Basic Information | |
---|---|
Family ID | F064865 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 40 residues |
Representative Sequence | GGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRERLG |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.44 % |
% of genes near scaffold ends (potentially truncated) | 49.22 % |
% of genes from short scaffolds (< 2000 bps) | 91.41 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.062 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.062 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.812 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.46% β-sheet: 20.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF10262 | Rdx | 10.16 |
PF13456 | RVT_3 | 9.38 |
PF00326 | Peptidase_S9 | 8.59 |
PF01243 | Putative_PNPOx | 2.34 |
PF07690 | MFS_1 | 2.34 |
PF13561 | adh_short_C2 | 1.56 |
PF05239 | PRC | 1.56 |
PF08281 | Sigma70_r4_2 | 1.56 |
PF00285 | Citrate_synt | 1.56 |
PF13520 | AA_permease_2 | 1.56 |
PF00202 | Aminotran_3 | 1.56 |
PF00171 | Aldedh | 1.56 |
PF10604 | Polyketide_cyc2 | 1.56 |
PF09954 | DUF2188 | 1.56 |
PF02558 | ApbA | 1.56 |
PF01434 | Peptidase_M41 | 0.78 |
PF00196 | GerE | 0.78 |
PF00903 | Glyoxalase | 0.78 |
PF07681 | DoxX | 0.78 |
PF01522 | Polysacc_deac_1 | 0.78 |
PF13177 | DNA_pol3_delta2 | 0.78 |
PF13515 | FUSC_2 | 0.78 |
PF00211 | Guanylate_cyc | 0.78 |
PF00589 | Phage_integrase | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF03069 | FmdA_AmdA | 0.78 |
PF02142 | MGS | 0.78 |
PF00248 | Aldo_ket_red | 0.78 |
PF01497 | Peripla_BP_2 | 0.78 |
PF01061 | ABC2_membrane | 0.78 |
PF01381 | HTH_3 | 0.78 |
PF14312 | FG-GAP_2 | 0.78 |
PF00999 | Na_H_Exchanger | 0.78 |
PF03193 | RsgA_GTPase | 0.78 |
PF01878 | EVE | 0.78 |
PF01266 | DAO | 0.78 |
PF01047 | MarR | 0.78 |
PF14224 | DUF4331 | 0.78 |
PF01844 | HNH | 0.78 |
PF16925 | TetR_C_13 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.56 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 1.56 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.56 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.56 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.78 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.78 |
COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.78 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.78 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.78 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.78 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.78 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.78 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.78 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.78 |
COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.78 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.06 % |
Unclassified | root | N/A | 10.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0630415 | Not Available | 882 | Open in IMG/M |
3300000559|F14TC_100933625 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300000881|JGI10215J12807_1141775 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300000881|JGI10215J12807_1170097 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300000890|JGI11643J12802_12255290 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300001213|JGIcombinedJ13530_109850731 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300002568|C688J35102_119772979 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300002568|C688J35102_120701759 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300004114|Ga0062593_100452249 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300004156|Ga0062589_100362435 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300004156|Ga0062589_101207545 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300004479|Ga0062595_101516304 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300004480|Ga0062592_101710725 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300004643|Ga0062591_100654554 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300004643|Ga0062591_101539197 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300004778|Ga0062383_10191396 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005333|Ga0070677_10699544 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005437|Ga0070710_10023969 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
