NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064980

Metagenome / Metatranscriptome Family F064980

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064980
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 51 residues
Representative Sequence MPYRPQRSKKPEHKPGELESRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK
Number of Associated Samples 97
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.17 %
% of genes near scaffold ends (potentially truncated) 32.81 %
% of genes from short scaffolds (< 2000 bps) 74.22 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.438 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(10.156 % of family members)
Environment Ontology (ENVO) Unclassified
(24.219 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(29.688 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 39.51%    β-sheet: 0.00%    Coil/Unstructured: 60.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF01479S4 32.03
PF00487FA_desaturase 6.25
PF08029HisG_C 3.12
PF00005ABC_tran 2.34
PF00132Hexapep 2.34
PF00849PseudoU_synth_2 1.56
PF01925TauE 0.78
PF04041Glyco_hydro_130 0.78
PF01420Methylase_S 0.78
PF13091PLDc_2 0.78
PF13439Glyco_transf_4 0.78
PF02833DHHA2 0.78
PF07992Pyr_redox_2 0.78
PF00011HSP20 0.78
PF04461DUF520 0.78
PF13360PQQ_2 0.78
PF01253SUI1 0.78
PF08388GIIM 0.78
PF12848ABC_tran_Xtn 0.78
PF03446NAD_binding_2 0.78
PF00749tRNA-synt_1c 0.78
PF00754F5_F8_type_C 0.78
PF01758SBF 0.78
PF08448PAS_4 0.78
PF00076RRM_1 0.78
PF06745ATPase 0.78
PF02517Rce1-like 0.78
PF08206OB_RNB 0.78
PF09723Zn-ribbon_8 0.78
PF02565RecO_C 0.78
PF01176eIF-1a 0.78
PF02518HATPase_c 0.78
PF03880DbpA 0.78
PF13291ACT_4 0.78
PF02706Wzz 0.78
PF00884Sulfatase 0.78
PF07963N_methyl 0.78
PF04545Sigma70_r4 0.78
PF00326Peptidase_S9 0.78
PF02609Exonuc_VII_S 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 6.25
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 6.25
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 3.12
COG0513Superfamily II DNA and RNA helicaseReplication, recombination and repair [L] 2.34
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 1.56
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 1.56
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.78
COG0023Translation initiation factor 1 (eIF-1/SUI1)Translation, ribosomal structure and biogenesis [J] 0.78
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.78
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.78
COG0557Exoribonuclease RTranscription [K] 0.78
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.78
COG0732Restriction endonuclease S subunitDefense mechanisms [V] 0.78
COG1158Transcription termination factor RhoTranscription [K] 0.78
COG1227Inorganic pyrophosphatase/exopolyphosphataseEnergy production and conversion [C] 0.78
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.78
COG1278Cold shock protein, CspA familyTranscription [K] 0.78
COG1381Recombinational DNA repair protein RecO (RecF pathway)Replication, recombination and repair [L] 0.78
COG1666Cyclic di-GMP-binding protein YajQ, UPF0234 familySignal transduction mechanisms [T] 0.78
COG1722Exonuclease VII small subunitReplication, recombination and repair [L] 0.78
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.78
COG3206Exopolysaccharide export protein/domain GumC/Wzc1Cell wall/membrane/envelope biogenesis [M] 0.78
COG3524Capsule polysaccharide export protein KpsE/RkpRCell wall/membrane/envelope biogenesis [M] 0.78
