Metagenome Family F064981

Basic Information
Family ID	F064981
Family Type	Metagenome
Number of Sequences	128
Average Sequence Length	40 residues
Representative Sequence	FDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID
Number of Associated Samples	113
Number of Associated Scaffolds	128

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	10.94 %
% of genes near scaffold ends (potentially truncated)	86.72 %
% of genes from short scaffolds (< 2000 bps)	94.53 %
Associated GOLD sequencing projects	105
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Bacteria (88.281 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.250 % of family members)
Environment Ontology (ENVO)	Unclassified (32.812 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.531 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF12146	Hydrolase_4	6.25
PF13460	NAD_binding_10	3.91
PF07369	DUF1488	3.12
PF12695	Abhydrolase_5	3.12
PF03795	YCII	2.34
PF04072	LCM	2.34
PF13628	DUF4142	2.34
PF06902	Fer4_19	1.56
PF04940	BLUF	1.56
PF07366	SnoaL	1.56
PF03734	YkuD	1.56
PF09992	NAGPA	0.78
PF17209	Hfq	0.78
PF00571	CBS	0.78
PF02775	TPP_enzyme_C	0.78
PF00903	Glyoxalase	0.78
PF03576	Peptidase_S58	0.78
PF00027	cNMP_binding	0.78
PF04226	Transgly_assoc	0.78
PF07238	PilZ	0.78
PF14518	Haem_oxygenas_2	0.78
PF12536	DUF3734	0.78
PF07758	DUF1614	0.78
PF00113	Enolase_C	0.78
PF00872	Transposase_mut	0.78
PF11799	IMS_C	0.78
PF06781	CrgA	0.78
PF07478	Dala_Dala_lig_C	0.78
PF01726	LexA_DNA_bind	0.78
PF05099	TerB	0.78
PF13599	Pentapeptide_4	0.78
PF02074	Peptidase_M32	0.78
PF08241	Methyltransf_11	0.78
PF00881	Nitroreductase	0.78
PF14759	Reductase_C	0.78

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.34
COG3315	O-Methyltransferase involved in polyketide biosynthesis	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.34
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	1.56
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	1.56
COG3191	L-aminopeptidase/D-esterase	Amino acid transport and metabolism [E]	1.56
COG0148	Enolase	Carbohydrate transport and metabolism [G]	0.78
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.78
COG2317	Zn-dependent carboxypeptidase, M32 family	Posttranslational modification, protein turnover, chaperones [O]	0.78
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.78
COG3793	Tellurite resistance protein TerB	Inorganic ion transport and metabolism [P]	0.78
COG4089	Uncharacterized membrane protein	Function unknown [S]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.28 %
Unclassified	root	N/A	11.72 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	88.28 %
Unclassified	root	N/A	11.72 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	88.28 %
Unclassified	root	N/A	11.72 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.28 %
Unclassified	root	N/A	11.72 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	31.25 %
Unclassified	root	N/A	11.72 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20.31 %
Unclassified	root	N/A	11.72 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	4.69 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.72 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	8.59 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	4.69 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.56 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.78 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.78 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.59 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.91 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	2.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.56 %
Methyloligella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella	1.56 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.78 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.78 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.78 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.59 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.91 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	2.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.56 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.78 %
