Basic Information | |
---|---|
Family ID | F064849 |
Family Type | Metagenome |
Number of Sequences | 128 |
Average Sequence Length | 42 residues |
Representative Sequence | MLSRADDLAKMTVLDAAGNTVVLGTLWRDKPAVLVFVRHFG |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.66 % |
% of genes near scaffold ends (potentially truncated) | 13.28 % |
% of genes from short scaffolds (< 2000 bps) | 81.25 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.625 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.938 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.906 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (28.906 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 8.70% Coil/Unstructured: 78.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF13911 | AhpC-TSA_2 | 52.34 |
PF00365 | PFK | 3.91 |
PF10041 | DUF2277 | 3.91 |
PF00645 | zf-PARP | 2.34 |
PF00069 | Pkinase | 2.34 |
PF02812 | ELFV_dehydrog_N | 1.56 |
PF02954 | HTH_8 | 1.56 |
PF13187 | Fer4_9 | 1.56 |
PF05099 | TerB | 1.56 |
PF00773 | RNB | 0.78 |
PF03976 | PPK2 | 0.78 |
PF13519 | VWA_2 | 0.78 |
PF00092 | VWA | 0.78 |
PF01656 | CbiA | 0.78 |
PF08308 | PEGA | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF00248 | Aldo_ket_red | 0.78 |
PF12073 | DUF3553 | 0.78 |
PF05726 | Pirin_C | 0.78 |
PF13640 | 2OG-FeII_Oxy_3 | 0.78 |
PF08534 | Redoxin | 0.78 |
PF00576 | Transthyretin | 0.78 |
PF00037 | Fer4 | 0.78 |
PF12531 | DUF3731 | 0.78 |
PF12838 | Fer4_7 | 0.78 |
PF12974 | Phosphonate-bd | 0.78 |
PF10009 | DUF2252 | 0.78 |
PF00724 | Oxidored_FMN | 0.78 |
PF08530 | PepX_C | 0.78 |
PF13237 | Fer4_10 | 0.78 |
PF13540 | RCC1_2 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 9.38 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 3.91 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.56 |
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 1.56 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.78 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.78 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.78 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.78 |
COG2351 | 5-hydroxyisourate hydrolase (purine catabolism), transthyretin-related family | Nucleotide transport and metabolism [F] | 0.78 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.78 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.62 % |
Unclassified | root | N/A | 9.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459020|G1P06HT01EOTQN | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300000956|JGI10216J12902_104525511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
3300000956|JGI10216J12902_107772892 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
3300000956|JGI10216J12902_110875296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1896 | Open in IMG/M |
3300003321|soilH1_10129447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1959 | Open in IMG/M |
3300003465|P52013CM_1023904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1917 | Open in IMG/M |
3300004000|Ga0055458_10162488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 658 | Open in IMG/M |
3300004067|Ga0055485_10044730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 981 | Open in IMG/M |
3300004114|Ga0062593_100016865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3700 | Open in IMG/M |
3300004266|Ga0055457_10021129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1401 | Open in IMG/M |
3300005077|Ga0071116_1000047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 118848 | Open in IMG/M |
