001 | 3300018073 | Groundwater Sediment | KREHQKEMVLGAMALSIPLFALAAIFTGLAGVIVVCGALAGVAIVTAR |
Ga0184609_102322681 | 3300018076 | Groundwater Sediment | VLGAMGISVPLFVVAAIFTGLAGVLAVCGMLAVIAITAARAR |
Ga0190265_116300761 | 3300018422 | Soil | SARELKRKREHQKEMVLGAMGISVPLMAIAAVFGGLPGIVAVCVALAVIAIVSAR |
Ga0190272_108728852 | 3300018429 | Soil | ERALKRRRDHQKEMVLGSMGISIPLFAIAAVFTGLPGVVAVCVALVVIALVSAR |
Ga0190269_109236991 | 3300018465 | Soil | QKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAVIVIASMR |
Ga0173482_105003851 | 3300019361 | Soil | QREMVLGSLAISIPLFAMAAIFTGLAGIIAVCVVLGVIAIASMRS |
Ga0190264_120841342 | 3300019377 | Soil | AISIPLFAIAAVFTGLAGVIAVCVVLAVIAITSARAR |
Ga0190267_113931052 | 3300019767 | Soil | RRNHQKEMVLGSMGISIPLLAIAAVFTGLAGVIAVCIALVLIAVVSSRG |
Ga0222622_105940802 | 3300022756 | Groundwater Sediment | LLESAQFPVMTDDAVKEMVLGSMAVSIPLLAIAAIFTGLPGVIAVCAALAVIAIASSRG |
Ga0207687_103913342 | 3300025927 | Miscanthus Rhizosphere | LGSMAISIPLLAIAAIFTGLAGVIAVCVALVVIAAITARS |
Ga0207686_114419761 | 3300025934 | Miscanthus Rhizosphere | RRRREHQKEMVLGAMALSIPLFALAAIFTGLAGVIVVCGALAVIAIVTSR |
Ga0207670_105134921 | 3300025936 | Switchgrass Rhizosphere | LGSMGISVPLLLFAEIFAGLAGIVVVCVALVAIAFIATRD |
Ga0207669_111759262 | 3300025937 | Miscanthus Rhizosphere | ALSIPLFAMAAIFTGLAGVIVVCAALVVIAVVASR |
Ga0207711_119719822 | 3300025941 | Switchgrass Rhizosphere | REHQKEMVLGAMALSIPLFAMAAIFTGLAGVIVVCAALVVIAVVASR |
Ga0207712_106601643 | 3300025961 | Switchgrass Rhizosphere | AERGGADQFAIERKREHQKEMVLGSMAISIPLLAIAAIFTGLAGVIAVCVALVVIAAITARG |
Ga0207712_113396031 | 3300025961 | Switchgrass Rhizosphere | SMALSIPLMAIAAIFTGLAGVITVCVALCVIAIVTSR |
Ga0207668_117462201 | 3300025972 | Switchgrass Rhizosphere | RDHQREMVLGSLAISIPLFAMAAIFTGLAGIIAVCVVLGVIAIASMRS |
Ga0209887_10394313 | 3300027561 | Groundwater Sand | KALERKREHQKEMVLGAMAISVPFFALAAIFTGLAGVIVVCAALVAIAVVTAR |
Ga0209818_12452582 | 3300027637 | Agricultural Soil | KRKQDHQKEMVLGSMAISIPLLAIAAIFTGLPGVVAVCVALAVIAIVSAR |
Ga0209481_101963051 | 3300027880 | Populus Rhizosphere | MGISIPLLALAAIFTGLAGVIVVCSALVVIAVVSAR |
Ga0247823_115005782 | 3300028590 | Soil | RRDHQKDMTLGAMAISIPLLAIAAVFTGLAGVIAVCVALAVIAIVTALQD |
Ga0307322_100534061 | 3300028710 | Soil | KEMVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAIATVR |
Ga0307320_100737452 | 3300028771 | Soil | MGISVPLFAIAAIFTGLAGVIAVCVMLAVIAIVSRR |
Ga0307320_103187372 | 3300028771 | Soil | DEQREKALSRKRAHQKEMVLGSMAISIPLMTIAAIFTGLAGVIAVCVAIAVVAIVAAR |
