NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064807

Metagenome / Metatranscriptome Family F064807

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064807
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 78 residues
Representative Sequence MKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMREDIAKLRQAID
Number of Associated Samples 93
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 50.78 %
% of genes near scaffold ends (potentially truncated) 97.66 %
% of genes from short scaffolds (< 2000 bps) 86.72 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.875 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(32.812 % of family members)
Environment Ontology (ENVO) Unclassified
(78.906 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.156 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.72%    β-sheet: 0.00%    Coil/Unstructured: 41.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF13884Peptidase_S74 2.34
PF00959Phage_lysozyme 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559017|JCVI_READ_736109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium978Open in IMG/M
3300001945|GOS2241_1017432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1505Open in IMG/M
3300001969|GOS2233_1051015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1958Open in IMG/M
3300002040|GOScombined01_100552177All Organisms → cellular organisms → Bacteria114565Open in IMG/M
3300002482|JGI25127J35165_1011800All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2217Open in IMG/M
3300002482|JGI25127J35165_1050779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium899Open in IMG/M
3300002482|JGI25127J35165_1055399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300002482|JGI25127J35165_1066645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium756Open in IMG/M
3300002482|JGI25127J35165_1069768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium734Open in IMG/M
3300004460|Ga0066222_1021644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium986Open in IMG/M
3300004831|Ga0069134_157701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300005057|Ga0068511_1038749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300005057|Ga0068511_1090437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300005057|Ga0068511_1095957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300005606|Ga0066835_10316029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300005971|Ga0066370_10345368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300006305|Ga0068468_1071337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1114Open in IMG/M
3300006345|Ga0099693_1408524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus501Open in IMG/M
3300006480|Ga0100226_1479739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300006481|Ga0100229_1129939All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium696Open in IMG/M
3300006481|Ga0100229_1522258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300006737|Ga0098037_1232503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300006789|Ga0098054_1130616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300009075|Ga0105090_10142879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1494Open in IMG/M
3300009168|Ga0105104_10788427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300009677|Ga0115104_10471615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium920Open in IMG/M
3300009679|Ga0115105_10041144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1062Open in IMG/M
3300009679|Ga0115105_11375981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300010148|Ga0098043_1126705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300010150|Ga0098056_1214352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300010370|Ga0129336_10005141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8110Open in IMG/M
3300012919|Ga0160422_10689476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium651Open in IMG/M
3300012920|Ga0160423_11058862All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300012928|Ga0163110_10540254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium894Open in IMG/M
3300012953|Ga0163179_10133753All Organisms → Viruses → Predicted Viral1834Open in IMG/M