unclassified Methyloligella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella	0.78 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.78 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.78 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.59 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.91 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	2.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.56 %
unclassified Rhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium	0.78 %
Methyloligella sp. GL2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella → Methyloligella sp. GL2	0.78 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.78 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.78 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	8.59 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.91 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	2.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.56 %
Rhizobium sp. BK313	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. BK313	0.78 %
Methyloligella sp. GL2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella → Methyloligella sp. GL2	0.78 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.78 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.78 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000655\|AF_2010_repII_A100DRAFT_1095361	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300000890\|JGI11643J12802_11383534	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300000891\|JGI10214J12806_12586596	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300000956\|JGI10216J12902_101195145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	876	Open in IMG/M
3300001228\|SwM_135654	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300004479\|Ga0062595_100930853	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300005045\|Ga0071328_178413	All Organisms → cellular organisms → Bacteria	2271	Open in IMG/M
3300005093\|Ga0062594_101960975	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300005343\|Ga0070687_100911735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	631	Open in IMG/M
3300005347\|Ga0070668_101904280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548	Open in IMG/M
3300005356\|Ga0070674_101579875	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300005364\|Ga0070673_100119880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	2193	Open in IMG/M
3300005439\|Ga0070711_101508056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	587	Open in IMG/M
3300005466\|Ga0070685_10564914	All Organisms → cellular organisms → Bacteria	814	Open in IMG/M
3300005555\|Ga0066692_10026939	All Organisms → cellular organisms → Bacteria	2996	Open in IMG/M
3300005598\|Ga0066706_10579869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. BK313	891	Open in IMG/M
3300005614\|Ga0068856_101509021	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300005719\|Ga0068861_100990110	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300005719\|Ga0068861_101235916	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300005764\|Ga0066903_100551835	All Organisms → cellular organisms → Bacteria	1976	Open in IMG/M
3300005764\|Ga0066903_102859369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	936	Open in IMG/M
3300005764\|Ga0066903_104633673	All Organisms → cellular organisms → Bacteria	732	Open in IMG/M
3300005843\|Ga0068860_102839238	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300005844\|Ga0068862_100007343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	9155	Open in IMG/M
3300005937\|Ga0081455_10041336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4056	Open in IMG/M
3300006102\|Ga0075015_100713621	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300006175\|Ga0070712_100265674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1376	Open in IMG/M
3300006196\|Ga0075422_10190443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	838	Open in IMG/M
