NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064766

Metagenome / Metatranscriptome Family F064766

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064766
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 112 residues
Representative Sequence FVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Number of Associated Samples 103
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.12 %
% of genes near scaffold ends (potentially truncated) 77.34 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(41.406 % of family members)
Environment Ontology (ENVO) Unclassified
(64.062 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.844 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 17.24%    β-sheet: 1.38%    Coil/Unstructured: 81.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006357|Ga0075502_1467802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300006383|Ga0075504_1240077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300006392|Ga0075507_1369808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300007955|Ga0105740_1088594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300008993|Ga0104258_1058686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300009071|Ga0115566_10382655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300009263|Ga0103872_1033235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300009265|Ga0103873_1102583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300009436|Ga0115008_10992911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300009543|Ga0115099_10636091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300009608|Ga0115100_10589969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300009741|Ga0123361_1073048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300009785|Ga0115001_10673064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300012470|Ga0129329_1105116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300012472|Ga0129328_1138590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300012504|Ga0129347_1178231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300012518|Ga0129349_1003206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300012518|Ga0129349_1110173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300012518|Ga0129349_1387233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012520|Ga0129344_1108280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300012523|Ga0129350_1070087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300012523|Ga0129350_1318499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300012525|Ga0129353_1802454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300012528|Ga0129352_10743495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300012963|Ga0129340_1234463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300012966|Ga0129341_1085403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300017771|Ga0181425_1201944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300017783|Ga0181379_1166675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300018602|Ga0193182_1017162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300018628|Ga0193355_1018870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300018649|Ga0192969_1039660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018684|Ga0192983_1040889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300018692|Ga0192944_1042043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300018742|Ga0193138_1041991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300018742|Ga0193138_1050064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300018762|Ga0192963_1062311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300018765|Ga0193031_1072926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300018766|Ga0193181_1042499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300018787|Ga0193124_1055686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300018791|Ga0192950_1057062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300018800|Ga0193306_1052723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300018831|Ga0192949_1093084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300018832|Ga0194240_1014813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300018832|Ga0194240_1028774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018846|Ga0193253_1107869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300018848|Ga0192970_1079167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300018874|Ga0192977_1113352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018899|Ga0193090_1114889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300018926|Ga0192989_10137136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300018926|Ga0192989_10143303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300018967|Ga0193178_10085847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018974|Ga0192873_10448194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300018976|Ga0193254_10122693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300018979|Ga0193540_10201804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300018980|Ga0192961_10173467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300018982|Ga