3300012953|Ga0163179_10934631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300013674|Ga0117783_103898All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium928Open in IMG/M
3300017720|Ga0181383_1046343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1167Open in IMG/M
3300017720|Ga0181383_1080860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium872Open in IMG/M
3300017730|Ga0181417_1048448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1039Open in IMG/M
3300017735|Ga0181431_1040772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1057Open in IMG/M
3300017745|Ga0181427_1004148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3635Open in IMG/M
3300017746|Ga0181389_1168996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300017746|Ga0181389_1209933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300017753|Ga0181407_1128729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium630Open in IMG/M
3300017755|Ga0181411_1186981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300017756|Ga0181382_1112162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium732Open in IMG/M
3300017758|Ga0181409_1227043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300017759|Ga0181414_1017224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1975Open in IMG/M
3300017760|Ga0181408_1143256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300017764|Ga0181385_1220515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300017764|Ga0181385_1269296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300017765|Ga0181413_1003855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4678Open in IMG/M
3300017765|Ga0181413_1201159All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300017768|Ga0187220_1036221All Organisms → Viruses → Predicted Viral1488Open in IMG/M
3300017768|Ga0187220_1093751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium907Open in IMG/M
3300017772|Ga0181430_1046596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1352Open in IMG/M
3300017773|Ga0181386_1073173All Organisms → Viruses → Predicted Viral1084Open in IMG/M
3300017773|Ga0181386_1114805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300017773|Ga0181386_1127142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium786Open in IMG/M
3300017785|Ga0181355_1060473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1600Open in IMG/M
3300017785|Ga0181355_1350409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300020167|Ga0194035_1245459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300020196|Ga0194124_10317020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300020197|Ga0194128_10412200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300020267|Ga0211648_1043925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium892Open in IMG/M
3300020267|Ga0211648_1081030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300020269|Ga0211484_1053873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium735Open in IMG/M
3300020343|Ga0211626_1087824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium741Open in IMG/M
3300020367|Ga0211703_10067555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium873Open in IMG/M
3300020367|Ga0211703_10162803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300020387|Ga0211590_10070058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1041Open in IMG/M
3300020394|Ga0211497_10111699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1095Open in IMG/M
3300020397|Ga0211583_10077267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1269Open in IMG/M
3300020402|Ga0211499_10090600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1142Open in IMG/M
3300020404|Ga0211659_10028888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2686Open in IMG/M
3300020409|Ga0211472_10128324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1008Open in IMG/M
3300020409|Ga0211472_10391066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300020410|Ga0211699_10308376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium618Open in IMG/M
3300020413|Ga0211516_10041446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2368Open in IMG/M
3300020420|Ga0211580_10018888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3028Open in IMG/M
3300020436|Ga0211708_10006570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4338Open in IMG/M