3300005180|Ga0066685_10029925 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
3300005329|Ga0070683_100425932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1266 | Open in IMG/M |
3300005329|Ga0070683_100971702 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005329|Ga0070683_101587430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 629 | Open in IMG/M |
3300005329|Ga0070683_101656427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 615 | Open in IMG/M |
3300005332|Ga0066388_105918918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 618 | Open in IMG/M |
3300005343|Ga0070687_100327666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 981 | Open in IMG/M |
3300005356|Ga0070674_101305301 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005437|Ga0070710_11166846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 568 | Open in IMG/M |
3300005456|Ga0070678_100503628 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300005467|Ga0070706_100076956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3088 | Open in IMG/M |
3300005471|Ga0070698_100002958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18692 | Open in IMG/M |
3300005535|Ga0070684_100858500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
3300005535|Ga0070684_101523591 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005541|Ga0070733_10199491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1308 | Open in IMG/M |
3300005548|Ga0070665_101290925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 740 | Open in IMG/M |
3300005764|Ga0066903_101492843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1276 | Open in IMG/M |
3300005764|Ga0066903_104363204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 756 | Open in IMG/M |
3300005834|Ga0068851_11069137 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006047|Ga0075024_100273623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 818 | Open in IMG/M |
3300006224|Ga0079037_101106022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 786 | Open in IMG/M |
3300006237|Ga0097621_102439881 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006854|Ga0075425_103001867 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006876|Ga0079217_10680152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300006880|Ga0075429_101296918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 635 | Open in IMG/M |
3300006954|Ga0079219_11204006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 656 | Open in IMG/M |
3300007004|Ga0079218_11333084 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300009012|Ga0066710_100263865 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
3300009087|Ga0105107_10056015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2785 | Open in IMG/M |
3300009100|Ga0075418_11698445 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300009111|Ga0115026_10021275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3168 | Open in IMG/M |
3300009111|Ga0115026_10089103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1848 | Open in IMG/M |
3300009120|Ga0117941_1000728 | All Organisms → cellular organisms → Bacteria | 13435 | Open in IMG/M |
3300009176|Ga0105242_10543903 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300009540|Ga0073899_10245771 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300009792|Ga0126374_10772794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