3300006845\|Ga0075421_102057178	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300006847\|Ga0075431_101905708	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300006881\|Ga0068865_100271520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1347	Open in IMG/M
3300007076\|Ga0075435_100925703	All Organisms → cellular organisms → Bacteria → Proteobacteria	760	Open in IMG/M
3300009012\|Ga0066710_102436959	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300009101\|Ga0105247_11659833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	527	Open in IMG/M
3300009137\|Ga0066709_101338977	Not Available	1047	Open in IMG/M
3300009156\|Ga0111538_10350370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	1869	Open in IMG/M
3300009156\|Ga0111538_12263937	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300009168\|Ga0105104_10507307	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300009171\|Ga0105101_10204166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	956	Open in IMG/M
3300009176\|Ga0105242_11799465	Not Available	651	Open in IMG/M
3300009177\|Ga0105248_10008416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11322	Open in IMG/M
3300009545\|Ga0105237_12592840	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009553\|Ga0105249_11604427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	723	Open in IMG/M
3300009818\|Ga0105072_1032262	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300009837\|Ga0105058_1084411	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300010358\|Ga0126370_12119605	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300010358\|Ga0126370_12609755	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300010366\|Ga0126379_10578510	All Organisms → cellular organisms → Bacteria → Proteobacteria	1206	Open in IMG/M
3300010366\|Ga0126379_13179775	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300010371\|Ga0134125_10610659	All Organisms → cellular organisms → Bacteria	1205	Open in IMG/M
3300010371\|Ga0134125_11478663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	740	Open in IMG/M
3300010373\|Ga0134128_10252462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1979	Open in IMG/M
3300010373\|Ga0134128_10728778	All Organisms → cellular organisms → Bacteria	1100	Open in IMG/M
3300010373\|Ga0134128_12629958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	555	Open in IMG/M
3300010375\|Ga0105239_10294429	All Organisms → cellular organisms → Bacteria → Proteobacteria	1828	Open in IMG/M
3300010401\|Ga0134121_12804502	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300010868\|Ga0124844_1264797	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300012198\|Ga0137364_10433991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	984	Open in IMG/M
3300012200\|Ga0137382_11332868	Not Available	506	Open in IMG/M
3300012210\|Ga0137378_11368286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	622	Open in IMG/M
3300012211\|Ga0137377_10898824	Not Available	817	Open in IMG/M
3300012212\|Ga0150985_116094048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	641	Open in IMG/M
3300012515\|Ga0157338_1009878	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300012582\|Ga0137358_10527287	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300012929\|Ga0137404_10922111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	797	Open in IMG/M
3300012960\|Ga0164301_11085167	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300012961\|Ga0164302_10471341	Not Available	878	Open in IMG/M
3300012971\|Ga0126369_10570363	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300012984\|Ga0164309_11041628	Not Available	677	Open in IMG/M
3300012988\|Ga0164306_10076751	All Organisms → cellular organisms → Bacteria → Proteobacteria	2113	Open in IMG/M
3300013297\|Ga0157378_11486055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	722	Open in IMG/M
3300013306\|Ga0163162_13251303	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300013307\|Ga0157372_10927605	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300014318\|Ga0075351_1020732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1029	Open in IMG/M