COG3765LPS O-antigen chain length determinant protein, WzzB/FepE familyCell wall/membrane/envelope biogenesis [M] 0.78
COG3944Capsular polysaccharide biosynthesis protein YveKCell wall/membrane/envelope biogenesis [M] 0.78
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.78
COG4776Exoribonuclease IITranscription [K] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.44 %
UnclassifiedrootN/A26.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_101579689All Organisms → cellular organisms → Bacteria → PVC group512Open in IMG/M
3300005338|Ga0068868_100563823All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1005Open in IMG/M
3300005354|Ga0070675_100090136All Organisms → cellular organisms → Bacteria2568Open in IMG/M
3300005367|Ga0070667_101222635All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium703Open in IMG/M
3300005367|Ga0070667_102011268All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300005436|Ga0070713_102490415Not Available500Open in IMG/M
3300005529|Ga0070741_10007122All Organisms → cellular organisms → Bacteria23432Open in IMG/M
3300005577|Ga0068857_100022464All Organisms → cellular organisms → Bacteria5550Open in IMG/M
3300005615|Ga0070702_101487776Not Available557Open in IMG/M
3300005829|Ga0074479_10580966All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300005831|Ga0074471_10466054All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006046|Ga0066652_100370261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1296Open in IMG/M
3300006175|Ga0070712_100335415All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1233Open in IMG/M
3300006642|Ga0075521_10608210All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
3300007258|Ga0099793_10565437All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia568Open in IMG/M
3300009011|Ga0105251_10591720All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium526Open in IMG/M
3300009091|Ga0102851_10051033All Organisms → cellular organisms → Bacteria3324Open in IMG/M
3300009093|Ga0105240_11231894Not Available791Open in IMG/M
3300009111|Ga0115026_11119540All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium637Open in IMG/M
3300009131|Ga0115027_10143177All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300009131|Ga0115027_10478384All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300009167|Ga0113563_10107153All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2582Open in IMG/M
3300009167|Ga0113563_11179406All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300009502|Ga0114951_10059352All Organisms → cellular organisms → Bacteria2278Open in IMG/M
3300009502|Ga0114951_10063148All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2191Open in IMG/M
3300009502|Ga0114951_10136847Not Available1359Open in IMG/M
3300009519|Ga0116108_1139330All Organisms → cellular organisms → Bacteria → PVC group722Open in IMG/M
3300009639|Ga0116122_1159408All Organisms → cellular organisms → Bacteria → PVC group716Open in IMG/M
3300009776|Ga0116154_10083455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1461Open in IMG/M
3300010037|Ga0126304_11060358All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010159|Ga0099796_10414146Not Available593Open in IMG/M
3300010343|Ga0074044_10023273All Organisms → cellular organisms → Bacteria4440Open in IMG/M
3300010352|Ga0116247_10736142Not Available737Open in IMG/M
3300010397|Ga0134124_10373122All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1350Open in IMG/M
3300010398|Ga0126383_13005509Not Available551Open in IMG/M