3300005444|Ga0070694_101176837 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005450|Ga0066682_10486478 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005455|Ga0070663_102178708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300005467|Ga0070706_101881174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300005468|Ga0070707_101284396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300005518|Ga0070699_101415059 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005526|Ga0073909_10490529 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005529|Ga0070741_10011004 | All Organisms → cellular organisms → Bacteria | 16861 | Open in IMG/M |
3300005530|Ga0070679_100699542 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300005536|Ga0070697_100551354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300005719|Ga0068861_100951812 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300005719|Ga0068861_101423191 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005764|Ga0066903_100775546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1709 | Open in IMG/M |
3300005937|Ga0081455_10947341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300006196|Ga0075422_10013064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2738 | Open in IMG/M |
3300006854|Ga0075425_101767972 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300006881|Ga0068865_101228124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300006931|Ga0097620_100449742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1384 | Open in IMG/M |
3300006953|Ga0074063_12153985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
3300009088|Ga0099830_10862954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 748 | Open in IMG/M |
3300009094|Ga0111539_12196727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300009098|Ga0105245_12034875 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300009147|Ga0114129_11134117 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300009148|Ga0105243_11160051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
3300009162|Ga0075423_10208042 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300009177|Ga0105248_10537401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
3300009545|Ga0105237_11959809 | Not Available | 594 | Open in IMG/M |
3300009597|Ga0105259_1136048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300009792|Ga0126374_10749811 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300009836|Ga0105068_1106645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300009873|Ga0131077_10941974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 741 | Open in IMG/M |
3300010364|Ga0134066_10358263 | Not Available | 543 | Open in IMG/M |
3300010397|Ga0134124_12021680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300010400|Ga0134122_12406931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300010400|Ga0134122_13042515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300011403|Ga0137313_1054279 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012022|Ga0120191_10114297 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012204|Ga0137374_10111428 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
3300012206|Ga0137380_10719376 | Not Available | 866 | Open in IMG/M |