3300020436|Ga0211708_10022304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2405Open in IMG/M
3300020437|Ga0211539_10002339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7904Open in IMG/M
3300020437|Ga0211539_10092981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1207Open in IMG/M
3300020437|Ga0211539_10096272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1187Open in IMG/M
3300020437|Ga0211539_10112639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1098Open in IMG/M
3300020437|Ga0211539_10250533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium731Open in IMG/M
3300020437|Ga0211539_10296074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium670Open in IMG/M
3300020439|Ga0211558_10131300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1214Open in IMG/M
3300020440|Ga0211518_10255772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium841Open in IMG/M
3300020450|Ga0211641_10288367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300020451|Ga0211473_10711117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300020452|Ga0211545_10359954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300020452|Ga0211545_10518144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300020459|Ga0211514_10054065All Organisms → Viruses → Predicted Viral2051Open in IMG/M
3300020461|Ga0211535_10100983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1230Open in IMG/M
3300020468|Ga0211475_10421335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300021376|Ga0194130_10293429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium907Open in IMG/M
3300021956|Ga0213922_1115511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300021961|Ga0222714_10307483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300025102|Ga0208666_1013980All Organisms → cellular organisms → Bacteria2679Open in IMG/M
3300025110|Ga0208158_1145621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300025127|Ga0209348_1004258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6344Open in IMG/M
3300025127|Ga0209348_1101701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium892Open in IMG/M
3300025127|Ga0209348_1124247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300025132|Ga0209232_1200013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300025132|Ga0209232_1240658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300025151|Ga0209645_1019274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2616Open in IMG/M
3300025151|Ga0209645_1026762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2149Open in IMG/M
3300025151|Ga0209645_1096262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium965Open in IMG/M
3300025889|Ga0208644_1213863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300027675|Ga0209077_1199988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300027774|Ga0209433_10196739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium758Open in IMG/M
3300027859|Ga0209503_10052453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1860Open in IMG/M
3300029306|Ga0135212_1021967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300029319|Ga0183748_1029881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1775Open in IMG/M
3300029319|Ga0183748_1086565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300029319|Ga0183748_1096278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300029319|Ga0183748_1106696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300029792|Ga0183826_1040652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium723Open in IMG/M
3300031746|Ga0315293_10755308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300031774|Ga0315331_10211631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1439Open in IMG/M
3300031785|Ga0310343_10720924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300031952|Ga0315294_10122180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2673Open in IMG/M
3300032011|Ga0315316_11363045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300032143|Ga0315292_10320768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1293Open in IMG/M