3300009870|Ga0131092_10401703 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300009873|Ga0131077_10000807 | All Organisms → cellular organisms → Bacteria | 84888 | Open in IMG/M |
3300010166|Ga0126306_11736300 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010359|Ga0126376_12148520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 602 | Open in IMG/M |
3300010364|Ga0134066_10427748 | Not Available | 512 | Open in IMG/M |
3300010371|Ga0134125_10693287 | Not Available | 1123 | Open in IMG/M |
3300010371|Ga0134125_10886392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 980 | Open in IMG/M |
3300010397|Ga0134124_13192842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300010399|Ga0134127_11019077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 889 | Open in IMG/M |
3300010399|Ga0134127_13720304 | Not Available | 501 | Open in IMG/M |
3300012363|Ga0137390_10521393 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300012469|Ga0150984_120340609 | Not Available | 512 | Open in IMG/M |
3300012922|Ga0137394_10597756 | Not Available | 933 | Open in IMG/M |
3300012931|Ga0153915_10014974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7506 | Open in IMG/M |
3300012964|Ga0153916_11136835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 860 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10199400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1517 | Open in IMG/M |
3300014169|Ga0181531_10101925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1715 | Open in IMG/M |
3300014317|Ga0075343_1084422 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300014323|Ga0075356_1022155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1225 | Open in IMG/M |
3300014969|Ga0157376_11950837 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300015194|Ga0167666_1023121 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
3300015265|Ga0182005_1216089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 582 | Open in IMG/M |
3300015371|Ga0132258_13909180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1013 | Open in IMG/M |
3300015373|Ga0132257_101611366 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300015373|Ga0132257_104364791 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300017973|Ga0187780_10035960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3480 | Open in IMG/M |
3300018431|Ga0066655_10704390 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300018466|Ga0190268_12280481 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018469|Ga0190270_11372688 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300018476|Ga0190274_10847064 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300018476|Ga0190274_10997864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 911 | Open in IMG/M |
3300019487|Ga0187893_10621138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
3300019886|Ga0193727_1102128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 844 | Open in IMG/M |
3300021377|Ga0213874_10333333 | Not Available | 578 | Open in IMG/M |
3300021384|Ga0213876_10040022 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10408142 | Not Available | 509 | Open in IMG/M |
3300025155|Ga0209320_10410129 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300025550|Ga0210098_1033448 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300025910|Ga0207684_10064823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3102 | Open in IMG/M |