3300012211|Ga0137377_11394345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300012212|Ga0150985_100825788 | Not Available | 670 | Open in IMG/M |
3300012350|Ga0137372_10020314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6231 | Open in IMG/M |
3300012354|Ga0137366_10100059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2198 | Open in IMG/M |
3300012355|Ga0137369_10474254 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300012901|Ga0157288_10059044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300012903|Ga0157289_10184297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300012914|Ga0157297_10424574 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012931|Ga0153915_12045885 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300012958|Ga0164299_10147815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1296 | Open in IMG/M |
3300012960|Ga0164301_11042818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300012984|Ga0164309_10687309 | Not Available | 810 | Open in IMG/M |
3300012988|Ga0164306_10516765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
3300012989|Ga0164305_10120736 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
3300013105|Ga0157369_11746463 | Not Available | 632 | Open in IMG/M |
3300013306|Ga0163162_10493237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1356 | Open in IMG/M |
3300013308|Ga0157375_11299574 | Not Available | 855 | Open in IMG/M |
3300014150|Ga0134081_10371958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300014325|Ga0163163_10097206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2965 | Open in IMG/M |
3300014326|Ga0157380_12402617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300014745|Ga0157377_10954539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 645 | Open in IMG/M |
3300015086|Ga0167655_1033206 | Not Available | 832 | Open in IMG/M |
3300015200|Ga0173480_10084310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
3300015359|Ga0134085_10447056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300015371|Ga0132258_12114057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
3300015371|Ga0132258_12606515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1263 | Open in IMG/M |
3300015371|Ga0132258_13261633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1118 | Open in IMG/M |
3300015372|Ga0132256_101992261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
3300015374|Ga0132255_103783811 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300017965|Ga0190266_10358457 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300017994|Ga0187822_10391753 | Not Available | 510 | Open in IMG/M |
3300018052|Ga0184638_1244342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300018422|Ga0190265_11953781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300018469|Ga0190270_10010018 | All Organisms → cellular organisms → Bacteria | 5315 | Open in IMG/M |
3300018476|Ga0190274_10582530 | Not Available | 1141 | Open in IMG/M |
3300018476|Ga0190274_11218542 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300018476|Ga0190274_13949344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300020020|Ga0193738_1079371 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300021082|Ga0210380_10507296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
3300021560|Ga0126371_10258783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1857 | Open in IMG/M |
3300021560|Ga0126371_13818204 | Not Available | 508 | Open in IMG/M |
3300022893|Ga0247787_1001956 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300022901|Ga0247788_1015093 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300025899|Ga0207642_10485449 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300025925|Ga0207650_10687064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