3300032401|Ga0315275_12676984All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium513Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine32.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.75%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine3.91%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.12%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.34%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water2.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.56%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.56%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.56%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.78%
Environmental And Host-AssociatedEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated0.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.78%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.78%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Surface SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater0.78%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.78%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.78%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.78%
Coral TissueHost-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559017Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573)EnvironmentalOpen in IMG/M
3300001945Marine microbial communities from Galapagos, Equador - GS026EnvironmentalOpen in IMG/M
3300001969Marine microbial communities from Yucatan Channel, Mexico - GS017EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004831Marine surface microbial communities from the North Atlantic Ocean - filtered matterEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006305Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025mEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006480Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075mEnvironmentalOpen in IMG/M
3300006481Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025mEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013674Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_NLN_DNA_SISPAHost-AssociatedOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020167Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20mEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020269Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041)EnvironmentalOpen in IMG/M
3300020343Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020387Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020397Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)EnvironmentalOpen in IMG/M
3300020402Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020461Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027774Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ocean5-_001605402166559017Environmental And Host-AssociatedMTKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDNMQDDISKLRQAIDMGLESKIQP
GOS2241_101743213300001945MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDNMQDDISKLRQAIDMGLVKQDMGAARIAMLQKE
GOS2233_105101543300001969MarineMKKWIQSLNNKDRESFLEFCKKTASPIQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDNMQDDISKLRQAIDMGLVKQDMGAARI
GOScombined01_1005521771613300002040MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDN
JGI25127J35165_101180043300002482MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSIKEFKKRNFNEVLESEIDNMRVDI
JGI25127J35165_105077913300002482MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVEXXEWSEKEFKKRNFNLVLETEIDNMREDIAKLRQAIDMGLVKQDMGAARIAM
JGI25127J35165_105539923300002482MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVLETEIDNMR
JGI25127J35165_106664523300002482MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMRE
JGI25127J35165_106976823300002482MarineMTKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVLETEIDNMR
Ga0066222_102164433300004460MarineMQSWIQSLTEKDRESFLAFCKKTSSPIQMYLYSRFLGNTGSIVECDEWSKEEFKKRNFNGIMEMEIDSMQQDISKLRDAIDLGMIK
Ga0069134_15770123300004831Surface SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMGIVKQDMGAARIAM
Ga0068511_103874913300005057Marine WaterMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSMKEFKKRNFNVVLEAE
Ga0068511_109043723300005057Marine WaterMKEWIHTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNIVLETEIDNMQIDIN
Ga0068511_109595723300005057Marine WaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEYKKRNFHQVLEVEIDNMQDDISKLRQAIDMGL
Ga0066835_1031602913300005606MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEYKKRNFHQVLEAEIDNMQDDISKLRQAIDMGLVKQDM