3300025918|Ga0207662_10384782 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300025921|Ga0207652_10534115 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300025934|Ga0207686_11429913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 569 | Open in IMG/M |
3300025937|Ga0207669_11632840 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026070|Ga0208423_1005214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1219 | Open in IMG/M |
3300027811|Ga0256868_10113603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
3300027818|Ga0209706_10110578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1364 | Open in IMG/M |
3300027867|Ga0209167_10678979 | Not Available | 563 | Open in IMG/M |
3300027877|Ga0209293_10001933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5148 | Open in IMG/M |
3300027877|Ga0209293_10330502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 779 | Open in IMG/M |
3300027886|Ga0209486_10625780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
3300027900|Ga0209253_10315892 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300027915|Ga0209069_10330028 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300028379|Ga0268266_12030173 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300030002|Ga0311350_11609884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
3300031538|Ga0310888_10534554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300031576|Ga0247727_10049031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5206 | Open in IMG/M |
3300031716|Ga0310813_11311326 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300031720|Ga0307469_12203962 | Not Available | 537 | Open in IMG/M |
3300031740|Ga0307468_100756631 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300032017|Ga0310899_10516210 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300032144|Ga0315910_11220075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
3300032157|Ga0315912_10199818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1569 | Open in IMG/M |
3300032782|Ga0335082_10065604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3694 | Open in IMG/M |
3300032782|Ga0335082_10703951 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300032783|Ga0335079_11834941 | Not Available | 589 | Open in IMG/M |
3300032893|Ga0335069_10179834 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
3300032954|Ga0335083_10000598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 53565 | Open in IMG/M |
3300033408|Ga0316605_10169377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1800 | Open in IMG/M |
3300033408|Ga0316605_10402239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1236 | Open in IMG/M |
3300033412|Ga0310810_10158310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2620 | Open in IMG/M |
3300033413|Ga0316603_10202332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1691 | Open in IMG/M |
3300033433|Ga0326726_10015352 | All Organisms → cellular organisms → Bacteria | 6681 | Open in IMG/M |
3300033433|Ga0326726_12506157 | Not Available | 500 | Open in IMG/M |
3300033480|Ga0316620_10174848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1758 | Open in IMG/M |
3300033480|Ga0316620_10188419 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300033480|Ga0316620_11111581 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300033486|Ga0316624_11487814 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300033487|Ga0316630_10697214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 860 | Open in IMG/M |