3300010401|Ga0134121_11788586All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300011413|Ga0137333_1001585All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5644Open in IMG/M
3300012164|Ga0137352_1123572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium509Open in IMG/M
3300012411|Ga0153880_1466062All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300012469|Ga0150984_104919413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium554Open in IMG/M
3300012469|Ga0150984_113139588All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae1426Open in IMG/M
3300012582|Ga0137358_10122967All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0631764Open in IMG/M
3300012944|Ga0137410_11394032Not Available609Open in IMG/M
3300013105|Ga0157369_11595467All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium663Open in IMG/M
3300013296|Ga0157374_11357590Not Available733Open in IMG/M
3300013307|Ga0157372_11962329Not Available673Open in IMG/M
3300014156|Ga0181518_10003942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia13468Open in IMG/M
3300014162|Ga0181538_10010497All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia7255Open in IMG/M
3300014325|Ga0163163_13330304All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300014490|Ga0182010_10392471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium756Open in IMG/M
3300014490|Ga0182010_10461636All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium698Open in IMG/M
3300014491|Ga0182014_10000831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia42050Open in IMG/M
3300014491|Ga0182014_10154983All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1288Open in IMG/M
3300014494|Ga0182017_10067318All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2369Open in IMG/M
3300014494|Ga0182017_10971149Not Available510Open in IMG/M
3300014496|Ga0182011_10173981All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1476Open in IMG/M
3300014498|Ga0182019_11466387Not Available507Open in IMG/M
3300014502|Ga0182021_11566271All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118794Open in IMG/M
3300014502|Ga0182021_13532566Not Available520Open in IMG/M
3300014839|Ga0182027_10032642All Organisms → cellular organisms → Bacteria6745Open in IMG/M
3300014839|Ga0182027_10391522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1547Open in IMG/M
3300014839|Ga0182027_10507523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1315Open in IMG/M
3300015372|Ga0132256_103783150Not Available509Open in IMG/M
3300016270|Ga0182036_10344568All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1146Open in IMG/M
3300018016|Ga0187880_1004431All Organisms → cellular organisms → Bacteria10350Open in IMG/M
3300018021|Ga0187882_1251040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium684Open in IMG/M
3300018038|Ga0187855_10777004All Organisms → cellular organisms → Bacteria → PVC group558Open in IMG/M
3300018083|Ga0184628_10006360All Organisms → cellular organisms → Bacteria5662Open in IMG/M
3300021168|Ga0210406_10916773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium658Open in IMG/M
3300021363|Ga0193699_10300973All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300021363|Ga0193699_10326572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium639Open in IMG/M
3300022526|Ga0224533_1038288All Organisms → cellular organisms → Bacteria → PVC group809Open in IMG/M
3300022555|Ga0212088_10053405All Organisms → cellular organisms → Bacteria4288Open in IMG/M