Ga0066370_1034536823300005971MarineMKKWIHTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNIVLETEIDNMQI
Ga0068468_107133733300006305MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMREDIAKLRQA
Ga0099693_140852413300006345MarineSTRGNASMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRKAGT*
Ga0100226_147973923300006480MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHRSDNTNHN
Ga0100229_112993923300006481MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSTKEFK
Ga0100229_152225823300006481MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHQVLEVK*
Ga0098037_123250323300006737MarineMKQWIHSLTSKDRESFLQFCKKTSSPIQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNEVLEYEIDNM
Ga0098054_113061633300006789MarineMKKWIQGLTSKDRESFLSFCKKASSTVQIYLYSRFLGNTGTIVECNEWSEKEFKKRNFTGVLEAEIDLMQQDISKLREAIDMGMVKQDMGAARIAMLQ
Ga0105090_1014287913300009075Freshwater SedimentMIDWIQDLTEKDRESFLAFCKRFSSPIQMYLYSRFLGFTGSIVECDDWAKKEFKRKNFNKVLEDEIDFMQEDISKLRDAIDMGMVKQDMGTARIAMLQK
Ga0105104_1078842723300009168Freshwater SedimentMIDWIQDLTEKDRESFLAFCKRFSSPIQMYLYSRFLGFTGSIVECDDWAKKEFKRKNFNKVLEDEIDFMQEDISKLRDAIDMGMVKQ
Ga0115104_1047161533300009677MarineMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMG
Ga0115105_1004114433300009679MarineMNNWIQGLTEKDRESFLAFCKRSPSPIQIYLYSRFLGFTGSIVECDEWSQKKTKKRNFTEVLEREIDYMQQDISKLREAIDMGMVKQDMGTARIAML
Ga0115105_1137598123300009679MarineMNKWVSSLTDKDRESFLAFCKRTASPIQIYLYSRFLGFKGTIVECDEWSKKKFKKRNFNILLEQEIDNMQEDIAKLRQAIDMGMVKQDMGTARIAMLQKE
Ga0098043_112670513300010148MarineMNKWVSSLTDKDRESFLAFCKQTASPIQIYLYSRFLGFKGTIVECDEWSKKKFKKRNFNILLEQEIDNMQEDIAKLRQAIDM
Ga0098056_121435223300010150MarineMKEWIQGLTSKDRESFLSFCKKASSPVQIYLYSRFLGNTGTIVECNEWSEKEFKKRNFTGVLETEIDLMQQDISKLREAI
Ga0129336_1000514113300010370Freshwater To Marine Saline GradientMKDWIQGLTDKDRESFLTFCKRTNSPIQMYLYSRFLGFTGSIVDCDEWSKKEYRKRDFNGLLEMEIDSMQQDIAKLREAIDMGMVKQDMGTSRIAMMQKE
Ga0160422_1068947623300012919SeawaterMKQWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNQVLE
Ga0160423_1105886213300012920Surface SeawaterMKKWIQTLNNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKR
Ga0163110_1054025413300012928Surface SeawaterMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEF
Ga0163179_1013375313300012953SeawaterMKKWIHTLSNKDRESYLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSTKEFKKRDFNQVLESEIDNMRVDIGKLRDAIDMGIVKQD
Ga0163179_1093463113300012953SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMGIV
Ga0117783_10389823300013674Coral TissueMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESGIDICR
Ga0181383_104634323300017720SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGE
Ga0181383_108086023300017720SeawaterMKKWIQSLNNKDRESFLEFCKKSSSPIQIYLFARFLGFQGTIVECNEWSEKEFKKR
Ga0181417_104844833300017730SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGEIDNMR
Ga0181431_104077223300017735SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGEIDNMREDISKLRQAIDMGLVKQDMGAAR
Ga0181427_100414813300017745SeawaterMKKWVQSLNNKDRESFLEFCKKTSSPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRN
Ga0181389_116899623300017746SeawaterVEQDLTKWLKTLTSKDRESFLAFCKRTSSPIQIYLYSRFLGFTGSIVECDQWSQKKYKKRNFHGVLETEIDSMQQDIAKLRDGIDMGMVKQDMG
Ga0181389_120993323300017746SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMGIVKQD
Ga0181407_112872913300017753SeawaterMNKWVSSLTDKDRESFLAFCKRTASPIQIYLYSRFLGFKGTIVECDEWSKKKFKKRNFNILLEQEIDNMQEDIAKLRQAI
Ga0181411_118698113300017755SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFARFLGFQGTIVECKEWSEKEYKKRNFNQVLETEIDNMREDISKLRQAIDMGL
Ga0181382_111216223300017756SeawaterVEQDLTKWLKTLTSKDRESFLAFCKRTSSPIQIYLYSRFLGFTGSIVECDEWSQKKYKKRNFHGVLETEIDSMQQDISKLRDGIDMGMVKQDMG
Ga0181409_122704323300017758SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMGIVKQDMGAARIA
Ga0181414_101722413300017759SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNF
Ga0181408_114325623300017760SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEI
Ga0181385_122051523300017764SeawaterMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGEIDNMREDIS
Ga0181385_126929623300017764SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNM
Ga0181413_100385513300017765SeawaterMKKWIHTLSNKDRESYLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSIKEFKKRDFTQVLESEIDNMRVDIGKLRDAIDMGIVKQDMGAERIAMLQKE