3300033513|Ga0316628_100070926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3751 | Open in IMG/M |
3300034194|Ga0370499_0003583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3234 | Open in IMG/M |
3300034268|Ga0372943_1153996 | Not Available | 518 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.47% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.91% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.12% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.12% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.34% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.34% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.56% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.56% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.56% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.78% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.78% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.78% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.78% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.78% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.78% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026070 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2NP_04134720 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MSQRAADLASMTVLDADRNAIVLGTLWKDRTAVVVFVRHFG |
JGI10216J12902_1045255112 | 3300000956 | Soil | MLNRADDLAKLTVLDERGQTVELGTLWRDRPAVLVFIRHFG* |
JGI10216J12902_1077728922 | 3300000956 | Soil | MLTRADDLAKLTVQDDKGGTVKLGSLWADKTAVLVFVRHFG* |
JGI10216J12902_1108752963 | 3300000956 | Soil | MLTRADDLAKMTVLDETGGTVELGTLWRDKTAVLVFIRHFG* |
soilH1_101294474 | 3300003321 | Sugarcane Root And Bulk Soil | MLDRADDLAKLTVQDEHGRSLELGSLWKDHPIVLAFVRHFG* |
P52013CM_10239044 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MLNRADDLATLTVLDEQGTPVALGTFWKDKPAVLVFTRHFG* |
Ga0055458_101624881 | 3300004000 | Natural And Restored Wetlands | SPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG* |
Ga0055485_100447302 | 3300004067 | Natural And Restored Wetlands | MSVHADDLAKLPVLDSAGTKIELGTLWRDRVAVLVFIRHFG* |
Ga0062593_1000168654 | 3300004114 | Soil | MLNRADDLANMTVLDEQGTPVALGTFWKDKPAVLVFTRHFG* |
Ga0055457_100211292 | 3300004266 | Natural And Restored Wetlands | VGSPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG* |
Ga0071116_10000479 | 3300005077 | Sinkhole | MNLAGKLAGMDVLDPAGQSVRLGTYWQDRPAVLVFVRHFG* |
Ga0066685_100299253 | 3300005180 | Soil | MLTRADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG* |
Ga0070683_1004259322 | 3300005329 | Corn Rhizosphere | MALARADALAEMSVLDAHGDKVTLGTLWKDKPAVLAFVRHFG* |
Ga0070683_1009717021 | 3300005329 | Corn Rhizosphere | MLDRADDLAKLTVQDEQGRSLELGSLWKDHAIVLAFVRHFG* |
Ga0070683_1015874302 | 3300005329 | Corn Rhizosphere | MSTRADDLATMTVLDERGQSVALGTFWRDRPAVLAFVRHFG* |
Ga0070683_1016564272 | 3300005329 | Corn Rhizosphere | MLDRADDLATLTVLDEHGTPVELGTFWKGRTAALVFTRHFG* |
Ga0066388_1059189182 | 3300005332 | Tropical Forest Soil | MSRADDLATMTVLDETKAVVTLGTLWRDQPAILVFVRHFG* |
Ga0070687_1003276662 | 3300005343 | Switchgrass Rhizosphere | MLSRADDLATMTVLDETGATVELGRLWRDKAAVLVFVRHFG* |
Ga0070674_1013053012 | 3300005356 | Miscanthus Rhizosphere | MLSRADDLATMTVLDAAGANVQLGTLWRDQPAVLVFVRHFG* |
Ga0070710_111668462 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GPRSDMKRGVLTRADDLARMNVLDDHGAPVAVGSMWRERTAVLVFVRHFG* |
Ga0070678_1005036282 | 3300005456 | Miscanthus Rhizosphere | MLTRADDLAKLIVQDEHGRSVELGTLWREHPIALAFVRHFG* |
Ga0070706_1000769561 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLERADDLAKLTVLDEHGKTLELGTLWAARPAVLVFVRHFG* |