3300014326\|Ga0157380_10611263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1080	Open in IMG/M
3300014969\|Ga0157376_10545188	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300015371\|Ga0132258_12999608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1170	Open in IMG/M
3300015372\|Ga0132256_102469079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella	622	Open in IMG/M
3300015372\|Ga0132256_102815066	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300016341\|Ga0182035_10192209	All Organisms → cellular organisms → Bacteria → Proteobacteria	1607	Open in IMG/M
3300016341\|Ga0182035_10322795	All Organisms → cellular organisms → Bacteria	1274	Open in IMG/M
3300016357\|Ga0182032_10287831	All Organisms → cellular organisms → Bacteria → Proteobacteria	1292	Open in IMG/M
3300016357\|Ga0182032_11265306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → unclassified Methyloligella → Methyloligella sp. GL2	636	Open in IMG/M
3300016445\|Ga0182038_10809282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	822	Open in IMG/M
3300018028\|Ga0184608_10399276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300018482\|Ga0066669_10215977	Not Available	1484	Open in IMG/M
3300022889\|Ga0247785_1004489	Not Available	1353	Open in IMG/M
3300023057\|Ga0247797_1026787	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300025900\|Ga0207710_10686624	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300025919\|Ga0207657_11081024	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300025919\|Ga0207657_11207819	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300025924\|Ga0207694_11031077	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300025928\|Ga0207700_10304710	All Organisms → cellular organisms → Bacteria	1376	Open in IMG/M
3300025945\|Ga0207679_10253593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	1497	Open in IMG/M
3300025972\|Ga0207668_11405445	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300026023\|Ga0207677_11155595	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300026089\|Ga0207648_11579969	Not Available	616	Open in IMG/M
3300026118\|Ga0207675_100573621	All Organisms → cellular organisms → Bacteria	1129	Open in IMG/M
3300026142\|Ga0207698_11475837	Not Available	695	Open in IMG/M
3300026325\|Ga0209152_10263230	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300027395\|Ga0209996_1041505	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300027680\|Ga0207826_1077609	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300027818\|Ga0209706_10410100	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300027874\|Ga0209465_10362991	Not Available	725	Open in IMG/M
3300027909\|Ga0209382_10574999	All Organisms → cellular organisms → Bacteria	1230	Open in IMG/M
3300027915\|Ga0209069_10458902	Not Available	709	Open in IMG/M
3300027964\|Ga0256864_1024182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1589	Open in IMG/M
3300027964\|Ga0256864_1038624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1287	Open in IMG/M
3300028380\|Ga0268265_11422496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	696	Open in IMG/M
3300028592\|Ga0247822_10565258	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300030620\|Ga0302046_10891931	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300031232\|Ga0302323_103020547	Not Available	537	Open in IMG/M
3300031250\|Ga0265331_10494973	Not Available	550	Open in IMG/M
3300031368\|Ga0307429_1063121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1112	Open in IMG/M
3300031368\|Ga0307429_1090326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	877	Open in IMG/M
3300031740\|Ga0307468_101514543	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300031744\|Ga0306918_11476667	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300031890\|Ga0306925_10281418	All Organisms → cellular organisms → Bacteria	1790	Open in IMG/M
3300031892\|Ga0310893_10343600	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300032017\|Ga0310899_10685974	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300032042\|Ga0318545_10152727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	821	Open in IMG/M