3300025981|Ga0207640_11691453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300025981|Ga0207640_11906804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 538 | Open in IMG/M |
3300025986|Ga0207658_11711785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300026118|Ga0207675_100395991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1360 | Open in IMG/M |
3300026547|Ga0209156_10170793 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10027022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1910 | Open in IMG/M |
3300028379|Ga0268266_12301168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300028592|Ga0247822_10471756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 989 | Open in IMG/M |
3300028592|Ga0247822_11022219 | Not Available | 683 | Open in IMG/M |
3300028654|Ga0265322_10085458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 896 | Open in IMG/M |
3300028715|Ga0307313_10070245 | Not Available | 1045 | Open in IMG/M |
3300031170|Ga0307498_10048182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1140 | Open in IMG/M |
3300031242|Ga0265329_10239473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300031834|Ga0315290_10828492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
3300031847|Ga0310907_10169953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
3300031908|Ga0310900_11375598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300032013|Ga0310906_10544740 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300032018|Ga0315272_10482516 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300032052|Ga0318506_10294309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
3300032075|Ga0310890_10266188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1215 | Open in IMG/M |
3300032143|Ga0315292_11114720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300032954|Ga0335083_10091582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3027 | Open in IMG/M |
3300033551|Ga0247830_10814945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
3300034143|Ga0334961_048350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300034149|Ga0364929_0153509 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300034417|Ga0364941_151302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.06% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.91% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.12% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.12% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.34% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.34% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.34% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.56% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.78% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.78% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_06304151 | 3300000033 | Soil | GGIFDVHVDGSLVFTKSMLGRYPXPDDVIPLVRAKLTG* |
F14TC_1009336252 | 3300000559 | Soil | VTGANGIFDVHLDGELVFEKSMLGRYPDPDDVLPLLRERLD* |
JGI10215J12807_11417751 | 3300000881 | Soil | VTGDGGIFDVHVDGDLVFEKKMLGRYPDPDDVVPLLREKLGA* |
JGI10215J12807_11700974 | 3300000881 | Soil | VTGDGGIFDVHVDGDLVFEKAMLGRYPDPDDVLPLLREKLSA* |
JGI11643J12802_122552901 | 3300000890 | Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPDPDDVLPLLRR |
JGIcombinedJ13530_1098507312 | 3300001213 | Wetland | VHLDGELVFEKRMLGRYPDPEDVLPLLRERIAAG* |
C688J35102_1197729792 | 3300002568 | Soil | VVPGADGIFDVHVGSELVFTKSMLGRYPDPDDVMPLLRPHVVG* |
C688J35102_1207017594 | 3300002568 | Soil | DVHLDGELVFEKSMLGRYPDPEDVIPLLGERFGGNSSPS* |
Ga0062593_1004522491 | 3300004114 | Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVLPLLRPHLASA* |
Ga0062589_1003624352 | 3300004156 | Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPKPDDVLPLLRPHLASA* |
Ga0062589_1012075452 | 3300004156 | Soil | VTGVGGIFDVHVDGERVFTKSMLGRYPEPDDVLPLLRPHLAA* |