3300023088|Ga0224555_1163195All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium636Open in IMG/M
3300023090|Ga0224558_1042255All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1943Open in IMG/M
3300023091|Ga0224559_1208454Not Available673Open in IMG/M
3300023101|Ga0224557_1044163All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2117Open in IMG/M
3300024232|Ga0247664_1086478All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium725Open in IMG/M
3300025482|Ga0208715_1092643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium531Open in IMG/M
3300025938|Ga0207704_11336489Not Available613Open in IMG/M
3300026116|Ga0207674_10030994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales5620Open in IMG/M
3300027722|Ga0209819_10210095All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium678Open in IMG/M
3300027905|Ga0209415_10117908All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2817Open in IMG/M
3300028573|Ga0265334_10012505All Organisms → cellular organisms → Bacteria3567Open in IMG/M
3300028573|Ga0265334_10246328Not Available616Open in IMG/M
3300028573|Ga0265334_10307590All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300028623|Ga0257141_1070052All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300028800|Ga0265338_10132877All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae1961Open in IMG/M
3300028800|Ga0265338_10409241All Organisms → cellular organisms → Bacteria → Proteobacteria966Open in IMG/M
3300029984|Ga0311332_10625162Not Available852Open in IMG/M
3300030000|Ga0311337_10593523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium952Open in IMG/M
3300030943|Ga0311366_10553008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1001Open in IMG/M
3300031344|Ga0265316_10275326All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300031344|Ga0265316_10560134Not Available813Open in IMG/M
3300031344|Ga0265316_10682429Not Available725Open in IMG/M
3300031344|Ga0265316_11003418All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium581Open in IMG/M
3300031344|Ga0265316_11079906All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium557Open in IMG/M
3300031726|Ga0302321_101615065All Organisms → cellular organisms → Bacteria → PVC group749Open in IMG/M
3300031902|Ga0302322_101933518Not Available724Open in IMG/M
3300031902|Ga0302322_102375734Not Available653Open in IMG/M
3300032018|Ga0315272_10171155All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300032177|Ga0315276_10296569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1718Open in IMG/M
3300032177|Ga0315276_12630231All Organisms → cellular organisms → Bacteria → PVC group501Open in IMG/M
3300032256|Ga0315271_11088722All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300032275|Ga0315270_11010492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium551Open in IMG/M
3300033402|Ga0326728_10434001Not Available1102Open in IMG/M
3300033418|Ga0316625_101980781All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium572Open in IMG/M
3300033418|Ga0316625_102101930Not Available559Open in IMG/M
3300033419|Ga0316601_102298395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium543Open in IMG/M
3300033482|Ga0316627_100356395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1233Open in IMG/M
3300033482|Ga0316627_100785393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium898Open in IMG/M
3300033488|Ga0316621_11134670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium588Open in IMG/M