3300032122\|Ga0310895_10226291	All Organisms → cellular organisms → Bacteria → Proteobacteria	853	Open in IMG/M
3300032179\|Ga0310889_10460083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	640	Open in IMG/M
3300032211\|Ga0310896_10288856	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300032261\|Ga0306920_101930402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	829	Open in IMG/M
3300033550\|Ga0247829_10851712	Not Available	759	Open in IMG/M
3300034354\|Ga0364943_0124268	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300034817\|Ga0373948_0075261	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.50%
Host-Associated	Host-Associated	37.50%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	56.25%
Plants	Host-Associated → Plants	37.50%
Aquatic	Environmental → Aquatic	6.25%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.44%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.06%
Freshwater	Environmental → Aquatic → Freshwater	2.34%
Sediment	Environmental → Aquatic → Sediment	2.34%
Marine	Environmental → Aquatic → Marine	1.56%
Peat	Environmental → Terrestrial → Peat	0.78%
Floodplain	Environmental → Terrestrial → Floodplain	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.84%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.50%
Loam	Environmental → Terrestrial → Soil → Loam	8.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.59%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.34%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.34%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.56%
Sand	Environmental → Terrestrial → Soil → Sand	1.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.56%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.78%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.59%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.03%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.47%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.69%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.91%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.12%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.34%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.34%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.56%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.56%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.78%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.78%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.47%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.47%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.69%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.12%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.34%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.34%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.34%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.34%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.34%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.56%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.56%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.56%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.56%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.78%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.78%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.78%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.78%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.78%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.78%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.78%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001228	Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005045	Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014318	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300022889	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4	Environmental	Open in IMG/M
3300023057	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300027964	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated	Open in IMG/M