Ga0307287_100853533 | 3300028796 | Soil | AEERERSLERKREHQKEMVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAIATAR |
Ga0307287_101642103 | 3300028796 | Soil | SEQSLRRKREHQKEMVLGSMALSIPLFAVAAIFTGLAGIIVVCAALAVIAVVASR |
Ga0307287_103620121 | 3300028796 | Soil | LRRKREHQKEMVLGAMALSIPLLAIAAIFTGLAGVIVVCAALGVVAIATGR |
Ga0307284_101487951 | 3300028799 | Soil | SLERKREHQKEVVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAIATAR |
Ga0307305_101013201 | 3300028807 | Soil | QALKRKRDHQRDMVLGAMAISVPLFAMAAIFVGLAGILVVCGALAVIAIVSTRS |
Ga0247824_106416391 | 3300028809 | Soil | QKEMVLGSMGLAIPLLVVAAIFTGLAGVIVVCSAVVVIALASLR |
Ga0307296_106699531 | 3300028819 | Soil | MTDDAVKEMVLGSMAVSIPLLAIAAIFTGLPGVIAVCAALAVIAIASSRG |
Ga0307286_102268841 | 3300028876 | Soil | LAHKREHQKEMTLGSMAISIPLFAIAAVFTGLAGVITVCAVLAVIAIVSSR |
Ga0307278_103185052 | 3300028878 | Soil | EMVLGAMALSIPLFALAAIFTGLAGVIVVCAALAVIAIATAR |
Ga0307304_101108911 | 3300028885 | Soil | MVLGAMGISVPMLAVAAIFTGLAGVLVVCAALAVIAIATAR |
Ga0247826_105144411 | 3300030336 | Soil | MVLASMALSIPLMAIAAIFTGLAGVITVCVALCVIAVVTSR |
Ga0268241_100812251 | 3300030511 | Soil | KMRRDHQKEMVLGSMAIAIPLLAIAAIFTGLPGVIAVCVALAVIAIATAR |
Ga0307498_100098784 | 3300031170 | Soil | KRKREHQKEMVLGAMGISIPLLAIAAIFTGLAGVLVVCAALAIIAIATAR |
Ga0307498_104725212 | 3300031170 | Soil | HQKEMVLGSMAIAIPLLAIAAVFTGLAGVITVCVALVLIAIVSAR |
Ga0307468_1006207672 | 3300031740 | Hardwood Forest Soil | RPGGRSERSLKRKRDHQKEMVLGAMGISIPLLGIAAVFTGLAGVIVVCAALAVIALASRP |
Ga0307468_1021490331 | 3300031740 | Hardwood Forest Soil | KRDHQKEMVLGAMGISIPMLAIAAIFAGLAGVIVVCAALAVIAVVASR |
Ga0307406_109157681 | 3300031901 | Rhizosphere | DHQKEMVLGAMAISVPLFALAAIFAGLAGVIVVSSALVVIAVVSAR |
Ga0307406_112638371 | 3300031901 | Rhizosphere | GSMAISIPLFALAAVFTGLAGIIVVCVTLVAIAVATAR |
Ga0307406_119259942 | 3300031901 | Rhizosphere | LKRKRDHQKEMVLGSMGISIPLLAIAAVFTGLPGVIAVCLALAVIAIVSGRD |
Ga0307407_116862071 | 3300031903 | Rhizosphere | NHQKEMVLGSMAIAVPLLAIAAVFTGLPGVIAVCVALVAIAVVSSR |
Ga0307416_1029149212 | 3300032002 | Rhizosphere | KARREHQKEMILGAMGISVPLFVIAAIFVGLAGILVVCATLAVIAVVAGRTT |
Ga0307415_1007297593 | 3300032126 | Rhizosphere | REHQKEMVLGAMGISIPLLAIAAIFTGLAGVIAVCVALGVIAIATTFQR |
Ga0307472_1023389771 | 3300032205 | Hardwood Forest Soil | MGISVPMLAIAAIFTGLAGVLVVCAALAVIAIASSR |
Ga0306920_1012158733 | 3300032261 | Soil | TELTLGAMALSIPLLAIAAAFTGLAGVIVVCAALAVIAVTANR |
Ga0318519_106054752 | 3300033290 | Soil | RHRTELTLGAMALSIPLLAIAAAFTGLAGVIVVCAALAVIAVTANR |
Ga0247829_101685211 | 3300033550 | Soil | QKEMVLGSMAISIPLLAIAAIFTGLLGVVAVCVALAVIAIATTR |
⦗Top⦘ |