3300033521|Ga0316616_100141047All Organisms → cellular organisms → Bacteria2256Open in IMG/M
3300033521|Ga0316616_102137171All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300033557|Ga0316617_100375545All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300033557|Ga0316617_100476965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1126Open in IMG/M
3300033557|Ga0316617_100899828All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium857Open in IMG/M
3300033887|Ga0334790_001808All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia17402Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen10.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.38%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere7.81%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.47%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.47%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.12%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland2.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.34%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.34%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.34%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.56%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.56%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.56%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge1.56%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.78%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.78%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009776Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaGEngineeredOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022526Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14EnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028623Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10157968923300001213WetlandMPYRPQRSKKPEHKPGELESRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK
Ga0062591_10224054623300004643SoilELKPGELESRKFRDNQASDQRRREMATRSTLSRLRNRKSDLK*
Ga0068868_10056382323300005338Miscanthus RhizosphereMRYRLKRSKKPEPKPGEFEARQFRANQLADQRRRELATRSTLSRLRNRKSDLK*
Ga0070675_10009013613300005354Miscanthus RhizosphereGTLRGMPHRPPRKKKPEAAPGALEHLQDRAQQQSEQRRREMATRSTLSRLRNRKSDLK*
Ga0070667_10122263513300005367Switchgrass RhizosphereMPHRPPRKKKPEAAPGALEHLQDRAQQQSEQRRREMATRSTLSRLRNRKSDLK*
Ga0070667_10201126813300005367Switchgrass RhizosphereDFMPHRAPRSKKSEAKPGELENRQFHQNQFLDRRNREMATRSTLSRLRNRKSDLK*
Ga0070713_10249041513300005436Corn, Switchgrass And Miscanthus RhizosphereMPYRPQKRKKPETKPGELNKHQSQADQYSDLRRRDMTACSTLSRLRNRKSDLK*
Ga0070741_10007122143300005529Surface SoilMRWYVHMPHRAPRKKTQPKPQELDRYQARSNQLAEQRRRELATRSTLSRLQNRKSDLK*
Ga0068857_10002246463300005577Corn RhizosphereMPYRPKRSKKSEPKPGELDIRQLRADQLAAQRHRDLATRSTLSRLRNRKSDLK*
Ga0070702_10148777623300005615Corn, Switchgrass And Miscanthus RhizosphereMTYRLKKSKKPELKPGEFEARQFRANQLADQRRRELATRSTLSRLRNRKSDLK*
Ga0074479_1058096623300005829Sediment (Intertidal)MPYRPKKSKKSNAKLGELTSGQFRADQFQEQRRRDMATRSTLSRLRNRKSDLK*
Ga0074471_1046605413300005831Sediment (Intertidal)TNSPQPAKKPESKPGEQEKRPFRANQFEEQRRRDMATRSTLSRLRNRKSDLK*
Ga0066652_10037026123300006046SoilMTYPTKKSKKAEAKPGPFGNRQSRADQLADQRRRELATRSTLSRLRNRKSDLK*
Ga0070712_10033541523300006175Corn, Switchgrass And Miscanthus RhizosphereMPYRPQKLKKSEPKPGELKSHQFRADQRSDQRRREMSTRSTLSRLRNRKSDLK*
Ga0075521_1060821013300006642Arctic Peat SoilMPYRPKRAKKPEAKPGELENRQSHYDQLADQRRREMATRSTLSRLRNRKSDLK*