3300031368	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031892	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F064981

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AF_2010_repII_A100DRAFT_10953612	3300000655	Forest Soil	DTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID*
JGI11643J12802_113835343	3300000890	Soil	TEDTKKAKEFAASADLKEALMKAGVLDTPTIYFLESID*
JGI10214J12806_125865961	3300000891	Soil	NKSEIVVVFDTEDTKKAKEFAASADLKEAMMAAGVLDTPTI*
JGI10216J12902_1011951454	3300000956	Soil	DTKKAKDFAASADLKETMKQSGVLDTPTIYFLESID*
SwM_1356542	3300001228	Switchgrass Rhizosphere	TKKAKDFAASTDLKEAMIKAGVLDTPTIYFLESID*
Ga0062595_1009308531	3300004479	Soil	DTEDTKKAKEFAASADLKEAMMAAGVLDTPTIYFLESID*
Ga0071328_1784133	3300005045	Permafrost	VVVFDTEDTKRAKDFAASTDLKEAMMKVGVLDTPTIYFLEAID*
Ga0062594_1019609751	3300005093	Soil	VVFDTEDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID*
Ga0070687_1009117351	3300005343	Switchgrass Rhizosphere	VVFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTIYLLESID*
Ga0070668_1019042801	3300005347	Switchgrass Rhizosphere	FDTEDTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID*
Ga0070674_1015798751	3300005356	Miscanthus Rhizosphere	FDTEDTKKAKDFAASSDLKEAMMKAGVLDTPTIYFLESID*
Ga0070673_1001198804	3300005364	Switchgrass Rhizosphere	FDTEDTKKAKDFALSADLKEVMKQSGVLDTPTIYFLESID*
Ga0070711_1015080561	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	VVVFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTLYFLESID*
Ga0070685_105649143	3300005466	Switchgrass Rhizosphere	VFDTEDTKKAKEFAASADLKEAMEKAGVLDTPTIYFLESID*
Ga0066692_100269397	3300005555	Soil	VFDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID*
Ga0066706_105798692	3300005598	Soil	DTTDTKKAKEFATSSDLKDVMTKAGVIDVPTMYFLESI*
Ga0068856_1015090211	3300005614	Corn Rhizosphere	KSEIVVVFDTEDTKKAKEFAASPDLKEAMMAAGVIDTPTIYFLESID*
Ga0068861_1009901102	3300005719	Switchgrass Rhizosphere	EDTKKAKEFAASADLKEAMMKAGVLDTPTIYFLESID*
Ga0068861_1012359161	3300005719	Switchgrass Rhizosphere	DTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID*
Ga0066903_1005518354	3300005764	Tropical Forest Soil	TKDTQKAKAFAASPDLKEVMSKAGVVDTPTIYFLESID*
Ga0066903_1028593691	3300005764	Tropical Forest Soil	VVFETKDTKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID*
Ga0066903_1046336732	3300005764	Tropical Forest Soil	DTKKAKDFAASADLKEVMKQSGVLDTPTIYFLESID*
Ga0068860_1028392381	3300005843	Switchgrass Rhizosphere	FDTEDTKKAKEFAASADLKEAMMKAGVLDTPTIYFLESID*
Ga0068862_1000073431	3300005844	Switchgrass Rhizosphere	FDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID*
Ga0081455_100413369	3300005937	Tabebuia Heterophylla Rhizosphere	FDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID*
Ga0075015_1007136211	3300006102	Watersheds	VFDTEDTQKAKDFAASADLDEAMKQAGVLDTPTIYFLESID*
Ga0070712_1002656741	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	SETVVVFDTEDTKKASDFAASADLKEAMKQAGVLDTPTIYFLESID*
Ga0075422_101904431	3300006196	Populus Rhizosphere	KKAKDFAVSADLKEVMKQSGVLDTPTIYFLESID*
Ga0075421_1020571783	3300006845	Populus Rhizosphere	DTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID*
Ga0075431_1019057082	3300006847	Populus Rhizosphere	IVVVFDTEDTKKAKEFAASAALKEAMMAAGVLDTPTIYFLESID*
Ga0068865_1002715201	3300006881	Miscanthus Rhizosphere	VVVFDTEDPKKAKDFAASADLKEAMKHAGILDTPTLSQA*
Ga0075435_1009257031	3300007076	Populus Rhizosphere	MFDTEDTKKAKEFAASADLKEAMIKAGVVDQPTIYFLESID*
Ga0066710_1024369592	3300009012	Grasslands Soil	SSTLRIPRWPKDFAASADLKEAMIRAGVLDTPTIYFLESID
Ga0105247_116598331	3300009101	Switchgrass Rhizosphere	TEDTKKAKEFAASADLKEAMMAAGVIDTPTIYFLESID*
Ga0066709_1013389771	3300009137	Grasslands Soil	IFDTTDTKKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI*
Ga0111538_103503701	3300009156	Populus Rhizosphere	SEIVIVFDTEDTKKAKDFAMSADLKEVMKQSGVLETPTIYFLESID*
Ga0111538_122639371	3300009156	Populus Rhizosphere	KKAKDFAMSADLKEAMKQAGVLDNPTIYFLESID*
Ga0105104_105073071	3300009168	Freshwater Sediment	EFVVVFDTEDTKKANEFAASTDLKESMMAAGVLDAPTIYFLESID*
Ga0105101_102041661	3300009171	Freshwater Sediment	IVVVFDTRDTKSAKTFAASDDLKDAMTEAGVLDTPTVYFLESID*