Ga0070698_1000029588 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRADDLAKMTVLDEQGQAVEVGTFWRDHTAVLVFVRHFG* |
Ga0070684_1008585001 | 3300005535 | Corn Rhizosphere | MLDRADDLAKLTVLDEHGTPVELGTFWKGRTAALVFTRHFG* |
Ga0070684_1015235911 | 3300005535 | Corn Rhizosphere | MNSRADDLASMTVLDDTGKPVVLGTFWKDRPAVLAFVRHFG* |
Ga0070733_101994913 | 3300005541 | Surface Soil | MQRADDLAAMTVLDEHGERVVLGTLWRDHSAVLAFVRHFG* |
Ga0070665_1012909252 | 3300005548 | Switchgrass Rhizosphere | MLTQADDLAKLTVQDEHGRSIELGSLWREHPVTLAFVRHFG* |
Ga0066903_1014928432 | 3300005764 | Tropical Forest Soil | VLERADALAEMPVQDARGEPVVLGTLWREKPAVLAFVRHFG* |
Ga0066903_1043632043 | 3300005764 | Tropical Forest Soil | LATMTVLDETKTAVTLGTLWRDQPAILVFVRHFG* |
Ga0068851_110691372 | 3300005834 | Corn Rhizosphere | MDARDLAEMTVLDAARQPIVLGTLWKDKPAVLSFVRHFG* |
Ga0075024_1002736231 | 3300006047 | Watersheds | MLDRANDLARMTVLDESGATILLGTLWHERPAVLVFVRHFG* |
Ga0079037_1011060221 | 3300006224 | Freshwater Wetlands | MLTRADDLASLSVLSEDGGQVALGMLWRERPAILVFVRHFG* |
Ga0097621_1024398812 | 3300006237 | Miscanthus Rhizosphere | MLSRADDLATMTVLDAAGANVQLGTLWRDKPAVLVFVRHFG* |
Ga0075425_1030018672 | 3300006854 | Populus Rhizosphere | MLTRADDLARMTVLDADGQAVELGTLWRDRPAVLVFIRHFG* |
Ga0079217_106801522 | 3300006876 | Agricultural Soil | MLHRADDLAKLTVLDERGNPVELGTFWRERTAALVFVRHFG* |
Ga0075429_1012969182 | 3300006880 | Populus Rhizosphere | DLATMTVLDADRNKVVLGTLWKDRTAVLVFVRHFG* |
Ga0079219_112040062 | 3300006954 | Agricultural Soil | MLSRADDLATMTVLDEAGTAIELGTLWRDKPAVLVFVRHFG* |
Ga0079218_113330842 | 3300007004 | Agricultural Soil | VGSYDAGMLSRADDLATMTVLDDKGGKIELGTLWRDKPAVLVFLRHFG* |
Ga0066710_1002638652 | 3300009012 | Grasslands Soil | MLTRADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG |
Ga0105107_100560154 | 3300009087 | Freshwater Sediment | MSSRADDLARMTVLDADGRAVVLGDFWKDRTAVLVFLRHFG* |
Ga0075418_116984452 | 3300009100 | Populus Rhizosphere | MPELVSTRADDLATMTVLDADRNKVVLGTLWKDRTAVLVFVRHFG* |
Ga0115026_100212753 | 3300009111 | Wetland | MLTRADDLAKMTVLDEHKTKVELGTLWRDKPAVLVFVRHFG* |
Ga0115026_100891033 | 3300009111 | Wetland | MLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG* |
Ga0117941_100072810 | 3300009120 | Lake Sediment | MSLERADDLAKLTVLDEQRHALELGTLWRDRPAVLVFVRHFG* |
Ga0105242_105439032 | 3300009176 | Miscanthus Rhizosphere | MSSIANDLGKLTVQDEAGKTIVVGTLWRDKTAVLVFVRHFG* |
Ga0073899_102457713 | 3300009540 | Activated Sludge | MAPDVGYNDWMLTRADDLATMSVLDENGNPITLGTLWHDKTAVLVFTRHFG* |
Ga0126374_107727942 | 3300009792 | Tropical Forest Soil | MHGRADDLAAMTVLDEQGTKVPLGPLWKDRTAILVFVRHFG* |
Ga0131092_104017032 | 3300009870 | Activated Sludge | MLTRADDLATMTVLDAAKHPVTLGSLWQDKPAVLVFVRHFG* |
Ga0131077_1000080728 | 3300009873 | Wastewater | MLTRADDLAKMTVLDAAKQVVTLGTLWRDKPAVLVFVRHFG* |
Ga0126306_117363002 | 3300010166 | Serpentine Soil | MLTRADDLAKMTVLDEHGGTVELASLWKDKPAVLVFIRHFG* |
Ga0126376_121485202 | 3300010359 | Tropical Forest Soil | VLARADDLATMTVLDARGEPVVLGTLWRDRPAVLAFVRHFG* |
Ga0134066_104277481 | 3300010364 | Grasslands Soil | MLTRADDLAKMTVLDDKGAKVELGTLWRDKPVVLVFVRHFG* |
Ga0134125_106932872 | 3300010371 | Terrestrial Soil | MLTRADDLAKLTVQDEHGRSVELGTLWREHPIALAFVRHFG* |
Ga0134125_108863923 | 3300010371 | Terrestrial Soil | WQDSAMLDRADDLAKLTVQDEHGRSLELGSLWKDHPIVLAFVRHFG* |
Ga0134124_131928421 | 3300010397 | Terrestrial Soil | MLNRADDLASMTVLDEKGTPVALGTFWKTKPAVLVFVRHFG* |
Ga0134127_110190771 | 3300010399 | Terrestrial Soil | METRADDLGKLTVLDEQGEKVQVSTLWRDQTAVLV |