0192947_10215561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300018989|Ga0193030_10241256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300018989|Ga0193030_10281383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300018989|Ga0193030_10289032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300019017|Ga0193569_10359819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300019022|Ga0192951_10266805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300019032|Ga0192869_10507485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300019036|Ga0192945_10242279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300019045|Ga0193336_10437396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300019045|Ga0193336_10556322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300019048|Ga0192981_10270285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300019095|Ga0188866_1025589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300019102|Ga0194243_1005423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300019108|Ga0192972_1080139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300019116|Ga0193243_1061944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300019125|Ga0193104_1047318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300019125|Ga0193104_1055343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300019125|Ga0193104_1061152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019129|Ga0193436_1071289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019149|Ga0188870_10151005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019150|Ga0194244_10049087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300019150|Ga0194244_10050257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300019150|Ga0194244_10085668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300019150|Ga0194244_10103231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300019150|Ga0194244_10109344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300019153|Ga0192975_10268153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300021169|Ga0206687_1946546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300021353|Ga0206693_1245637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300021872|Ga0063132_102141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300021872|Ga0063132_124550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300021896|Ga0063136_1013054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300021908|Ga0063135_1007715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300021908|Ga0063135_1056530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300021912|Ga0063133_1074171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300021941|Ga0063102_1082174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300023683|Ga0228681_1038200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300023698|Ga0228682_1052925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300025626|Ga0209716_1148591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300025830|Ga0209832_1152389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300025894|Ga0209335_10267092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300026403|Ga0247557_1046831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300026443|Ga0247559_1109281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300026448|Ga0247594_1078379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300026465|Ga0247588_1110337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300026466|Ga0247598_1150364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300026468|Ga0247603_1092183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300026468|Ga0247603_1117145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300026470|Ga0247599_1117435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300026495|Ga0247571_1116071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300026495|Ga0247571_1146085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300026500|Ga0247592_1148823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300028137|Ga0256412_1294758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300028137|Ga0256412_1322189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300028137|Ga0256412_1334133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300028137|Ga0256412_1382393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300028233|Ga0256417_1201504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300028282|Ga0256413_1315972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300028282|Ga0256413_1327650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300028282|Ga0256413_1353478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300028672|Ga0257128_1092770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300030670|Ga0307401_10515794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300030671|Ga0307403_10679642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300030780|Ga0073988_12273476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300030856|Ga0073990_11942659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300030856|Ga0073990_11991511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300030912|Ga0073987_11080086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300031038|Ga0073986_11950053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300031522|Ga0307388_10903951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300031579|Ga0308134_1161189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300031626|Ga0302121_10174374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300031735|Ga0307394_10321224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300031752|Ga0307404_10399588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300032521|Ga0314680_10724058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine41.