Ga0062595_1015163042 | 3300004479 | Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPDPDDVLPLLRRYLAD* |
Ga0062592_1017107252 | 3300004480 | Soil | VTGVGGIFDVHVDGERVFTKSMLGRYPEPEDVLPLLRPHLAA* |
Ga0062591_1006545541 | 3300004643 | Soil | VEVVTGRDGIFDVHLGDSLVFTKAMLGRYPEPEDVMPLLRSHLAG* |
Ga0062591_1015391972 | 3300004643 | Soil | VTGVGGIFDVHVDGERVFTKSMLGRYPEPDDVLPLLRPRL |
Ga0062383_101913961 | 3300004778 | Wetland Sediment | GIFDVHVDGELVFWKKMLGRYPDPDDVLPLIRERIGAEVMRSSGP* |
Ga0070677_106995441 | 3300005333 | Miscanthus Rhizosphere | VTGDGCIFDVHVDGDLVFEKKMLGRYPDPDDVVPLLREKLGP* |
Ga0070710_100239695 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IFDVHVDDELLFTKSMIGHYPEPDEVLPLLRERIGAELDS* |
Ga0070694_1011768372 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VFDVHVGDKLVFEKSMLGRYPDPEDVMPLLRPRLVLTAGPEA* |
Ga0066682_104864781 | 3300005450 | Soil | VVPGADGIFDVHVAGDLVFTKAMLGRYPEPDDVMPLLHSQLH* |
Ga0070663_1021787081 | 3300005455 | Corn Rhizosphere | VVTGADGIFDVHVRGELVFTKAMLGRYPEPDDVLPLLQPHLR* |
Ga0070706_1018811741 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IPGGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAA* |
Ga0070707_1012843961 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVGGIFDVHVGDELVFTKSMLGRYPEPEDVLPLLRPRLAA* |
Ga0070699_1014150591 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPGADGIFDVHVDGDLVFTKAMLGRYPEPDDVMPLLQSRLRT* |
Ga0073909_104905292 | 3300005526 | Surface Soil | LVTGVGGVFDVHVGDELVFEKSMLGRYPDPEDVMPLLRPLLAA* |
Ga0070741_100110045 | 3300005529 | Surface Soil | VELVPGVDGVFDVHVGENLVFTKSMLGRYPQPGDVMPLLRPHIGS* |
Ga0070679_1006995422 | 3300005530 | Corn Rhizosphere | VELVTGVGGIFDVHVGDDIVFTKSMLGRYPEPEDVMPLLRPRLAP* |
Ga0070697_1005513541 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPGANGIFDVHVDGDLVFTKAMLGRYPKPDDVMPLLQSRLQT* |
Ga0068861_1009518121 | 3300005719 | Switchgrass Rhizosphere | IFDVHLDGELVFTKSMLGRYPDPEDVTPLLRAKLDT* |
Ga0068861_1014231912 | 3300005719 | Switchgrass Rhizosphere | VTGDGGIFDVHVDGDLLFAKRMLGRYPDPGDVEPLLRERLGAPVL* |
Ga0066903_1007755463 | 3300005764 | Tropical Forest Soil | VHVDGDLVFEKKMLGRYPDPEDVMPLLRERIAGG* |
Ga0081455_109473411 | 3300005937 | Tabebuia Heterophylla Rhizosphere | FDVHVDGDLVFEKKMIGRYPEPDDVVPLVKAKFES* |
Ga0075422_100130643 | 3300006196 | Populus Rhizosphere | VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLDA* |
Ga0075425_1017679722 | 3300006854 | Populus Rhizosphere | VVPGADGIFDVHVAGDRVFTKAMLGRYPQPEDVMPLLRSRLDL* |
Ga0068865_1012281242 | 3300006881 | Miscanthus Rhizosphere | GGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRERLG* |
Ga0097620_1004497421 | 3300006931 | Switchgrass Rhizosphere | GDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE* |
Ga0074063_121539852 | 3300006953 | Soil | HVHVDGDLVFTKSMLGRYPGPDDVLPLIRSRLSQGRA* |
Ga0099830_108629541 | 3300009088 | Vadose Zone Soil | VPGADGIFDVHLGGERVFTKSMLGRYPEPDDVMPLLR |
Ga0111539_121967272 | 3300009094 | Populus Rhizosphere | VFDVHVDGDLVFEKSMLGHYPDPDDVLPLVRDKLS* |
Ga0105245_120348752 | 3300009098 | Miscanthus Rhizosphere | VTGVGGVFDVHVGDELVFEKSMLGRYPDPEDVMPLLRPHLGT* |
Ga0114129_111341174 | 3300009147 | Populus Rhizosphere | GIFDVHVDGDLVFEKAMLGRYPDPDDVLPLLREKLSA* |
Ga0105243_111600512 | 3300009148 | Miscanthus Rhizosphere | VTGVGGVFDVHVGDELVFEKSMLGRYPDPDDVMPLLRPRLAA* |
Ga0075423_102080421 | 3300009162 | Populus Rhizosphere | IFDVHVDGELVFTKSMLGRYPDPDDVVPLLREKLGG* |
Ga0105248_105374013 | 3300009177 | Switchgrass Rhizosphere | DVDVDGERIFFKKMIGRYPQPDDVVPLLRERIGPEVM* |
Ga0105237_119598092 | 3300009545 | Corn Rhizosphere | LTGLDDTIVFTKSMIGRYPNPDDVLPLVHARLAE* |
Ga0105259_11360481 | 3300009597 | Soil | VTGANGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA* |
Ga0126374_107498112 | 3300009792 | Tropical Forest Soil | VHVDETLVFTKSMLGRYPQPDEVTPLLNDQLTAD* |
Ga0105068_11066451 | 3300009836 | Groundwater Sand | VTGANGIFDVHLDGDLVFTKSMLGRYPDPDDVIPLLRDQLGAS* |