Ga0181413_120115913300017765SeawaterMKKWVQSLNNKDRESFLEFCKKTSSQVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLE
Ga0187220_103622133300017768SeawaterMKKWVQSLNNKDRESFFEFCKKTSSPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNQVLEGEIDNMREDISKLRQAIDMGLV
Ga0187220_109375113300017768SeawaterMKKWIQSLNNKDRESFLEFCKKSSSPIQIYLFARFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDN
Ga0181430_104659633300017772SeawaterMKKWIHTLSNKDRESYLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAIDMGIVKQ
Ga0181386_107317323300017773SeawaterMKKWVQSLNNKDRESFLEFCKKTSSPVQIYLFSRFLGFQGMIVECNEWSEKE
Ga0181386_111480513300017773SeawaterMKKWVQSLNNKDRESFLEFCKKTSSPVQIYLFSRFLGFQGTIVECNEWSEKEF
Ga0181386_112714223300017773SeawaterMKKWIHTLSNKDRESYLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSIKEFKKRDFTQVLESEIDNMRVDIGKLRDAID
Ga0181355_106047323300017785Freshwater LakeMIDWLQSLTEKDRESFLSFCKQISSPIQMYLYSRFLGFTGSIVECSEWAVKEFKKRNFNGIMEMEIDSMQQDIAKLREAIDLGMIKQDMG
Ga0181355_135040913300017785Freshwater LakeMIDWLQSLTEKDRESFLSFCKQISSPIQMYLYSRFLGFAGSIVECSEWAAKEFKKRNFNGIMEMEIDSMQQDIAKLREAIDLGMIKQDMG
Ga0194035_124545913300020167Anoxic Zone FreshwaterMKNWIKQLTEKDRESFVTFCKQTPSPIQMYLYSRFLGFTGSIVECSEWSASEFKKRNFNAILEMEIDSMQQDIAKLRDAIDLGLVKQDMGTARIAM
Ga0194124_1031702013300020196Freshwater LakeMNQWIQSLSEKDRESFLTFCKRTSSPIQMYLYSRFLGFTGSIVECDEWSKKEYKKQDFNGLLEVEIGAMQQDIMKLRDAIDMGMVKQDMGTARIAM
Ga0194128_1041220013300020197Freshwater LakeMNQWIQSLSEKDRESFLTFCKRTSSPIQMYLYSRFLGFTGSIVECDEWSKKEYKKQDFNGLLEVEIGAMQQDIMKLRD
Ga0211648_104392513300020267MarineMKQWIHSLTSKDRESFLQFCKKTSSPIQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNEVLEYEIDNMQQDIQKLRDAIEMGLVKQDM
Ga0211648_108103013300020267MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVDCYEWSKKEFKKRNFNQVLEKEVDNMQDDISKLRQAIDMGLVKQDMG
Ga0211484_105387323300020269MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLE
Ga0211626_108782413300020343MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGEIDNMREDISKLRQAIDMGLVKQDMGA
Ga0211703_1006755523300020367MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLEIEIDNMREDIAKLR
Ga0211703_1016280313300020367MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVLETEIDNMREDIAKLRQAIDMGLVKQDMGAARIA
Ga0211590_1007005813300020387MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVESNEWSKKEFKKRNFNQVLETEIDNMREDIAKLRQAID
Ga0211497_1011169913300020394MarineMKKWIQSLNNKDRESFLEFCKKTASPIQIYLFSRFLGFQGTIVECNEWSEKEYKKR
Ga0211583_1007726713300020397MarineMKKWIQSLNNKDRESFLEFCKKTASPIQIYLFSRFLGFQGTIVECNEWSEKEFKKR
Ga0211499_1009060013300020402MarineMKKWIQSLNNKDRESFLEFCKKTASPIQIYLFSRFLGFQGTIVECNEWSEKEYKKRNFHQVLEVEIDNMQDDISKLRQAIDMGLVKQDM
Ga0211659_1002888843300020404MarineMKKWIQILTNKDRESFLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSEKEFKKRNFHLVLEKEIDNMQVDIANLREAIQMGMVKQDMG
Ga0211472_1012832423300020409MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKK
Ga0211472_1039106613300020409MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNF
Ga0211699_1030837623300020410MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLEAEIDNMQI
Ga0211516_1004144643300020413MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFNQVLEGEIDNMRED
Ga0211580_1001888853300020420MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLETEIDNMQIDINKLRDAIDMGLVKQDMGAARIAMLQ
Ga0211708_1000657093300020436MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLE
Ga0211708_1002230413300020436MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVL
Ga0211539_1000233913300020437MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLEAEIDNMQIDINKLRDAIDMGIVKQDM
Ga0211539_1009298113300020437MarineMKQWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNQVLEIE
Ga0211539_1009627213300020437MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNQVLEIEIDNMREDI
Ga0211539_1011263933300020437MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMREDIAKLRQAIDMGLV
Ga0211539_1025053313300020437MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLESEIDNMQIDINKLRDAIDMGIVKQDM
Ga0211539_1029607423300020437MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKK
Ga0211558_1013130013300020439MarineMTKWIQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLE
Ga0211518_1025577233300020440MarineMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLE
Ga0211641_1028836713300020450MarineMKQWIQSLNNKDRESFFQFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEYKKRNFNKVLEREIDNMQDDISKL