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.97%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater16.41%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.56%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.56%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.78%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.78%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075502_146780213300006357AqueousKFVFALMALAATSQAVKLDGVPKKELMKGPHWRKPWPEGTDDSTDDENVMNWMRARKAPDPPIQYHDKMRQWAPGTWPVYHTWNKDFDHATMHHQIDDGSDDNEVVDMIQTHADKTHY*
Ga0075504_124007713300006383AqueousMALAATSQAVKLDGVPKKELMKGPHWRKPWPEGTDDSTDDENVMNWMRARKAPDPPIQYHDKMRQWAPGTWPVYHTWNKDFDHATMHHQIDDGSDDNEVVDMIQTHADKTHY*
Ga0075507_136980813300006392AqueousMKFVFALMALAATSQAVKLDGVPKKELMKGPHWRKPWPEGTDDSTDDENVMNWMRARKAPDPPIQYHDKMRQWAPGTWPVYHTWNKDFDHATMHHQIDDGSDDNEVVDMIQTHADKTHY*
Ga0105740_108859413300007955Estuary WaterAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVEMIQTRQ*
Ga0104258_105868623300008993Ocean WaterMYPAKAGIPDGSLMDKNPSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0115566_1038265523300009071Pelagic MarineMKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0103872_103323513300009263Surface Ocean WaterKKSLMKGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN*
Ga0103873_110258313300009265Surface Ocean WaterMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN*
Ga0115008_1099291123300009436MarineMKFVLALLALAATSEAVKLDGVPKKQLMKGSHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWKTNDDGSFKKANYYQEVDDGTDDNEVLNTQIRA*
Ga0115099_1063609113300009543MarineKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0115100_1058996913300009608MarineLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY*
Ga0123361_107304813300009741MarineKFALAIMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLY*
Ga0115001_1067306413300009785MarineHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0129329_110511613300012470AqueousFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0129328_113859013300012472AqueousKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY*
Ga0129347_117823113300012504AqueousFALAIMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN*
Ga0129349_100320623300012518AqueousAATTEAVQLEGVPKKELMKGSHWRKAWPEGTDDSTDDENILNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWDTNSDGSFKHANYHQEVDDGTDDNEVLNVHLKTEQTRY*
Ga0129349_111017313300012518AqueousVALAATSQAVQLEGVPKKELMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY*
Ga0129349_138723313300012518AqueousFVLALFALATTSQAVKLEGVPKKELMAGAHWRKAWPEGVDDSTNDEDVLNWMRKRKGPDPPIEYHDKMRQWAPGTWPVYHTWNTDFNHASYHQEVDDGTDDNEVLNLMQTKVEQTRTRK*
Ga0129344_110828013300012520AqueousMKFALAIMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN
Ga0129350_107008713300012523AqueousVLALVALAATSQAVQLEGVPKKELMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY*
Ga0129350_131849913300012523AqueousKFALAIMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN*
Ga0129353_180245413300012525AqueousLALVALAATSQAVQLEGVPKKELMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY*
Ga0129352_1074349513300012528AqueousFVLALVALAATSQAVQLEGVPKKELMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY*
Ga0129340_123446313300012963AqueousATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLN*
Ga0129341_108540313300012966AqueousMKFALAIMALAATSEAVKLDGVPKKELMKGAHWRKSWPEGTDDSTNDEDVLNWMRKRKSPDPPIKYHDKMRQWTEGTWPVYHTWTTNDDGSFKKAHYYQTVDDGTDDNEVVNTQIHQRLY
Ga0181425_120194413300017771SeawaterMKFVLALLALATTSQAVKLEGVPKKDLMAGAHWRKAWPEGVDDSTNDEDVLNWMRKRKGPDPPIEYHDKMRQWAPGTWPVYHTWNTDFNHASYHQEVDDGTDDNEVLNLMQTKVEQTRTR
Ga0181379_116667513300017783SeawaterMKFVLALMALAATTEAVQLEGVPKKELMKGSHWRKAWPEGTDDSTDDENILNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWDTNSDGSFKHANYHQEVDDGTDDNEVLNVHLREEQTRY
Ga0193182_101716213300018602MarineMKFVFALVALAATSQAVQLEGVPKKELMKGAHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEVGTWPVYHTWDKKMNWATQHHEIDDGTDDNEVVDMLQTRQEKTHY
Ga0193355_101887013300018628MarineMALVATTQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEVDDGTDDNEVVDMVQMKHEKTHF
Ga0192969_103966013300018649MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHYXNRQNGEDFDFXQQT
Ga0192983_104088913300018684MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0192944_104204313300018692MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNVATQKHEIDDGTDDNEVVDMVQTRHENTHY
Ga0193138_104199113300018742MarineKMKFTFALIALVATSQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWQPGTWPVYHTWDKKMNWATHHYEVDDGTDDNEVVDMVQMKHEKTHF
Ga0193138_105006413300018742MarineMKFVFALLALATTSQAVKLEGVPKKDLMSGSHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWNGDFNHATQHQQIDDGTDDNEVLNLMQLREQKTRMN