Ga0099793_1056543723300007258Vadose Zone SoilPKRTKKPDLKPGEFGNRQDRANQLSDQRRRDMATRSTLSRLRNRKSDLK*
Ga0105251_1059172013300009011Switchgrass RhizosphereTLRGMPHRPPRKKKPEAAPGALEHLQDRAQQQSEQRRREMATRSTLSRLRNRKSDLK*
Ga0102851_1005103323300009091Freshwater WetlandsMGPFSVAAWHMTNRPHRPKKPEPKPGELENRQYRANQLLDQRRREMVTRSTLSRLRNRKSDLK*
Ga0105240_1123189413300009093Corn RhizosphereMPHRPPRSKKNQPSEKGLDPHQHRSEQLAALRRREAATRSTLSRLRNRKSDLK*
Ga0075418_1129067623300009100Populus RhizosphereKPGELENLQFPSGQLAGQRWQAMNTGSILSRLRTRKSDLK*
Ga0115026_1111954013300009111WetlandVLARIGPFSVSAWHMTNRPQRPKKPEPKPGELENRQYRANQLLDQRRREMATRSTLSRLRNRKSDLK*
Ga0115027_1014317723300009131WetlandMTNRPQRPKKPEPKPGELENRQYRANQLLDQRRREMVTRSTLSRLRNRKSDLK*
Ga0115027_1047838423300009131WetlandMTNRRPKSKKPEPKPGELESRPFRANQLLDQRRRENATRSTLSRLRNRKSDLK*
Ga0113563_1010715323300009167Freshwater WetlandsMTNRPQRPKKPEPKPGELENRQFRANQLLDQRRREMATRSTLSRLRNRKSDLK*
Ga0113563_1117940623300009167Freshwater WetlandsMTIRPPKSKKPEPKPGELESRPFRANQLLDQRRRENATRSTLSRLRNRKSDLK*
Ga0114951_1005935243300009502FreshwaterMPYRPQRSKKPESKPGELGNQQSRANQIADQRRREMATRSTLSRLRNRKSDLK*
Ga0114951_1006314823300009502FreshwaterMPYRPPKSKKAAPKPGELENRRFHSDQLSDQRRREMATRSTLSRLRNRKSDLK*
Ga0114951_1013684723300009502FreshwaterMPYRPKKSQKSKTKPGELESGQLRDNQFLDRRRQDSATRSTLSRLRNRKSDLK*
Ga0116108_113933023300009519PeatlandMPYRPPRSKKTNLKPGELENRQFHFGQLSDQRRREMTTRSTLSRLRNRKSDLK*
Ga0116122_115940823300009639PeatlandMPYRPQRSKKTNLKPGELENRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK*
Ga0116154_1008345523300009776Anaerobic Digestor SludgeMPYRPKRSKKTERKPGEFESDRLRAGQLADLRRRDMATRSTLSRLRNRKSDLK*
Ga0126304_1106035823300010037Serpentine SoilMPYRPPRPKKSELKPGELESRKFRDNQVSDQRRREMATRSTLSRLRNRKSDLK*
Ga0126312_1133402833300010041Serpentine SoilKPGELENLQSRSAQLANQRRQQMATRSTLSRLRNRKSDLK*
Ga0099796_1041414623300010159Vadose Zone SoilMPYRPKRKKTESKPGELDTRQLRANQLAAQRHRDLATRSTLSRLRNRKSDLK*
Ga0074044_1002327333300010343Bog Forest SoilMLYRTKRSKRPEPKPGEPGFDQVAANQFADRRRRDADTRSTLSRLRNRKSDLK*
Ga0116247_1073614213300010352Anaerobic Digestor SludgeMPYRPPRSKKSKLKPGQLENRQFHSDQLSDQRRREMATRST
Ga0134124_1037312223300010397Terrestrial SoilVPYRPKRAVKPESKPGDFAASDLRERQREEQRRAQMATRSTLSRLRNRKSDAK*
Ga0126383_1300550913300010398Tropical Forest SoilMPYRPQKPKKSEPKPGEPKKYQFRADQYSDLRHREMTTRSTLSRLRNRKSDLK*
Ga0134121_1178858623300010401Terrestrial SoilMPHRPPRTKKNQPKTGELENRQFQSNQFANQRRQDMATRSTLARLRNRKSDLK*
Ga0137333_100158553300011413SoilMPYRPKRSKKPEPNPGELGFDQVRASLFSDQRRRDMATRSTLSRLRNRKSALK*
Ga0137352_112357213300012164SoilMPYRPKRSKKPEPNPGELGFDQVRASLFSDQRRRDMATRSTLSR
Ga0153880_146606213300012411Freshwater SedimentQRSKKPESKPGELGNQQSRANQIADQRRREMATRSTLSRLRNRKSDLK*
Ga0150984_10491941323300012469Avena Fatua RhizosphereVLFRSPKKSKKPELKPGPFENRQSRADQLADRRRRELATRSTLSRLRNRKSDLK*
Ga0150984_11313958813300012469Avena Fatua RhizosphereRPKKAKKPELKPGEFDPRQSRAHQLAGQRRQDFATRSTLSRLRNRKSDLK*
Ga0137358_1012296713300012582Vadose Zone SoilMPYRPKRTKKPDLKPGEFGNRQDRANQLSDQRRRDMATR
Ga0137410_1139403213300012944Vadose Zone SoilMLNRPKAAKTSKPKLAVLSGGQFRAAQIADQRRREMATRSTLSRLRNRKSDLK*
Ga0157369_1159546713300013105Corn RhizosphereMPHRPPRKKKPQPQPGELDHRRDRFEQISEQRRRELATRSTLSRLRNRKSDLK*
Ga0157374_1135759013300013296Miscanthus RhizosphereKKNQLKPGELDLSQVRSNQIAEQRRRDMATRSTLSRLRNRKSDLK*
Ga0157372_1196232913300013307Corn RhizosphereMPHRPPRKKKPETKAGELEHRASGFQQLSDQRRRDMATRSTLSRLRNRKSD
Ga0181518_1000394293300014156BogMPYRPPRSKKTNLKPGELENRQFHFGQLSDQRRREMATRSTLSRLRNRKSDLK*
Ga0181538_1001049723300014162BogMPYRPPRSKKTNLKPVELENRQFHFGQLSDQRRREMTTRSTLSRLRNRKSDLK*