Ga0105242_117994651	3300009176	Miscanthus Rhizosphere	TEDTKRAKAFATSTDLEETMAEASVVDTPTIYFLESID*
Ga0105248_1000841613	3300009177	Switchgrass Rhizosphere	KKAKDFAASADLKEAMIKAGVLDTPTIYFLESID*
Ga0105237_125928402	3300009545	Corn Rhizosphere	LVVFDTESTKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID*
Ga0105249_116044271	3300009553	Switchgrass Rhizosphere	IVVVFDTEDPKKAKDFAASADLKEAMKQSGVLDAPTIYFLESID*
Ga0105072_10322621	3300009818	Groundwater Sand	TKKAKDFAASADLKEAMMEAGVLDTPTIYFLESID*
Ga0105058_10844112	3300009837	Groundwater Sand	VVVFDTKDTKVAKAFAASAGLKEAMTKAGVVDVPTIYLLESI*
Ga0126370_121196052	3300010358	Tropical Forest Soil	AAKIAKDFATSADLKEAMKQAGVLDTPTIYFLESID*
Ga0126370_126097551	3300010358	Tropical Forest Soil	KSEIVIVFDTEDTKKAKDFAASADLKEVMKQAGVLDTPTIYFLESID*
Ga0126379_105785101	3300010366	Tropical Forest Soil	KKAKAFAASADLKEAMTKAGVVDMPTIYFLESID*
Ga0126379_131797752	3300010366	Tropical Forest Soil	VVFDTEDTKKAKDFAASADLKAAMKQAGVLDTPTIYFLESID*
Ga0134125_106106591	3300010371	Terrestrial Soil	VFDTEDTKKAKDFAASADLKEAMEKAGVLDTPTIYFLESID*
Ga0134125_114786631	3300010371	Terrestrial Soil	VVVFDTKETKVAKDFVVSTDLKEAMTKAGVVDTPTIYFLESID*
Ga0134128_102524625	3300010373	Terrestrial Soil	DTKKARDFAASADLKEAMKQAGVLDTPTIYFLESID*
Ga0134128_107287783	3300010373	Terrestrial Soil	KSEIVVVFDTESTKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID*
Ga0134128_126299581	3300010373	Terrestrial Soil	TKKAKDFAASADLKEAMEKAGVLDTPTIYLLESID*
Ga0105239_102944293	3300010375	Corn Rhizosphere	EIVVVFDTEDTKKAKEFAASADLKEAMDTAGVLDTPTIYFLESID*
Ga0134121_128045022	3300010401	Terrestrial Soil	VFDTQDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID*
Ga0124844_12647971	3300010868	Tropical Forest Soil	IVFDTEDTKKAKDFAASADLKEVMKQSGVLDTPTIYFLESID*
Ga0137364_104339912	3300012198	Vadose Zone Soil	RIPRWPKDFAASADLKEAMIKAGVLDTPTIYFLESID*
Ga0137382_113328681	3300012200	Vadose Zone Soil	DTKKAKEFATSSDLKDVMTKAGVIDVPTMYFLESI*
Ga0137378_113682862	3300012210	Vadose Zone Soil	EDTKKAKDFAASADLNEAMIKAGVLDTPTIYFLESID*
Ga0137377_108988241	3300012211	Vadose Zone Soil	TDTEKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI*
Ga0150985_1160940482	3300012212	Avena Fatua Rhizosphere	EIVVVFDTKETKMAKDFSASADLKEAMTKAGVVDTPTIYFLESID*
Ga0157338_10098781	3300012515	Arabidopsis Rhizosphere	TQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID*
Ga0137358_105272872	3300012582	Vadose Zone Soil	VFDTEDTKKAKDFAASALKEAMIKAGVLDTPTIYFLKSID*
Ga0137404_109221111	3300012929	Vadose Zone Soil	VVFDTEDTKKAKDFAASADLKEAMEKAGVLDAPTIYFLESID*
Ga0164301_110851671	3300012960	Soil	EDTKKAKEFAASADLKEAMEKAGVLDTPTIYFLESID*
Ga0164302_104713412	3300012961	Soil	DAADTKKAKEFATSSNLKDVMTKAGVIDVPTMYFLESI*
Ga0126369_105703631	3300012971	Tropical Forest Soil	TEDTKKAKDFAASADLKEAMQRAGVLFTPTIYFLESID*
Ga0164309_110416282	3300012984	Soil	VVVFDTEDTKRANEFAASADVKDAMMKAGVLDTPTIDFLESID*
Ga0164306_100767513	3300012988	Soil	VILEKAKEFAAAADLKEAMEKAGVLDTPTIYFLESID*
Ga0157378_114860551	3300013297	Miscanthus Rhizosphere	KETKVAKDFAVSTDLKEAMTEGGVVDTPTIYFLESID*
Ga0163162_132513031	3300013306	Switchgrass Rhizosphere	TKMAKDFAASADLKEAMMEAGVLDTPTIYFLESID*
Ga0157372_109276051	3300013307	Corn Rhizosphere	SEIVVVFDTEDTKKAKEFAASADLKEAMMAAGVIDTPTIYFLESID*
Ga0075351_10207321	3300014318	Natural And Restored Wetlands	DTKKAKDFAASADLKEAMEKAGVLDTPTIYFLESID*
Ga0157380_106112633	3300014326	Switchgrass Rhizosphere	VVVFDTKDTKSAKTFAASDDLKKAMGEAGVLDTPTVYFLESID*
Ga0157376_105451881	3300014969	Miscanthus Rhizosphere	TEDPKKAKDFAASADLKEAMKHAGILDTPTIYFL*
Ga0132258_129996081	3300015371	Arabidopsis Rhizosphere	KKAKDFAASADLKEAMEKAGVLDTPTIYLLESID*
Ga0132256_1024690791	3300015372	Arabidopsis Rhizosphere	SEIVVVFDTQDTKKAKEFAASSDLKEAMLKAGVLDTPTIFS*
Ga0132256_1028150661	3300015372	Arabidopsis Rhizosphere	TKKAKDFAASAGLKEAMEQAGILDTPTIYFLESID*
Ga0182035_101922091	3300016341	Soil	VVVFETKDSKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID
Ga0182035_103227954	3300016341	Soil	VFDTEDTKKAKDFAASADLKEAMKQSGVLDTPTIYFLESID
Ga0182032_102878311	3300016357	Soil	ETKDSKKAKAFAASADLKEAMTKAGVVDMPTIYFLESID