Ga0192963_106231113300018762MarineKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0193031_107292613300018765MarineMKFVLLLALAATAEAVKLDSVPKKELMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWQPGTWPVYHTWNDDFDHATYHQHIDDGTDDNEVLNMVQLNAQKTMSK
Ga0193181_104249913300018766MarineFVFALVALAATSQAVQLEGVPKKELMKGAHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEVGTWPVYHTWDKKMNWATQHHEIDDGTDDNEVVDMLQTRQEKTHY
Ga0193124_105568613300018787MarineKMKFIALLALVATSQAVQLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWTSGTWPVYHTWDTNGDGSFKWAQYHQEVDDGTDDNEVLNVHLKTEQTNY
Ga0192950_105706213300018791MarineLMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQKHEIDDGTDDNEVVDMVQTRHENTHY
Ga0193306_105272313300018800MarineMKGSHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWETGTWPVYHTWDKKMNWATQHYEIDDGTDDNEVVNMLQTHTEKTHY
Ga0192949_109308413300018831MarineFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNVATQKHEIDDGTDDNEVVDMVQTRHENTHY
Ga0194240_101481313300018832MarineMALVATTQAVKLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEIDDGTDDNEVVDMVQMKHEKTHF
Ga0194240_102877413300018832MarinePEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATQHYELDDGTDDNEVVDMVQMKHEKTHY
Ga0193253_110786913300018846MarineKMKFVFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATIHHQIDDGSDDNEVVDMVQTRADKTHFSH
Ga0192970_107916713300018848MarineFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0192977_111335213300018874MarineKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0193090_111488913300018899MarineFVFALLALSATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0192989_1013713613300018926MarineFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNVATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0192989_1014330313300018926MarineATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATIHHQIDDGSDDNEVVDMVQTRADKTHFSH
Ga0193178_1008584713300018967MarineLLALAATSQAVKLEGVPKKQLMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKAPDPPIKYHDKMRQWQPGTWPVYHTWDTNPDGSFKWAQYDQQIDDGTDDNEVLNVHLKEERTKY
Ga0192873_1044819413300018974MarineMKFTLALVALAATSQAVQLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKAPDPPIQYHDKMRQWEKGTWPIYHTWNKDFDHASYSQEIDDGTDDNEVVNLLGMRAEQTRMK
Ga0193254_1012269313300018976MarineKFVFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATIHHQIDDGSDDNEVVDMVQTRADKTHFSH
Ga0193540_1020180413300018979MarineELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0192961_1017346713300018980MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQKHEIDDGTDDNEVVDMVQTRHENTHYXNRQNGEDFDFXQQT
Ga0192947_1021556113300018982MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNVATQKHEIDDGTDDNEVVDMVQTRHENTHYXNRQNGEDFDFXQQT
Ga0193030_1024125613300018989MarineMGKIIKKKMKFILLLALAATSEAVKLDGVPKKEIMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWQPGTWPVYHTWNSDFNHATQHQEIDDGSDDNEVLNMMQLKEERTRI
Ga0193030_1028138313300018989MarineATSQAVKLDGVPKKEIMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWKLNGDGSFKHATQHQQIDDGTDDNEVVNMIQQKDEQTRF
Ga0193030_1028903213300018989MarineEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0193569_1035981913300019017MarineFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0192951_1026680513300019022MarineMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQKHEIDDGTDDNEVVDMVQTRHENTHY
Ga0192869_1050748513300019032MarineHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWETGTWPVYHTWDKKMNWATQHYEVDDGTDDNEVVNMLQAHTDKTHY
Ga0192945_1024227923300019036MarineMKFVFALLALTATSQAVKLDGVPKADLMKGSHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWNSKFDHAGYHQEVDDGTDDNEVLNLMQLREQRTRDQ
Ga0193336_1043739613300019045MarineMALVATTQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATQHYEIDDGSDDNEVVDMLQMKHEKTHF
Ga0193336_1055632213300019045MarinePKKELMKGSHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWNKDFDHASYHQETDDGTDDNEVLNMLQVKKEETRTN
Ga0192981_1027028513300019048MarineMKFVFALLALSATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHYXNRQNGEDFDFXQQT
Ga0188866_102558913300019095Freshwater LakeKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0194243_100542313300019102MarineMALVATSQAVKLDGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEVDDGTDDNEVVDMVQMKHEKTHF
Ga0192972_108013913300019108MarineFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0193243_106194413300019116MarineWRKAWPEGTDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWKLNGDGSFKWASQHQQIDDGTDDNEVVNMIQQKDEQTRF
Ga0193104_104731813300019125MarineQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0193104_105534313300019125MarineHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0193104_106115213300019125MarineMGKIIKKKMKFVLLLALAATAEAVKLDSVPKKELMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWQPGTWPVYHTWNDDFDHATYHQHIDDGTDDNEVLNMVQLNAQKAMSK
Ga0193436_107128913300019129MarineRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEIDDGTDDNEVVDMVQMKHEKTHF
Ga0188870_1015100513300019149Freshwater LakeKFVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWESGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0194244_1004908713300019150MarineMKGSHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATQHYELDDGTDDNEVVDMVQMKHEKTHY