Ga0134127_137203041 | 3300010399 | Terrestrial Soil | MLSRADDLATMTVLDETGAAVELGRLWRDKAAVLVFVRHFG* |
Ga0137390_105213932 | 3300012363 | Vadose Zone Soil | MLSRADDLARMAVFDADGRAVELGTLWRDRPAVLVFIRHFG* |
Ga0150984_1203406092 | 3300012469 | Avena Fatua Rhizosphere | MLTSADDLAKLTVQDEHGRSIELGTLWRDHPVALAFVR |
Ga0137394_105977562 | 3300012922 | Vadose Zone Soil | MTMLDRADDLAAMTVLDPEGKSVVLGTLWRERPAVLAF |
Ga0153915_100149749 | 3300012931 | Freshwater Wetlands | MLHRADDLAKMTVLDATGATVEVGSFWRDHTAVLVFLRHFG* |
Ga0153916_111368353 | 3300012964 | Freshwater Wetlands | MLTRADDLANLTVLDDHGGSVRLGTLWRDKPAVLVFVRHFG* |
(restricted) Ga0172372_101994003 | 3300013132 | Freshwater | MMRSSDRMTMLTRADDLAAMTVLDEAGATVTLGTLWRDRPVVLVFLRHFG* |
Ga0181531_101019253 | 3300014169 | Bog | MTRTPQLARADDLTNLTVLDEHGEPVVLGTLWRERPAVLAFVRHFG* |
Ga0075343_10844221 | 3300014317 | Natural And Restored Wetlands | LAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG* |
Ga0075356_10221551 | 3300014323 | Natural And Restored Wetlands | MILSMLDRADDLAKMTVLDPSGSPVVLGTLWRDKVAVLVFLRHFG* |
Ga0157376_119508372 | 3300014969 | Miscanthus Rhizosphere | VLDRADDLAPMTVLDGRGDRIELGTLWRDHTAVLAFVRHFG* |
Ga0167666_10231212 | 3300015194 | Glacier Forefield Soil | MLDRADDLAKLTVLDADGRTVVLGTLWKTQTAILVFLRHFG* |
Ga0182005_12160892 | 3300015265 | Rhizosphere | CSAASSCYDAAMLSRADDLAPMTVLDEQGGKVPLGTLWRDKTAVLAFVRHFG* |
Ga0132258_139091802 | 3300015371 | Arabidopsis Rhizosphere | MLGRADDLAKLTVLDENSATIELGTLWRDKPAGLAFVRHFG* |
Ga0132257_1016113662 | 3300015373 | Arabidopsis Rhizosphere | MLGRADDLAKLTVLDENSATIELGTLWRDKPAVLAFVRHFG* |
Ga0132257_1043647912 | 3300015373 | Arabidopsis Rhizosphere | CPTMNSRADDLASMTVLDDAGKPVILGTLWKDRPAVLAFVRHFG* |
Ga0187780_100359602 | 3300017973 | Tropical Peatland | VSLERADDLATMTVLDEQGQPVVLGTLWRERPAVLAFVRHFG |
Ga0066655_107043901 | 3300018431 | Grasslands Soil | ADDLARMTVLDADGRAVELGTLWRDRPAVLVFIRHFG |
Ga0190268_122804812 | 3300018466 | Soil | MLSRADDLAKMTVLDARGSTVVLGTLWRDKPAVLVFVRHFG |
Ga0190270_113726882 | 3300018469 | Soil | MLSRADDLAKMTVLDAAGNTVVLGTLWRDKPAVLVFVRHFG |
Ga0190274_108470643 | 3300018476 | Soil | MLSRADDLAKMTVLDATGGSVVLGTLWRDKPAVLVFVRHFG |
Ga0190274_109978642 | 3300018476 | Soil | MIAGMRADDLATMTVLDERGDKVVLGTLWATKPAVLVFIRHFG |
Ga0187893_106211382 | 3300019487 | Microbial Mat On Rocks | MLTRADDLATMTVLDEAGHAVELGTLWRDRAVVLVFLRHFG |
Ga0193727_11021283 | 3300019886 | Soil | METRADDLAKLTVLDAAGASVELGTLWRDRVAVLVFVRHFG |
Ga0213874_103333332 | 3300021377 | Plant Roots | MLQNCYVLTRADDLATMTVLDEASREVVLGTLWAERTAVLAFVRHFG |
Ga0213876_100400223 | 3300021384 | Plant Roots | MLDRADDLAKLTVQDEHGRSVELGSLWADHAIVLAFVRHFG |
(restricted) Ga0233424_104081422 | 3300023208 | Freshwater | MVRADDLAKLRIQDEKGGEIELGALWRDKTAVLVWIRHFG |
Ga0209320_104101292 | 3300025155 | Soil | MQRETSTAADDLAGLPVQDEHGATHTLGEAWRERTAVLAFVRHFG |
Ga0210098_10334482 | 3300025550 | Natural And Restored Wetlands | VGSPSLGYDHAMLSRADDLAKLTVLDDHSVTLALGTLWRDATAVLVFVRHFG |
Ga0207684_100648234 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLERADDLAKLTVLDEHGKTLELGTLWAARPAVLVFVRHFG |
Ga0207662_103847822 | 3300025918 | Switchgrass Rhizosphere | MLSRADDLATMTVLDETGATVELGRLWRDKAAVLVFVRHFG |
Ga0207652_105341152 | 3300025921 | Corn Rhizosphere | MLDRADDLAKLTVLDEHGRSLELGTLWKDHAIVLAFVRHFG |
Ga0207686_114299132 | 3300025934 | Miscanthus Rhizosphere | MSSIANDLGKLTVQDEAGKTIVVGTLWRDKTAVLVFVRHFG |
Ga0207669_116328401 | 3300025937 | Miscanthus Rhizosphere | MLSRADDLATMTVLDAAGANVQLGTLWRDQPAVLVFVRHFG |