Ga0131077_109419741 | 3300009873 | Wastewater | YDVDLDGERVFTKSMLGRYPEPEEVIPLLQERMGPPVL* |
Ga0134066_103582632 | 3300010364 | Grasslands Soil | EVVPGADGIFDVHVGSELVFTKSMLGRYPDPDDVMPLLRPHVVG* |
Ga0134124_120216803 | 3300010397 | Terrestrial Soil | GIFDVHLDGDLVFEKSMLGRYPDPEDVLPLLRERM* |
Ga0134122_124069311 | 3300010400 | Terrestrial Soil | GGVFDVDVDGERIFFKKMIGRYPQPDDVVPLLRERIGPEVM* |
Ga0134122_130425151 | 3300010400 | Terrestrial Soil | GGIFDVHLDGELVFTKSMIRRYPDPDDVMPLLRAALG* |
Ga0137313_10542791 | 3300011403 | Soil | VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLSGA* |
Ga0120191_101142972 | 3300012022 | Terrestrial | GIFDVHLDGELVFTKSMLGRYPDPDDVTPLVRDQLGG* |
Ga0137374_101114283 | 3300012204 | Vadose Zone Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVMPLLRPSLSA* |
Ga0137380_107193762 | 3300012206 | Vadose Zone Soil | VVPGADGIFDVHVAGDLVFTKAMLGRYPEPDDVMPLLRSHLH* |
Ga0137377_113943452 | 3300012211 | Vadose Zone Soil | VVPGADGIFDVHVAGDLVCTKAMLGRYPEPDDVMPLLRSHLH* |
Ga0150985_1008257881 | 3300012212 | Avena Fatua Rhizosphere | VVPGADGIFDVHVGSELVFTKSMLGRYPVPDDVMPLLRPHVVG* |
Ga0137372_100203142 | 3300012350 | Vadose Zone Soil | VHVNGELVFTKSMLGRYPQPDEVVPLVRKRLPAA* |
Ga0137366_101000592 | 3300012354 | Vadose Zone Soil | VHLNGELVFTKSMLGRYPRPDEVVPLVRKRLAAA* |
Ga0137369_104742542 | 3300012355 | Vadose Zone Soil | VHVNGELVFTKSMLGRYPQPDEVVPLVRKRLAAA* |
Ga0157288_100590441 | 3300012901 | Soil | GGVFDVHVDDQLVFEKKMIRRYPNPDDVLPRLRAVLGDEVL* |
Ga0157289_101842971 | 3300012903 | Soil | VTGVGGIFDVHVGDELVFTKSMLGRYPEPDDVMPLLRPRLVL* |
Ga0157297_104245741 | 3300012914 | Soil | NVHMDGELVFTKSMIGRYPQPDDVVPLLRERFGGG* |
Ga0153915_120458852 | 3300012931 | Freshwater Wetlands | VFDVHVDGELVFEKRMLGRYPDPDDVLPLIRDRIGPEVMRR* |
Ga0164299_101478154 | 3300012958 | Soil | GGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE* |
Ga0164301_110428182 | 3300012960 | Soil | VFDVHVDGELVFEKKMIGRYPQPDDVLPLIRERL* |
Ga0164309_106873092 | 3300012984 | Soil | VVPGADGIFDVHVGTELVFTKSMLGRYPEPEDVMPLLRPHV |
Ga0164306_105167653 | 3300012988 | Soil | VFDVHVDGDLVFEKKMLGRYPDPEDVMPLLRLRLG* |
Ga0164305_101207362 | 3300012989 | Soil | VPGVDGIFDVHVAGDLVFTKAMLGRYPGPDDVMPLLRSHLHS* |
Ga0157369_117464632 | 3300013105 | Corn Rhizosphere | HGVFDVHVDGELVFTKSMLGRYPDPDDVLPLLRPFLG* |
Ga0163162_104932373 | 3300013306 | Switchgrass Rhizosphere | FDVHVDGELVFTKSMLGRYPQPDDVVPLMRELLEG* |
Ga0157375_112995742 | 3300013308 | Miscanthus Rhizosphere | KGGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLHERFGTG* |
Ga0134081_103719581 | 3300014150 | Grasslands Soil | VHVNGDLVFTKSMLGRYPQPDDVVPLLRERLEST* |
Ga0163163_100972061 | 3300014325 | Switchgrass Rhizosphere | GDGIFDVHVNDTLVFTKSMIGRYPNTDDVLPLVHARLAA* |
Ga0157380_124026171 | 3300014326 | Switchgrass Rhizosphere | VFDVDVDGERIFFKKMIGRYPQPDDVLPLLRERIGPEVL* |
Ga0157377_109545392 | 3300014745 | Miscanthus Rhizosphere | DVHVDDQLVFAKQMIRRYPQPDDVLPLLRAVLGDEVL* |
Ga0167655_10332062 | 3300015086 | Glacier Forefield Soil | VFDVDLDGERIFFKKMIGRYPQPEDVLPLLRERIGPELL* |
Ga0173480_100843106 | 3300015200 | Soil | VTGDHGIFDVHVDGDLVFEKAMIGRYPDPDDVLPLLREKLSA* |
Ga0134085_104470561 | 3300015359 | Grasslands Soil | GIFDVHVAGDLVFTKAMIGRYPQPDDVMPLLNSHLHI* |
Ga0132258_121140572 | 3300015371 | Arabidopsis Rhizosphere | VAAVEVVPGADGIFDVHVAGDRVFTKAMIGRYPQPEDVMPLLRSRLHV* |
Ga0132258_126065155 | 3300015371 | Arabidopsis Rhizosphere | GVFDVHVDGDLVFTKSMLGRYPDPDDVLPLVRERLSS* |
Ga0132258_132616332 | 3300015371 | Arabidopsis Rhizosphere | FDVDLDGERIFYKKMIGRYPEPDDVLPLLRERIGPEVL* |
Ga0132256_1019922611 | 3300015372 | Arabidopsis Rhizosphere | FDVHVDGRLVFTKSMIGRYPDPDDVLPLVRAHLKN* |
Ga0132255_1037838112 | 3300015374 | Arabidopsis Rhizosphere | VFDVHVDGELVFEKKMLGRYPDPEDVMPLLRPRLAG* |
Ga0190266_103584572 | 3300017965 | Soil | VTGANGIFDVHVDGELVFTKSMLGRYPDPDDVTPLLGAKLDT |