Ga0163163_1333030423300014325Switchgrass RhizosphereRSKKSEPKPGELENLQFHSGQLAGQRWQAMNTRSILSRLRNRKSDLK*
Ga0182010_1039247113300014490FenPQRTKKPSLKPGELENRQFHSSKLADQRRREMATRSTLSRLRNRKSDLK*
Ga0182010_1046163623300014490FenMPYRPKRSKKPELKPGETGFDQVRANQFSDQRRRDMATRSTLSRLRNRKSALK*
Ga0182014_10000831343300014491BogMPYRPQRPKKTNLKPGELENRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK*
Ga0182014_1015498323300014491BogMPYRPQRTKKPELKPGELENRQFHSNQQADQRRREMATRSTLSRLRNRKSDLK*
Ga0182017_1006731813300014494FenMPYRSKKPKKSGVKPEALESGRVRANQFSDRRRRDMATRSTLSRLRNRKSDLK*
Ga0182017_1043154513300014494FenKPGELENRQSHFGQLSDQRRREMATRSTLSRLRNRKSDLK*
Ga0182017_1097114913300014494FenMPYRPKRPKKPEPKPGEQGFDQIRANQFADRRRRDMATRST
Ga0182011_1017398123300014496FenMPYRPKRSKKPELKPGEAGFDQVRANQFSDQRRRDMATRSTLSRLRNRKSALK*
Ga0182011_1073698913300014496FenMPYRPAKSKKAGVKPGALESGRVRANEFSDRRRRDMATRSTLS
Ga0182019_1146638723300014498FenMPYRPKRSKKPEAKPGEPGFDQATANQFMDRRRRDMAARSTLARLRNRKSDLK*
Ga0182021_1156627113300014502FenMPYRPKRSKKPEAKPGEPGFDQATANQFMDRRRRDMAARST
Ga0182021_1353256613300014502FenMPYRPKRSKKSEPKPGELGSSQVRANQWSEHRRRDVATRSTLSRLRNRKSDLK*
Ga0182027_1003264223300014839FenMPYRPKRPKKPEPKPGEQGFDQVRANQFADRRRRDMATRSTLSRLRNRKSDLK*
Ga0182027_1039152223300014839FenMPYRPQRSKKSKAKPGDLENRQFHSDQLSDQRRREMATRSTLSRLRNRKSDLK*
Ga0182027_1050752323300014839FenMPNRPQKSNKPELKPGELEHRQLRSNQLSDQRRREMATRSTLSRLRNRKSDLK*
Ga0132256_10378315013300015372Arabidopsis RhizosphereKPELKPGEFEARQFRANQLADQRRRELATRSTLSRLRNRKSDLK*
Ga0182036_1034456813300016270SoilKRRKSESKPGELKKYQFQVDQHSDLRHREMTTRSTLSRLRNRKSDLK
Ga0187880_100443143300018016PeatlandMPYRPQRSKKTNLKPGELENRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK
Ga0187882_125104023300018021PeatlandMPYRPKRSKKPDAKPGEPGFNQVNANQFADRQRRDMAARSTLSRLRNRKSDLK
Ga0187855_1077700413300018038PeatlandMPYRPPRSKKTNLKPGELENRQFHFGQLSDQRRREMATRSTLSRLRNRKSDLK
Ga0184628_1000636023300018083Groundwater SedimentMTNRPQRPTKPETKPAEQESRPFRANQLQDQRRREMATRSTLSRLRNRKSDLK
Ga0210406_1091677313300021168SoilMPYRPKRKKTESKPGELDTRQLRADQLAAQRHRDFATRSTLSRLRNRKSDLK
Ga0193699_1030097323300021363SoilMPYRPKKSKKPHPKPGELESGQFRANQFADQRRRDLATRSTLSRLRNRKSDLK
Ga0193699_1032657223300021363SoilMPHRPPRTKKNQPKPGELENRQSAHLASQRRQEMATRSTLARLRNRKSDLK
Ga0224533_103828823300022526SoilMPYRPQRPKKTNLKPGELENRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK
Ga0212088_1005340553300022555Freshwater Lake HypolimnionMPYRPPKSKKAAPKPGELENRRFHSDQLSDQRRREMATRSTLSRLRNRKSDLK
Ga0224555_116319523300023088SoilPKKTNLKPGELENRQFHSNQLADQRRREMATRSTLSRLRNRKSDLK
Ga0224558_104225523300023090SoilMPYRPRKSKKANLKPGALESVQFRADQFSDLRRRDMNTRSTLSRLRNRKSDLK
Ga0224559_120845423300023091SoilMPYRPKRSKKPEAKPGEPGFDQATANQFMDRRRRDMAARSTLARL
Ga0224557_104416323300023101SoilMPYRPQRTKKPELKPGELENRQFHSNQQADQRRREMATRSTLSRLRNRKSDLK
Ga0247664_108647823300024232SoilKKSEPKPGELKSHQFRADQRSDQRRREMSTRSTLSRLRNRKSDLK
Ga0208715_109264313300025482Arctic Peat SoilQRSKKTNLKPGELENRQFHSSQLADQQRREMATRSTLSRLRNRKSDLK
Ga0207693_1122674723300025915Corn, Switchgrass And Miscanthus RhizosphereGELKSHQFRADQRSDQRRREMSTRSTLSRLRNRKSDLK
Ga0207704_1133648923300025938Miscanthus RhizosphereMTYRLKKSKKPELKPGEFEARQFRANQLADQRRRELATRSTLSRLRNRKSDLK
Ga0207674_1003099433300026116Corn RhizosphereMPYRPKRSKKSEPKPGELDIRQLRADQLAAQRHRDLATRSTLSRLRNRKSDLK
Ga0209819_1021009513300027722Freshwater SedimentMPYRPRKSNKAQRKAGELENQQTRANKLSGQRYHAMATRSTLSRLRNRKSDLK
Ga0209415_1011790823300027905Peatlands SoilMPYRPPRAKKPNLKPGELENRQSHFGQLSDQRRREMATRSTLSRLRNRKSDLK