Ga0182032_112653061	3300016357	Soil	EDTKKAKDFAASDDLKEAMKRSGVLDTLTIYFLDSID
Ga0182038_108092821	3300016445	Soil	VVFDTNDTKKAKAFAASADLKEAMTKAGVVDTPTIYFLESID
Ga0184608_103992762	3300018028	Groundwater Sediment	VPGQLFGAEDTKRAKEFAASADLKEAMMAAGVIDTPTIYFLESID
Ga0066669_102159771	3300018482	Grasslands Soil	TTDTKKAKEFASSSNLKEVMTKAGVSDVPTMYFLESI
Ga0247785_10044891	3300022889	Soil	VVFDTKDTQKAKAFAASPDLKEAMSRASVVDTPTIYFLESID
Ga0247797_10267871	3300023057	Soil	VVFDTKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID
Ga0207710_106866241	3300025900	Switchgrass Rhizosphere	TEDTKKAKDFATSAALTEAMMKAGVLDTPTIYFLESID
Ga0207657_110810241	3300025919	Corn Rhizosphere	KSEIVVVFDTEDPKKAKDFAASADLKEAMKHAGILDTPTIYFLESID
Ga0207657_112078191	3300025919	Corn Rhizosphere	KSEIVVVFDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID
Ga0207694_110310773	3300025924	Corn Rhizosphere	TKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID
Ga0207700_103047101	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	TQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID
Ga0207679_102535933	3300025945	Corn Rhizosphere	SNKSEIVIVFDTEDTKKAKDFAVSADLKEVMKQSGVLDTPTIYFLESID
Ga0207668_114054452	3300025972	Switchgrass Rhizosphere	SNKSEIVVVFDTEDTRMAKAFAASADLKEAMVKAGVLDTPTIYFLESID
Ga0207677_111555951	3300026023	Miscanthus Rhizosphere	VVVFDTKDTKMAKDFAGSVDLKEAMAEAGVVDMPTIYLLESID
Ga0207648_115799692	3300026089	Miscanthus Rhizosphere	TEDTKRAKAFATSTDLEETMAEASVVDTPTIYFLESID
Ga0207675_1005736211	3300026118	Switchgrass Rhizosphere	EDTKKAKEFAVSSDLKEAMTAAGVLDTPTIYFLESID
Ga0207698_114758371	3300026142	Corn Rhizosphere	GYQEGKGFAASTDLKGAMIKAGVLDTPTIYFFESID
Ga0209152_102632302	3300026325	Soil	EDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID
Ga0209996_10415051	3300027395	Arabidopsis Thaliana Rhizosphere	DTEDTKKAKDFAASAELKEAMEKAGVLDTPTIYFLESID
Ga0207826_10776091	3300027680	Tropical Forest Soil	MLPNRAKAFAAWAELKEAMMRAGVVDTPTIYFLESID
Ga0209706_104101001	3300027818	Freshwater Sediment	KSEVVVVFDTKDTKLAKEFAGSADLKEAMMKAGVEDSPTIYFLESID
Ga0209465_103629912	3300027874	Tropical Forest Soil	SEIVIVFDTEDTKKAKDFAASADLKEVMKQSGVLDTPTIYFLETV
Ga0209382_105749991	3300027909	Populus Rhizosphere	TKRAKEFAASPDLKEAMMAAGVLDAPTIYFLESID
Ga0209069_104589022	3300027915	Watersheds	DTTKAKAFAGSADLKEAMMKAGVLDTPTIYFLESID
Ga0256864_10241824	3300027964	Soil	FDTKETKMAKDFAASAVLKQAMSKAGVVDTPTIYFLESID
Ga0256864_10386241	3300027964	Soil	VVVFDTKETKMAKDFAASADLKQAMSKAGVVDTPTIYF
Ga0268265_114224962	3300028380	Switchgrass Rhizosphere	VFDTKETKVAKDFAVSTDLREAMTKAGVVDTPTIYFLESID
Ga0247822_105652581	3300028592	Soil	TKRAKEFAASADLKEAMMAAGVIDTPTIYFLESID
Ga0302046_108919311	3300030620	Soil	DTEDTKKAKDFAASADLREAMMKAGVLDTPTIYFLESID
Ga0302323_1030205472	3300031232	Fen	MDTKKARDFAASADLKETMMKAGVVDKPTIYFLELA
Ga0265331_104949731	3300031250	Rhizosphere	FDDMDTKKAKEFAHSADLKETMMKAGVVDVPTIYFLETI
Ga0307429_10631211	3300031368	Salt Marsh	DTEDTSKAKEFADSTDLKEAMAKAGVSDTPTIYFLESID
Ga0307429_10903262	3300031368	Salt Marsh	VVVFDTEDTKKAKDFAASADLKETMTKAGVVDAPTIYFLESID
Ga0307468_1015145433	3300031740	Hardwood Forest Soil	VVVFDTKDTQKAKAFAASPDLKEAMSRAGVVDTPTIYFLESID
Ga0306918_114766671	3300031744	Soil	MRFWLLFAAGAELKEAMMKAGVMDTPTIYFLESID
Ga0306925_102814181	3300031890	Soil	FDTEDTKKAKDFAASDDLKEAMKRSGVLDTPTIYFLDSID
Ga0310893_103436001	3300031892	Soil	VVVFDTEDPKKAKDFAASADLKEAMKHAGVLDTPTIYFLESID
Ga0310899_106859741	3300032017	Soil	VVFDTKDTKSAKAFAASDDLKDAMTKAGVLDTPTVYFLESID
Ga0318545_101527271	3300032042	Soil	VFDTEDTKKAKDFAASADLKEAMIKAGVLDTPTIYFLESID
Ga0310895_102262911	3300032122	Soil	VVFDTKDTNSAKAFAVSDDLKKAMSEAGLDTPTVYFLESID
Ga0310889_104600831	3300032179	Soil	TKKAKEFAASPDLKEAMMAAGVLDAPTIYFLESID
Ga0310896_102888561	3300032211	Soil	SEIVVVFDTEDTKKAKEFAASADLKEAMETAGVLDTPTIYFLESID
Ga0306920_1019304021	3300032261	Soil	DDKSEIVVVFDTKDTKRAKDFAASPNLRERMVKAGVMDDPTIYFLESV
Ga0247829_108517121	3300033550	Soil	VVVFDTKDTKSAKAFAASDDLKDAMTKAGVLDTPTVYFLESID
Ga0364943_0124268_1_117	3300034354	Sediment	TEDTKKAKDFAASADLKEAMMEAGVLDTPTIYFLESID
Ga0373948_0075261_3_140	3300034817	Rhizosphere Soil	EIVVVFDTEDTKKAKEFAASADLKEAMETAGVLDTPTIYFLESID

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign