NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064874

Metagenome / Metatranscriptome Family F064874

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064874
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 42 residues
Representative Sequence GYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP
Number of Associated Samples 66
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 24.41 %
% of genes near scaffold ends (potentially truncated) 92.97 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 63
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (56.250 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(32.812 % of family members)
Environment Ontology (ENVO) Unclassified
(32.031 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.438 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF04392ABC_sub_bind 2.34
PF00872Transposase_mut 2.34
PF00106adh_short 1.56
PF02627CMD 1.56
PF13359DDE_Tnp_4 1.56
PF06508QueC 1.56
PF03050DDE_Tnp_IS66 1.56
PF01609DDE_Tnp_1 1.56
PF13358DDE_3 1.56
PF09344Cas_CT1975 0.78
PF13730HTH_36 0.78
PF13592HTH_33 0.78
PF14104DUF4277 0.78
PF13612DDE_Tnp_1_3 0.78
PF13586DDE_Tnp_1_2 0.78
PF02371Transposase_20 0.78
PF13518HTH_28 0.78
PF08388GIIM 0.78
PF00264Tyrosinase 0.78
PF00589Phage_integrase 0.78
PF13005zf-IS66 0.78
PF13551HTH_29 0.78
PF13614AAA_31 0.78
PF13613HTH_Tnp_4 0.78
PF02796HTH_7 0.78
PF05057DUF676 0.78
PF13271DUF4062 0.78
PF00691OmpA 0.78
PF10134RPA 0.78
PF12762DDE_Tnp_IS1595 0.78
PF10282Lactonase 0.78
PF12704MacB_PCD 0.78
PF08241Methyltransf_11 0.78
PF00884Sulfatase 0.78
PF03683UPF0175 0.78
PF13524Glyco_trans_1_2 0.78
PF00924MS_channel 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.34
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 2.34
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 1.56
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 1.56
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 1.56
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.56
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 1.56
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 1.56
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.56
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.56
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 1.56
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 1.56
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.56
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.56
COG3293TransposaseMobilome: prophages, transposons [X] 1.56
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.56
COG3436TransposaseMobilome: prophages, transposons [X] 1.56
COG5421TransposaseMobilome: prophages, transposons [X] 1.56
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.56
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.56
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.78
COG2886Predicted antitoxin, contains HTH domainGeneral function prediction only [R] 0.78
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.78
COG3547TransposaseMobilome: prophages, transposons [X] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A56.25 %
All OrganismsrootAll Organisms43.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111006|2214758282All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella850Open in IMG/M
3300005289|Ga0065704_10342423Not Available821Open in IMG/M
3300005294|Ga0065705_10152783All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300005294|Ga0065705_10700303Not Available653Open in IMG/M
3300005294|Ga0065705_11142376Not Available507Open in IMG/M
3300005295|Ga0065707_10883596All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005332|Ga0066388_100865862Not Available1487Open in IMG/M
3300005332|Ga0066388_101171376All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300005332|Ga0066388_101463593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1192Open in IMG/M
3300005332|Ga0066388_103438397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300005332|Ga0066388_107140945Not Available562Open in IMG/M
3300005332|Ga0066388_107706395Not Available539Open in IMG/M
3300005332|Ga0066388_108758581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300005447|Ga0066689_10832427Not Available573Open in IMG/M
3300005552|Ga0066701_10149138All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300005552|Ga0066701_10825492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4551Open in IMG/M
3300005558|Ga0066698_10948187All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005562|Ga0058697_10093280Not Available1236Open in IMG/M
3300005562|Ga0058697_10274352Not Available795Open in IMG/M
3300005562|Ga0058697_10336667All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005562|Ga0058697_10400198Not Available680Open in IMG/M
3300005562|Ga0058697_10629506Not Available563Open in IMG/M
3300005568|Ga0066703_10701606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4582Open in IMG/M
3300005764|Ga0066903_100156693All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum3289Open in IMG/M
3300005764|Ga0066903_100761378All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300005764|Ga0066903_101127139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea1449Open in IMG/M
3300005764|Ga0066903_101470719All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300005764|Ga0066903_103388492Not Available860Open in IMG/M
3300005764|Ga0066903_104099414Not Available780Open in IMG/M
3300005764|Ga0066903_104299050All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005764|Ga0066903_104443412Not Available748Open in IMG/M
3300005764|Ga0066903_104766158Not Available721Open in IMG/M
3300005764|Ga0066903_107099940Not Available580Open in IMG/M
3300005764|Ga0066903_107774625All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005764|Ga0066903_108977182All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006032|Ga0066696_10126692Not Available1568Open in IMG/M
3300006049|Ga0075417_10085316Not Available1415Open in IMG/M
3300006049|Ga0075417_10090192All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300006049|Ga0075417_10093370Not Available1357Open in IMG/M
3300006049|Ga0075417_10170363Not Available1020Open in IMG/M
3300006049|Ga0075417_10477249Not Available624Open in IMG/M
3300006049|Ga0075417_10510994Not Available604Open in IMG/M
3300006058|Ga0075432_10175129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis836Open in IMG/M
3300006194|Ga0075427_10004815All Organisms → cellular organisms → Bacteria1905Open in IMG/M
3300006194|Ga0075427_10009284Not Available1464Open in IMG/M
3300006194|Ga0075427_10031275Not Available874Open in IMG/M
3300006194|Ga0075427_10036573Not Available818Open in IMG/M
3300006844|Ga0075428_100161204All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2434Open in IMG/M
3300006844|Ga0075428_100254110Not Available1893Open in IMG/M
3300006844|Ga0075428_100257069Not Available1881Open in IMG/M
3300006844|Ga0075428_100358894Not Available1563Open in IMG/M
3300006844|Ga0075428_100384132All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300006844|Ga0075428_100521962Not Available1270Open in IMG/M
3300006844|Ga0075428_102116601Not Available582Open in IMG/M
3300006844|Ga0075428_102209832Not Available567Open in IMG/M
3300006845|Ga0075421_100263290Not Available2109Open in IMG/M
3300006845|Ga0075421_100455050Not Available1528Open in IMG/M
3300006845|Ga0075421_100577494All Organisms → cellular organisms → Bacteria → Terrabacteria group1324Open in IMG/M
3300006845|Ga0075421_100627873All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300006845|Ga0075421_100980249All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300006846|Ga0075430_100130980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2090Open in IMG/M
3300006846|Ga0075430_101119193Not Available648Open in IMG/M
3300006846|Ga0075430_101207581Not Available622Open in IMG/M
3300006846|Ga0075430_101602807Not Available534Open in IMG/M
3300006847|Ga0075431_100950987All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300006847|Ga0075431_101177373Not Available730Open in IMG/M
3300006847|Ga0075431_101415999Not Available654Open in IMG/M
3300006852|Ga0075433_10255773Not Available1553Open in IMG/M
3300006871|Ga0075434_101803963All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006880|Ga0075429_100450688Not Available1127Open in IMG/M
3300006880|Ga0075429_100617871Not Available950Open in IMG/M
3300006904|Ga0075424_102067624Not Available600Open in IMG/M
3300006969|Ga0075419_10080488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2073Open in IMG/M
3300006969|Ga0075419_10098873Not Available1874Open in IMG/M
3300006969|Ga0075419_10620338Not Available761Open in IMG/M
3300009038|Ga0099829_10791001Not Available788Open in IMG/M
3300009090|Ga0099827_11521061Not Available583Open in IMG/M
3300009100|Ga0075418_10102911Not Available3031Open in IMG/M
3300009100|Ga0075418_11305432All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum787Open in IMG/M
3300009147|Ga0114129_11991668Not Available702Open in IMG/M
3300010047|Ga0126382_10544786All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300010145|Ga0126321_1229865Not Available898Open in IMG/M
3300010398|Ga0126383_13049921Not Available547Open in IMG/M
3300012199|Ga0137383_10027147All Organisms → cellular organisms → Bacteria → Proteobacteria4002Open in IMG/M
3300012210|Ga0137378_10904994Not Available795Open in IMG/M
3300012212|Ga0150985_101569672All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.1397Open in IMG/M
3300012351|Ga0137386_11198728Not Available531Open in IMG/M
3300012469|Ga0150984_112653882Not Available656Open in IMG/M
3300012961|Ga0164302_11126524All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012971|Ga0126369_10271352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1681Open in IMG/M
3300015371|Ga0132258_11803445All Organisms → cellular organisms → Bacteria → Proteobacteria1542Open in IMG/M
3300015372|Ga0132256_100011312All Organisms → cellular organisms → Bacteria7739Open in IMG/M
3300015374|Ga0132255_100009110All Organisms → cellular organisms → Bacteria11514Open in IMG/M
3300015374|Ga0132255_100897633Not Available1325Open in IMG/M
3300015374|Ga0132255_100997656All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300015374|Ga0132255_102067014Not Available868Open in IMG/M
3300015374|Ga0132255_106145891Not Available508Open in IMG/M
3300016319|Ga0182033_10202946All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor1578Open in IMG/M
3300016319|Ga0182033_11387094Not Available633Open in IMG/M
3300016319|Ga0182033_11813834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300016371|Ga0182034_10295915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1295Open in IMG/M
3300016404|Ga0182037_11998823Not Available520Open in IMG/M
3300016422|Ga0182039_11028052Not Available740Open in IMG/M
3300026312|Ga0209153_1047707Not Available1511Open in IMG/M
3300026323|Ga0209472_1072926Not Available1412Open in IMG/M
3300027874|Ga0209465_10032563Not Available2459Open in IMG/M
3300028587|Ga0247828_10432524All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter766Open in IMG/M
3300028587|Ga0247828_11233499All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031572|Ga0318515_10078401Not Available1709Open in IMG/M
3300031681|Ga0318572_10587330All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia664Open in IMG/M
3300031682|Ga0318560_10313523All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300031748|Ga0318492_10101460All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300031793|Ga0318548_10354406Not Available720Open in IMG/M
3300031798|Ga0318523_10356437All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031833|Ga0310917_10330939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1032Open in IMG/M
3300031912|Ga0306921_11076828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae902Open in IMG/M
3300031941|Ga0310912_10949825Not Available660Open in IMG/M
3300031947|Ga0310909_10155474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides1883Open in IMG/M
3300031995|Ga0307409_100229222All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300031995|Ga0307409_101368667Not Available734Open in IMG/M
3300032054|Ga0318570_10540408Not Available532Open in IMG/M
3300032060|Ga0318505_10295240All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia764Open in IMG/M
3300032065|Ga0318513_10630646Not Available525Open in IMG/M
3300032180|Ga0307471_101738492Not Available777Open in IMG/M
3300032261|Ga0306920_104325651Not Available510Open in IMG/M
3300032261|Ga0306920_104380735Not Available506Open in IMG/M
3300034678|Ga0314803_016774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi1048Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere32.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil16.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.25%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.91%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave3.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere3.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.34%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22137728272209111006Arabidopsis RhizosphereGQQMMPNNVGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVPP
Ga0065704_1034242323300005289Switchgrass RhizosphereGYALKAGQLTYDCRYSTIHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0065705_1015278343300005294Switchgrass RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP*
Ga0065705_1070030313300005294Switchgrass RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNGVPP*
Ga0065705_1114237623300005294Switchgrass RhizosphereLYILFDGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNG
Ga0065707_1088359613300005295Switchgrass RhizosphereGYALKAGQLTYDCRYSTMHGMPVIGGRGFRGLKPLWYNGVPP*
Ga0066388_10086586213300005332Tropical Forest SoilGYLLKVGQLEYDCRYSKMHDMPVTGGRSFRSLKPLWYKGVPP*
Ga0066388_10117137613300005332Tropical Forest SoilMGPKTGGPGYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNG
Ga0066388_10146359343300005332Tropical Forest SoilLKAGQWTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0066388_10343839733300005332Tropical Forest SoilGYPLKAGQLTYDCRYSTMHGMPVTGSRGFRGLKPLWYNGVPP*
Ga0066388_10695173413300005332Tropical Forest SoilMEPLSPIARGEITGYALKAGQLTYDCRYSTMHGMPVTGGCGFRGLKPLWYNG
Ga0066388_10714094513300005332Tropical Forest SoilGYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP*
Ga0066388_10770639513300005332Tropical Forest SoilGYPLKAGQLGYDCRYSKMHGMPVTGGRGFRGLKPWWYNSVPP*
Ga0066388_10875858123300005332Tropical Forest SoilLKVGQLEYDCRYSKMYGMPVAGGRGFSALKPLWYKGVPP*
Ga0066689_1083242723300005447SoilGYPLKAGQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0066701_1014913843300005552SoilMSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGV
Ga0066701_1082549233300005552SoilQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0066698_1094818723300005558SoilMSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGRGFRG
Ga0058697_1009328013300005562AgaveGYALKAGQLTYDCRYSTMHGMPVTGGRGFRALKPLWYNGVPP*
Ga0058697_1027435233300005562AgaveMLTERALGQTGYPLKAGQLTYDCRYSTMHGIPVTGGRGFRGLKPLWYNSVPP*
Ga0058697_1033666733300005562AgaveVHGALGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPL
Ga0058697_1040019813300005562AgaveAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP*
Ga0058697_1062950613300005562AgaveLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0066703_1070160613300005568SoilEGYPLKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0066903_10015669313300005764Tropical Forest SoilQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP*
Ga0066903_10076137833300005764Tropical Forest SoilGYALKAGQLTYDCRYSTMHGMPVTGGHGFRGLKPLWYNGVPP*
Ga0066903_10112713913300005764Tropical Forest SoilVFPGYLLKPGQLEYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV
Ga0066903_10147071933300005764Tropical Forest SoilGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYHSVPP*
Ga0066903_10338849213300005764Tropical Forest SoilKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP*
Ga0066903_10409941413300005764Tropical Forest SoilMNTGGGPPEGYALKAGQLTYDCRYSTMHGMPVTGGHGFRGLKPLWYNGV
Ga0066903_10429905013300005764Tropical Forest SoilGYLLKVGQLEYDCRYSKMHGMPVTGGRSFRSLKPLWYKGVPP*
Ga0066903_10444341213300005764Tropical Forest SoilGYLLKAGQLEYDCRYSTMHGMPVTGGRGFRGLKPWWYNGVPP*
Ga0066903_10476615823300005764Tropical Forest SoilMGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPWWYNGVPA*
Ga0066903_10709994013300005764Tropical Forest SoilLEYDCRYSKMHGMPVTGGRGFRALKPLWYKGVPP*
Ga0066903_10777462513300005764Tropical Forest SoilLLAGSGYLLKPGQLEYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV
Ga0066903_10897718213300005764Tropical Forest SoilLRVRGYALKAGQLTYDCHYSAMHGMPVTGGRGFRSLKPLWYNG
Ga0066696_1012669233300006032SoilYALKAGQLTYDCRYSTMHGMPVTGGRGFRDLKPLWYNGVPP*
Ga0075417_1008531613300006049Populus RhizosphereQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP*
Ga0075417_1009019213300006049Populus RhizosphereQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP*
Ga0075417_1009337013300006049Populus RhizosphereLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075417_1017036313300006049Populus RhizosphereQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP*
Ga0075417_1047724913300006049Populus RhizosphereMGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVP
Ga0075417_1051099423300006049Populus RhizosphereQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075432_1017512933300006058Populus RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP*
Ga0075427_1000481513300006194Populus RhizosphereVCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNG
Ga0075427_1000928413300006194Populus RhizosphereVVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYN
Ga0075427_1003127523300006194Populus RhizosphereMGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP*
Ga0075427_1003657313300006194Populus RhizosphereMGSYSQWGYVLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075428_10016120413300006844Populus RhizosphereQLTYDCRYSTMHGMPVTGRRGFRGLKLLWYNGVPP*
Ga0075428_10025411043300006844Populus RhizosphereLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP*
Ga0075428_10025706943300006844Populus RhizosphereMGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP
Ga0075428_10035889413300006844Populus RhizosphereEGYALKAGQLTYDCRYSTMHGIPVTGGRGFRGLKPLWYKASQEQ*
Ga0075428_10038413253300006844Populus RhizosphereYPTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075428_10052196213300006844Populus RhizosphereLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP*
Ga0075428_10211660123300006844Populus RhizosphereQGYALKAGQLTYDCRYSTMHGMSVIGGRGFRGLKSLWYNGVPH*
Ga0075428_10220983213300006844Populus RhizosphereQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP*
Ga0075421_10026329043300006845Populus RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGRGFRVLKPLWYNGVPP*
Ga0075421_10045505013300006845Populus RhizosphereVVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLW
Ga0075421_10057749423300006845Populus RhizosphereGYALKAGQLTYDCRYSTTHGMPVTGGRGFRGLKSLWYNGVPP*
Ga0075421_10062787313300006845Populus RhizosphereIGYALKAGQLTYDCRYSTIHSMLVTGGHGFRGLKPLWYKGVPP*
Ga0075421_10098024923300006845Populus RhizosphereMLSAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGV
Ga0075430_10013098033300006846Populus RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP*
Ga0075430_10111919313300006846Populus RhizosphereVCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGL
Ga0075430_10120758113300006846Populus RhizosphereAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075430_10160280723300006846Populus RhizosphereLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGVPP*
Ga0075431_10095098713300006847Populus RhizosphereVGAGRPHATGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNG
Ga0075431_10117737323300006847Populus RhizosphereGYALKAGQLTYDCRYSTMHGMPVTGGSGFRGLKPLWYNGVPP*
Ga0075431_10141599923300006847Populus RhizospherePTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075433_1025577313300006852Populus RhizosphereVVIDIWESAHPGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVP
Ga0075434_10180396313300006871Populus RhizosphereMALRVSGYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGV
Ga0075429_10045068813300006880Populus RhizosphereLKAGQLTYDCRYSTMHGMPVTGGRGFGGLKPLWYNSVPP*
Ga0075429_10061787123300006880Populus RhizosphereGYALKAGQLTYDCRYSTMHGMPGTGGRGFRSLKPLWYNSVPP*
Ga0075424_10206762413300006904Populus RhizosphereVCISAGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWDNGV
Ga0075419_1008048833300006969Populus RhizosphereGQLTYDCRYSTMHGMPVTGGRGFRGLKPFWYNGVPP*
Ga0075419_1009887313300006969Populus RhizosphereGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP*
Ga0075419_1062033813300006969Populus RhizosphereRQLTYDCRYSTMHGMPVTGRRGFRGLKLLWYNGVPP*
Ga0099829_1079100113300009038Vadose Zone SoilLEYDYRYSKMHGMPVTGGRGLRGLKPLWYNGVPP*
Ga0099827_1152106113300009090Vadose Zone SoilGQLEYDRRYSKMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0075418_1010291153300009100Populus RhizosphereKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYKASQEQ*
Ga0075418_1130543213300009100Populus RhizosphereSGAALTYVSFEGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0114129_1199166813300009147Populus RhizosphereGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0126382_1054478623300010047Tropical Forest SoilGYALKAGQLTYDCRYSTMHGMPVTDGRGFRGLQPLWYNGVSP*
Ga0126321_122986513300010145SoilGQLTYDCRYSTMHGMPVTGGRGFRGLKALWYNGVPP*
Ga0126383_1304992113300010398Tropical Forest SoilVGQLEYDCRYSKMHGMPVTGGRGFRALKSLWYKGVPP*
Ga0137383_1002714733300012199Vadose Zone SoilMSTHHGYPLKAGQLEYDRRYSKMHGMPVTGGHSFRGLKPLWYNGVPP*
Ga0137378_1090499413300012210Vadose Zone SoilAGQLEYDCRYSKMHGIPVTGGRGFRGLKPLWYNGVPP*
Ga0150985_10156967223300012212Avena Fatua RhizosphereMPDVLTGYLLKVGQLEYDCRYSKMPGMPVTGGRGFRSLKPLWYKGVPP*
Ga0137386_1119872813300012351Vadose Zone SoilQAGQLEYDCRYAKMHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0150984_11265388213300012469Avena Fatua RhizosphereMCVSLGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYN
Ga0164302_1112652423300012961SoilVSRAKWLPETGYPLKAGQLEYDCRYSTMHGMPVTGGRGFRGLKPLWYNGV
Ga0126369_1027135223300012971Tropical Forest SoilGYALKAGQLTYDCRYSTMHDMPVTGGHGFRGLKPLWYNGVPP*
Ga0132258_1180344533300015371Arabidopsis RhizosphereQLEYDCRYSTMHGMPVTGGRGFRDLKPLGYKGVPP*
Ga0132256_100011312103300015372Arabidopsis RhizosphereMLYSGLSGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSV
Ga0132255_10000911013300015374Arabidopsis RhizosphereMLYSGLSGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVP
Ga0132255_10089763323300015374Arabidopsis RhizosphereGYALKAGQLTYDYRYSTMHGMPVTGGRGFRGLKPLRHNSVPP*
Ga0132255_10099765613300015374Arabidopsis RhizosphereGQLEYDCRYSTMHGMPVTGGRGFRDLKPLGYKGVPP*
Ga0132255_10206701413300015374Arabidopsis RhizosphereGQWTYDCRYSTIHGMPVTGGRGFRGLKPLWYNGVPP*
Ga0132255_10614589123300015374Arabidopsis RhizosphereFEEAGYALKAGQLTYDYRYSTMHGMPVTGGRGFRALKPLRHNSVPP*
Ga0182033_1020294613300016319SoilTDIVRHLKNGYPLKVGQLEYDCRYSKMYGMPVAGGRGFSALKPLWNNGVPP
Ga0182033_1138709433300016319SoilPQLGYLLEVGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYNGVPP
Ga0182033_1181383413300016319SoilMGTGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLL
Ga0182034_1029591533300016371SoilMCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGV
Ga0182037_1199882313300016404SoilGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0182039_1102805213300016422SoilMCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKG
Ga0209153_104770713300026312SoilKMGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGIPP
Ga0209472_107292623300026323SoilEGYPLKAGQLEYDCRYSRMHDMPFTGRRGFRGLKPL
Ga0209465_1003256313300027874Tropical Forest SoilMNGFIGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP
Ga0247828_1043252413300028587SoilMDVQWGIPPQPEHFDHGYPLKAGQLTYDCHYSTMHGMPVTGGRGFRGLKPLW
Ga0247828_1123349913300028587SoilAGQLEYDCHYSKMHGMPVTGGRSFRGLKPLWYNGVPP
Ga0318515_1007840113300031572SoilFIKFLLVRGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKSLWYNGVPP
Ga0318572_1058733013300031681SoilAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0318560_1031352313300031682SoilCLFLWLMRGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP
Ga0318492_1010146013300031748SoilMVRYGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLW
Ga0318548_1035440613300031793SoilMVFLGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVP
Ga0318523_1035643723300031798SoilSGKAVAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0310917_1033093923300031833SoilADVGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0306921_1107682833300031912SoilGHVGQIEGYALKAGQLTYDCRYSTMHGMPVTGGRGFRSLKPLWYNGVPP
Ga0310912_1094982513300031941SoilMCLCVVSRSAGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVP
Ga0310909_1015547413300031947SoilKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0307409_10022922253300031995RhizosphereGYPLKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNSVPP
Ga0307409_10136866723300031995RhizosphereLKAGQLEYDCRYSTMHGMPVTGSRGFRGLQPLWYNGVQP
Ga0318570_1054040813300032054SoilPHPEVMQGGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0318505_1029524023300032060SoilGTVDVSGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSVKLLWYKGVPP
Ga0318513_1063064623300032065SoilIGVEAHVGYLLKAGQLEYDCRYSKMHGMPVTGGRGFRSLKPLWYKGVPP
Ga0307471_10173849213300032180Hardwood Forest SoilLKAGQLEYDCRYSKMHGMPVTGGRGFRGLKPWWYNGVPA
Ga0306920_10432565123300032261SoilMGLGYALKAGQLTYDCRYSTMHGMPVTGGRGFRGLKPLWYNGV
Ga0306920_10438073513300032261SoilARVFQKLKLGYLLKVGQLEYDCRYSKMHGMPVTSGRGFRSLKPL
Ga0314803_016774_3_1493300034678SoilLIMEFLGYALKAEQLTYDCRYSTMHGMLVTGGRGFRVLKPLWYNGVPP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.