Ga0265334_1001250533300028573RhizosphereMPYRPKRSKKPDAKPGEPGFNQVNANQFADRHRRDMATRSTLSRLRNRKSDLK
Ga0265334_1024632823300028573RhizosphereMANSPQKSKKSEFKPGVLESNQVRASQNEVQRRRDMAVRSTLSRLRNRKSALK
Ga0265334_1030759013300028573RhizosphereMPYRPKRSKKPEAKPGEPGFNQANTNQFADRHRRDMATRS
Ga0257141_107005223300028623MarinePQRSKKPESKPGELGNQQSRANQIADQRRREMATRSTLSRLRNRKSDLK
Ga0265338_1013287723300028800RhizosphereMPYRPRKSKKSDAKPEALENGQHRANQFSELRRREMATRSTLSRLRNRKSDLK
Ga0265338_1040924123300028800RhizosphereMPDRPQKPKKPEPKLGGLKEHQFRSDQRTDQRHRDMTTRSTLSRLRNRKSDLK
Ga0311332_1062516223300029984FenMQNQPKASKKTVPKPGELGSAQTRANQFADQRRREMATRSTLSRLRNRKSDLK
Ga0311337_1059352323300030000FenMPYRPKRSKKLELKPGEQGFDQSRANQFEDRRRRDMATRSTLSRLRNRKSDLK
Ga0311366_1055300813300030943FenMSNLKKTQPKPGKNSPSRAEQLAEQRRRDMATRSTLSRLRNRKSALK
Ga0265316_1027532623300031344RhizosphereMPYRPKRSKKSEPKPGDAGFDPARANQFLDRRRMANATRSTLSRLRNRKSDLK
Ga0265316_1056013413300031344RhizosphereMPYRPKRSKKPEPKLGEPGFGQVAANQFADRRRRDMATRSTLSRLRNRKSNLK
Ga0265316_1068242923300031344RhizosphereMPYRPKRSKKPETKPGEPGFNQANTNQFEDRRRRDMATRSTLSRLRNRKSDLK
Ga0265316_1100341813300031344RhizosphereMPYRPKRSKKPEPKPGEVGFDQVRANQFSDQRRRDMATRSTLSR
Ga0265316_1107990623300031344RhizosphereMPHRPPRTKKSQSRPGDLENRQAHSNQIADQRRREMATRSTLSRLR
Ga0302321_10039820633300031726FenPKPGELENEQLCSHQLVDQRPRDMATRSTLSRLHNRTSDLE
Ga0302321_10161506523300031726FenMPYRPKRAKKPEAKPGELENRQSHYDQLADQRRREMATRSTLSRLRNRKSDLK
Ga0302322_10193351823300031902FenMPYRPKRSKKPEAKPGEPDFDQATANQFMDRRRRDMATRSTLARLRNRKSDLK
Ga0302322_10237573423300031902FenMPYRTKRSKKAEPKPGEAGFDQVNADQFADRRRRDMATRSTLSRLRNRKSDLK
Ga0315278_1018900243300031997SedimentGELENRQFHSNQLADQRRRENATRSTLSRLRNRKSDLK
Ga0315272_1017115523300032018SedimentMTNRPQQSKKPEPKPGEAENRAFRANQLQEQRRREMATRSTLSRLRNRKSDLK
Ga0315276_1029656913300032177SedimentMPYRPQKSKKANLKPGELENRQFHSGQLADQRRREMATRSTLSRLRNRK
Ga0315276_1263023123300032177SedimentMPYRPQRSKKAKPAPGDLENRQFHSDQLADQRRREMATRSALSRLRNRKSDLK
Ga0315271_1108872223300032256SedimentMTNSPQPAKKPEPKPGEQEKRPFRANQFEEQRRRDMATRSTLSRLRNRKSDLK
Ga0315271_1151186223300032256SedimentQSKTVELNRGENRANQFADQRLRAMATRSTLSRLRNRKSDLK
Ga0315270_1101049223300032275SedimentLVVMPHRPKRSKKPQPKPGELENLQFRSSQLAGQRHQDMTTRSTLSRLRNRKSDLK
Ga0326728_1043400123300033402Peat SoilMPNSRPQPTKKPQPKAGAWENHQARSSQLANQRRQDMATRSTLSRLRNRKSDLK
Ga0316625_10198078113300033418SoilMTYRPPKSKKPEPKPGELESRPFRANQLLDQRRRENATRSTLSRLRNRKSDLK
Ga0316625_10210193023300033418SoilKKPEPKTEVFANDQLRAHQLADHRRRDMATRSTLSRLRNRKSDLK
Ga0316601_10229839513300033419SoilSVPPWHMTNRPPKSKKPEPKPGELESRPFRANQLLDQRRRENATRSTLSRLRNRKSDLK
Ga0316627_10035639523300033482SoilMTNRPQRPKKPEPKPGELENRQFRANQLLDQRRREMVTRSTLSRLRNRKSDLK
Ga0316627_10078539313300033482SoilMTNRPPKSKKTEPKPGELESRPFRANQLLDQRRREMATRSTLSRLRNRKSDLK
Ga0316629_1166003113300033483SoilSEPKPGELDTRQSRANQLADQRRREMATRSTLSRLRNRKSDLK
Ga0316621_1113467013300033488SoilHMTNRPPKSKKPEPKPGELESRPFRANQLLDQRRRENATRSTLSRLRNRKSDLK
Ga0316616_10014104723300033521SoilMPYRPKRSKQPEPKPGESDFDQVRASQFSDQRRRDMATRSTLSRLRNRESALK
Ga0316616_10213717123300033521SoilMTIRPPKSKKPEPKPGELESRPFRANQLLDQRRREMATRSTLSRLRNRKSDLK
Ga0316617_10037554523300033557SoilMTNRPQRPKKPEPKPGELENRQYRANQLLDQRRREMVTRSTLSRLRNRKSDLK
Ga0316617_10047696523300033557SoilMPYRTKRSKQPEPKPGESDFDQVRASQFSDQRRRDMATRSTLSRLCNRESAMK
Ga0316617_10089982823300033557SoilMTNRPPKSKKPEPKPGELESRPFRANQLLDQRRREMATRSTLSRLRNRKSDLK
Ga0334790_001808_14763_149243300033887SoilMPYRPRKSKKANPKPGALESVQFRADQFSDLRRRDMNTRSTLSRLRNRKSDLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.