Ga0208423_10052141 | 3300026070 | Natural And Restored Wetlands | SPARPHPSMILSMLDRADDLAKMTVLDPSGSPVVLGTLWRDKVAVLVFLRHFG |
Ga0256868_101136032 | 3300027811 | Soil | MSSQTDDLAKLTVLDDDGKSIELGTLWHDRTAVLVFVRHFG |
Ga0209706_101105782 | 3300027818 | Freshwater Sediment | MSSRADDLARMTVLDADGRAVVLGDFWKDRTAVLVFLRHFG |
Ga0209167_106789792 | 3300027867 | Surface Soil | MQRADDLAAMTVLDEHGERVVLGTLWRDHSAVLAFVRHFG |
Ga0209293_100019333 | 3300027877 | Wetland | MLTRADDLAKMTVLDEHKTKVELGTLWRDKPAVLVFVRHFG |
Ga0209293_103305022 | 3300027877 | Wetland | MLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG |
Ga0209486_106257802 | 3300027886 | Agricultural Soil | MLTRADDLAKMTVLDENKQAVELGTLWRDKPAVLVFLRHFG |
Ga0209253_103158923 | 3300027900 | Freshwater Lake Sediment | MIFSMLTRADDLATMTVLDPAGSPVVLGTLWRDKVAVLV |
Ga0209069_103300283 | 3300027915 | Watersheds | MLDRANDLARMTVLDESGATILLGTLWHERPAVLVFVRHFG |
Ga0268266_120301732 | 3300028379 | Switchgrass Rhizosphere | MRTHADDLARLTVQDENGRSIELGSLWREHPVTLAFVRHFG |
Ga0311350_116098842 | 3300030002 | Fen | MKRADDLARLAVLDERGAEVVLGTLWRDRPAVLAFVRHFG |
Ga0310888_105345542 | 3300031538 | Soil | LLGTRVRYDIRMRARADDLARLTVLDEHGRAIALGTLWQDRPSVLVFTRHFG |
Ga0247727_100490313 | 3300031576 | Biofilm | MDLASLSVLDAAGAPVPLGTAWRDRPAVLVFLRHFG |
Ga0310813_113113261 | 3300031716 | Soil | MLSRADDLAKLTVLDENSAAVELGTLWRDKPAVLAFVRHFG |
Ga0307469_122039622 | 3300031720 | Hardwood Forest Soil | VTMLHRADDLAAMTVLDSNGKPVVLATLWRERPAVLAFVRHFG |
Ga0307468_1007566313 | 3300031740 | Hardwood Forest Soil | MLSRADDLATMTVLDEGGTAVTLGTLWRDRPAVLVFVRHFG |
Ga0310899_105162102 | 3300032017 | Soil | MRADDLAHLTVLDAAGKPVELRTFWRERTAALVFVRHFG |
Ga0315910_112200751 | 3300032144 | Soil | MRVGYDSRMLHRADDMAKLTVLDERGNAVELGTFWRDRPAALVFTRHFG |
Ga0315912_101998183 | 3300032157 | Soil | MLSRADDLAKLTVLDESGKTIEVGTLWRDQIAVLVFVRHFG |
Ga0335082_100656042 | 3300032782 | Soil | MSLARADDLAAMTVLDDHGEPVVVGTLWAEHPAVLAFVRHFG |
Ga0335082_107039512 | 3300032782 | Soil | MVHSPAMLHRADDLANMTVLDEAGGKVVLGTLWRERTAVLVFVRHFG |
Ga0335079_118349412 | 3300032783 | Soil | MSSATLRRADDLAGMTVLDEHGQPVVLGTLWHDRAAV |
Ga0335069_101798344 | 3300032893 | Soil | MSGATLRRADDLAALTVLDEHGQPVVLGTLWRDRAAVLAFVRHFG |
Ga0335083_1000059819 | 3300032954 | Soil | MSSATLRRADDLAGMTVLDEHGQPVVLGTLWHDRAAVLAFVRHFG |
Ga0316605_101693772 | 3300033408 | Soil | MLTRADDLASLSVLSEDGGQVALGMLWRERPAILVFVRHFG |
Ga0316605_104022391 | 3300033408 | Soil | MLTRADDLSKMTVLDEHKSKVELGTLWRDKPAVLVFVRHFG |
Ga0310810_101583104 | 3300033412 | Soil | MLDRADDLATLTVLDEHGTPVELGTFWKGRTAALVFTRHFG |
Ga0316603_102023323 | 3300033413 | Soil | MLTRADDLAKMTVLDEHKSKVELGTLWRDKPAVLVFVRHFG |
Ga0326726_100153525 | 3300033433 | Peat Soil | MLHRADDLAKMTVLDATGATVVVGSFWRDHAAVLVFLRHFG |
Ga0326726_125061571 | 3300033433 | Peat Soil | MSTATALAPISVLDVNGDEVRLGDLWRDRSAVLVFVRHFG |
Ga0316620_101748484 | 3300033480 | Soil | GTCLIVRYDGAMLTRADDLANMTVLDDHGGSVRLGTLWADKPAVLVFVRHFG |
Ga0316620_101884193 | 3300033480 | Soil | MLERADDLATMTVQDEHGQPVELATLWRDRPVALAFVRHFG |
Ga0316620_111115812 | 3300033480 | Soil | MLHRADDLAKMTVLDEAGEPVVLGTLWRDRPAVLVFLRHFG |
Ga0316624_114878142 | 3300033486 | Soil | RRMLERADDLANMTVQDEHGQPVELGTLWRDRPVALAFVRHFG |
Ga0316630_106972142 | 3300033487 | Soil | MLTRADDLAKLTVLDEAGARVELGTLWRDKPAVLVFIRHFG |
Ga0316628_1000709265 | 3300033513 | Soil | MLERADDLATMTVQDEHGQPVELGALWRDRPVALAFVRHFG |
Ga0370499_0003583_2135_2260 | 3300034194 | Untreated Peat Soil | MLTRADDLATMTVLDDRSTKVVLGTLWRDKPAVLVFLRHFG |
Ga0372943_1153996_365_490 | 3300034268 | Soil | MLNRADDLAQMTVQDEHGRSVVLGSLWADHPIVLAFVRHFG |
⦗Top⦘ |