Ga0187822_103917532 | 3300017994 | Freshwater Sediment | VELVPGVDGVFDVHVGENLVFTKSMLGRYPQPGDVMPLLRPHIGS |
Ga0184638_12443422 | 3300018052 | Groundwater Sediment | VTGANGIFDVHLDGELVFEKSMLGRYPEPDDVIPLFREKLGG |
Ga0190265_119537813 | 3300018422 | Soil | VVTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA |
Ga0190270_100100184 | 3300018469 | Soil | VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVLLLLGDKFRA |
Ga0190274_105825302 | 3300018476 | Soil | VFDVDVDGDRIFFKKMIGRYPQPDDVLPLLRERIGPEVL |
Ga0190274_112185421 | 3300018476 | Soil | VSAVEVVTGVDGIFDVHVGGELVFTKSMLGRYPEPDDVVPLLREKLGA |
Ga0190274_139493441 | 3300018476 | Soil | GVFDVDVDGERIFFKKMIGRYPQPDDVLPLLRERIGPEVL |
Ga0193738_10793713 | 3300020020 | Soil | VTGADGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLGGA |
Ga0210380_105072962 | 3300021082 | Groundwater Sediment | VPGANGIFDVHVDGELVFTKSMLGRYPDPDDVTPLLGAKLDT |
Ga0126371_102587832 | 3300021560 | Tropical Forest Soil | VTGVGGVFDVHVDGDLVFEKAMLGRYPDLEDVMPLLRARLAAPRD |
Ga0126371_138182041 | 3300021560 | Tropical Forest Soil | DGIFDVHVDGELVFTKSMLGRYPQPDEVMPLLRERLVAG |
Ga0247787_10019564 | 3300022893 | Soil | VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLRAKLG |
Ga0247788_10150932 | 3300022901 | Soil | VNGIFDVHVDGELVFTKSMLGRYPQPDDVVPLLREKLDA |
Ga0207642_104854493 | 3300025899 | Miscanthus Rhizosphere | VGGVFDVHVDDELVFTKSMLGRYPVPDDVLPLLRE |
Ga0207650_106870641 | 3300025925 | Switchgrass Rhizosphere | GGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE |
Ga0207640_116914532 | 3300025981 | Corn Rhizosphere | IPGGDGIFDVHVNDTLVFTKSMIGRYPNPDDVLPLVHARLAE |
Ga0207640_119068042 | 3300025981 | Corn Rhizosphere | GVGGIFDVHVDGELVFTKSMLGRYPQPDDVMPLLRPAVGA |
Ga0207658_117117851 | 3300025986 | Switchgrass Rhizosphere | GDKGIFDVHVDDVLVFTKSMIGGYPEPDDVLPLVRAQLAS |
Ga0207675_1003959912 | 3300026118 | Switchgrass Rhizosphere | TGGVFDVHVDDQLVFAKQMIRRYPQPDDVLPLLRAVLGDEVL |
Ga0209156_101707932 | 3300026547 | Soil | VVPGADGIFDVHVAGELVFTKAMLGRYPEPDDVMPLLNSHLH |
(restricted) Ga0233416_100270223 | 3300027799 | Sediment | SIFAVTLDGELVFEKKMLGRYPDPDDVLPLLREQLG |
Ga0268266_123011682 | 3300028379 | Switchgrass Rhizosphere | GVFDVHVDRELVFTKSMLGRYPDPDDVLPLIDPHVD |
Ga0247822_104717562 | 3300028592 | Soil | VTGTGGIFDVHVDGERVFEKKLIGRYPQPDDVLPLLAEKLG |
Ga0247822_110222191 | 3300028592 | Soil | PEQRENPFDVHVDGALVFTKSMLGRYPDPDDVIPLVRAKLTG |
Ga0265322_100854582 | 3300028654 | Rhizosphere | VGGIFDVHVDGDLVFTKSMLGRYPDPDDVMPLLRSRIS |
Ga0307313_100702451 | 3300028715 | Soil | DVDGERIFFKKMIGRYPEPEDVLPLLRERIGPEVM |
Ga0307498_100481822 | 3300031170 | Soil | VFDVHVGGELVFEKSMLGRYPDPEDVMPLLRARLAA |
Ga0265329_102394732 | 3300031242 | Rhizosphere | GTGGIFDVHVGDDLVFTKSMIGRYPEPDDVMPLLRPRLGP |
Ga0315290_108284921 | 3300031834 | Sediment | GGIFDVHLDGELVFTKSMLGRYPQPEDVLPLLRERLDSG |
Ga0310907_101699531 | 3300031847 | Soil | DKGIFDVHVDDVLVFTKSMIGGYPEPDDVLPLVRAQLAS |
Ga0310900_113755982 | 3300031908 | Soil | IFDVHVDGELVFTKSMLGRYPEPDEVVPLVEARLT |
Ga0310906_105447402 | 3300032013 | Soil | VTGVGGIFDVNVDDELVFTKSMLGRYPDPDDVLPLLRAKLGP |
Ga0315272_104825161 | 3300032018 | Sediment | VDGELVFYKKMLGRYPDPDDVLPLIRERIGPEVMRER |
Ga0318506_102943091 | 3300032052 | Soil | GIFDVHVDGDLVFTKSMLGRYPEPDDVVPVLRTKLV |
Ga0310890_102661882 | 3300032075 | Soil | GGIFDVHVDGDLVFTKSMLGRYPQPDDVVPLLRAKLG |
Ga0315292_111147201 | 3300032143 | Sediment | KGGIFDVHLDGELVFTKSMIGRYPQPDDVVPLLRERLAAG |
Ga0335083_100915822 | 3300032954 | Soil | VFDVHVDGELVFTKSMLGRYPQPDDVLPLLQPYLT |
Ga0247830_108149451 | 3300033551 | Soil | FDVHVNDTLVFTKSMIGRYPNPDDVLPLVQARLAA |
Ga0334961_048350_552_671 | 3300034143 | Sub-Biocrust Soil | VFDVEVDGERLFTKSMLGRYPEPDDVLPRLRPALGDELA |
Ga0364929_0153509_160_291 | 3300034149 | Sediment | VTGADGIFDVHLDGELVFTKSMLGRYPQPDDVVPLLREKLGGA |
Ga0364941_151302_465_584 | 3300034417 | Sediment | VDGIFDVKVDDELVFTKSMLGRYPQPDDVVPLLREKLAP |
⦗Top⦘ |