Ga0211473_1071111713300020451MarineMKKWIQTLTSKDRESYLEFCKKASSPVQIYLFARFLGFQGTVVECNEWSIKEFKKRNFNEVLESEIDNMRVDIGKLRDA
Ga0211545_1035995413300020452MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFHQVLEGEIDNMREDISKLRQAI
Ga0211545_1051814413300020452MarineMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIG
Ga0211514_1005406513300020459MarineMNEWIKSLTSKDRESFTTFCKKTSSPIQIYLYSRFLGFQGTIVECDEWSTKKFKKRNFTSVLEGEIDAMQMDISKLREAIDMGMVKQDMGAARIAMLQK
Ga0211535_1010098313300020461MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVESNEWSKKEFKKRNFNQVLETEIDNMREDIAKLRQAIDMGLVKQDM
Ga0211475_1042133513300020468MarineMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFKKRDFSQVLESEIDNMRVDIGKLRDAI
Ga0194130_1029342913300021376Freshwater LakeMKDWIQGLTDKDRESFLTFCKRTNSPIQMYLYSRFLGFTGSIVDCDEWAKKEYKKRDFNGLLEMEIDSMQQDIAKLREAIDMGMVKQDMGTSR
Ga0213922_111551113300021956FreshwaterMIDWIQSLTEKDRESFLAFCKQVNSPIQMYLYSRFLGFMGTIVDCEDWAKKEFKKQNFNAILEMEINSMQQDIAKLRDAIDLGMIKQDMGASR
Ga0222714_1030748323300021961Estuarine WaterMTEWLETLPEKDREAFLAFCKQSASPIQMYLYSRFLGYGGSIVDTEAWAKKEFKKRNFNVILELEIDSMTLDISKLREGIEMGMIKPDMGASRIAMMQKELR
Ga0208666_101398053300025102MarineMNEWIKSLTDKDRESFTSFCKKTSSPIQIYLYSRFLGFQGTIVECDNWSTKKFKKRNFTSVLEGE
Ga0208158_114562113300025110MarineMNDWIQGLTEKDRESFLAFCKRTRSPIQIYLYTRFLGFTGSIVECDKWSQKKFKKRDFSEVLETEIDYMQQDISKLREAIDMG
Ga0209348_100425813300025127MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVLETEIDNMREDIAKLRQAIDMGL
Ga0209348_110170123300025127MarineMKKWIQSLNSKDRESFFEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFNLVLETEIDNMREDIAKLRQAI
Ga0209348_112424723300025127MarineMTKWVQSLNNKDRESFLQFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFHLVLESEIDNMQDDISKLRQAIDMGL
Ga0209232_120001323300025132MarineMKKWVQSLNNKDRESFFEFCKKTASPVQIYLFSRFLGFQGTIVECKEWSEKEFKKRNFNI
Ga0209232_124065823300025132MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRNFN
Ga0209645_101927413300025151MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMREDIAKLRQAID
Ga0209645_102676213300025151MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLESEIDNMQIDINKLRDAI
Ga0209645_109626223300025151MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEF
Ga0208644_121386313300025889AqueousMIEWVQSLTDKDRESFLTFCKRTSSPIQMYLYSRFLGFTGSIVECDEWSKQNFKKRDFTGLLEMEIDSMSQDIAKLRDAIDMGMVKQDMGTSRI
Ga0209077_119998823300027675Freshwater SedimentMIDWIQDLTEKDRESFLAFCKRFSSPIQMYLYSRFLGFTGSIVECDDWAKKEFKRKNFNKVLEDEIDFMQEDISKLRDAIDMGMVKQDMGTARIAMLQKE
Ga0209433_1019673913300027774MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFARFLGFQGTVVECNEWSIKEFKKRNFNEVLESEIDNMRVDISKLRDAIDMGIVKQDM
Ga0209503_1005245313300027859MarineMNDWIKSLTDKDRECFTSFCKKTSSPIQIYLYSRFLGFQGTIVECDDWSTKKFKKRNFTSVLEGEIDSMQVDISKLREAIDMGMV
Ga0135212_102196713300029306Marine HarborMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEYKKRNFHQVLEAEIDNMQDDISKLRQL
Ga0183748_102988113300029319MarineMKKWIQTLSNKDRESFLEFCKKASSPIQIYLFSRFLGFQGTVVECNEWSTKEFKKRNFNVVLEAEIDNMQIDINKLRDAIDMGIVKQDMGAARIAMLQK
Ga0183748_108656523300029319MarineMKQWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRN
Ga0183748_109627813300029319MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRN
Ga0183748_110669613300029319MarineMKQWIQSLNNKDRESFLEFCKKTASPIQIYLFSRFLGFQGTIVECNEWSEKEF
Ga0183826_104065223300029792MarineMKKWVQSLNNKDRESFLEFCKKTASPVQIYLFSRFLGFQGTIVECNEWSTKEFKKRNFNQVLETEIDNMREDIAKLRQAIDMGLVKQDMGA
Ga0315293_1075530823300031746SedimentMIDWIQSLTEKDRESFLAFCKKTASPIQMYLYSRFLGFTGSIVQCDEWSKQEFKKRNFNGIMEMEIDSMQQDIAKLRDAIDLGIIKQDMGASRIA
Ga0315331_1021163133300031774SeawaterVEQGLTKWLKSLTDKDRESFLAFCKRTVSPIQIYLYSRFLGFTGSIVECDEWSQKKYKKRNFHGVLETEIDSMQQDIAKLRDGIDMGMVKQDMGAARIAMLQKE
Ga0310343_1072092413300031785SeawaterMKQWVQSLNNKDRESFLEFCKKTVSPVQIYLFSRFLGFQGTIVECNEWSEKEFKKRN
Ga0315294_1012218053300031952SedimentMKSWIQSLTEKDRESFFAFCKKTASPIQMYLYSRFLGNTGSIVECDDWAKEEFKKRNFNGIMEMEIDSMQQDIAKLRDAIDLGMIKQDMGASRIAMLQ
Ga0315316_1136304513300032011SeawaterMKKWIQTLSNKDRESFLEFCKKASSPIQMYLFARFLGFQGTVVECNEWSIKEFK
Ga0315292_1032076813300032143SedimentMNDWIPSLTEKDRESFLAFCKKTSSPIQMYLYSRFLGFTGSIAECDEWAKNEFKKRNFNGIMEMEIDSMQQDISKLRDAIDLGM
Ga0315275_1267698413300032401SedimentMKSWIQSLTEKDRESFFAFCKKTASPIQMYLYSRFLGNTGSIVECDDWAKEEFKKRNFNGIMEMEIDSMQQDIAKLRDAIDLGMIKQDMGA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.