Ga0194244_1005025713300019150MarineMALVATSQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEIDDGTDDNEVVDMVQMKHEKTHF
Ga0194244_1008566813300019150MarineATSQAVQLEGIPKKELMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIEYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEIDDGTDDNEVVDMVQTRQEKTHY
Ga0194244_1010323113300019150MarineGVPKKALMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWAPGTWPVYHTWNGDFDHATYHQEVDDGTDDNEVLNVHLREEK
Ga0194244_1010934413300019150MarineMKGSHWRKAWPEGIDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0192975_1026815313300019153MarineFALLALSATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0206687_194654613300021169SeawaterLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0206693_124563713300021353SeawaterFVFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFSH
Ga0063132_10214113300021872MarineMKFTFALMALVATTQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRTRKGPDPPIQYHDKMRQWTPGTWPVYHTWDKKMNWATHHYEVDDGTDDNEVVDMVQMKHEKTHF
Ga0063132_12455013300021872MarineFVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0063136_101305413300021896MarineMKFVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0063135_100771513300021908MarineKMKFVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0063135_105653013300021908MarineALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATIHHQIDDGSDDNEVVDMVQTRADKTHFSH
Ga0063133_107417113300021912MarineKFVFALLALAATSQAVKLDGVPKKELMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPEPPIQYHDKMRQWTTGTWPVYHTWNKDFDHASFHQEVDDGTDDNEVLNMVHLRTEETRAN
Ga0063102_108217413300021941MarineFVFALLALAATSQAVQLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0228681_103820013300023683SeawaterFVFALLALASTSQAVKLEGVPKADMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTRPVLR
Ga0228682_105292513300023698SeawaterMKFVFALLALASTSQAVKLEGVPKADMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0209716_114859113300025626Pelagic MarineMKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0209832_115238923300025830Pelagic MarineQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0209335_1026709213300025894Pelagic MarineMKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWRQGNWPVNFSWNAPMDHATYHNQIDDGSDDNESVDVMTAHHGI
Ga0247557_104683113300026403SeawaterRKMKFVFALLALASTSQAVKLEGVPKKDMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0247559_110928113300026443SeawaterATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFSH
Ga0247594_107837913300026448SeawaterKFVFALMALVATSQAVQLEGIPKKELMKGSHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEAGTWPVYHTWDKKMNWATQHHEVDDGTDDNEVVDMVQTRQEKTHY
Ga0247588_111033713300026465SeawaterFVFALLALASTSQAVKVEGVPKKDMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLR
Ga0247598_115036413300026466SeawaterFVLALMALAATTEAVQLEGVPKKELMKGSHWRKAWPEGTDDSTDDENILNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWDTNSDGSFKHANYHQEVDDGTDDNEVLNVHLREEQTRY
Ga0247603_109218313300026468SeawaterKFVFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFSH
Ga0247603_111714513300026468SeawaterFVFALLALASTGQAVKLEGVPKADMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLR
Ga0247599_111743513300026470SeawaterKFVFALLALASTSQAVKLEGVPKKDMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTRPVRRK
Ga0247571_111607113300026495SeawaterMKFVFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFS
Ga0247571_114608513300026495SeawaterSTSQAVKLEGVPKKDMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0247592_114882313300026500SeawaterKMKFVFALLALASTSQAVKLEGVPKADMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0256412_129475813300028137SeawaterKFVFALLALATTSQAVKLEGVPKADMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0256412_132218913300028137SeawaterFALMALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFSH
Ga0256412_133413313300028137SeawaterMKGSHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWETGTWPVYHTWDKKMNWATQHYEVDDGTDDNEVVNMLQTHTDKTHY
Ga0256412_138239313300028137SeawaterATSQAVKLEGVPKGDLMSGSHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYHDKMRQWQEGTWPVYHTWNGGFNHATQHQEIDDGTDDNEVLNLMQLREQKTRMN
Ga0256417_120150413300028233SeawaterLAATTEAVQLEGVPKKELMKGSHWRKAWPEGTDDSTDDENILNWMRKRKGPDPPIQYHDKMRQWQPGTWPVYHTWDTNSDGSFKHANYHQEVDDGTDDNEVLNVHLREEQTRY
Ga0256413_131597213300028282SeawaterQAVKLEGVPKKDMMAGPHWRKAWPEGTDDSTNDEDVLNWMRKRKGPDPPIQYWDKMRQWAPGTWPVYHTWNGDFNKATQHQEIDDGTDDNEVLNLMQTRVEQTKPVLRK
Ga0256413_132765013300028282SeawaterVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIQYHDKMRQWAPGTWPVYHTWNEDFDHATMHHQIDDGSDDNEVVDMIQTRADKTHFSH
Ga0256413_135347813300028282SeawaterPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWETGTWPVYHTWDKKMNWATQHYEVDDGTDDNEVVNMLQTHTDKTHY
Ga0257128_109277013300028672MarineFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRQ
Ga0307401_1051579413300030670MarineKMKFVFALLALSATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0307403_1067964213300030671MarinePKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0073988_1227347613300030780MarineLLLALAATSEAVKLDGVPKKELMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWQPGTWPVYHTWNKDFDKATQHQEIDDGTDDNEVLNMMQIKEERTRMH
Ga0073990_1194265913300030856MarineMKFVFALMALVATSQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHYEVDDGTDDNEVVDMVQTRQEKTHY
Ga0073990_1199151113300030856MarineMKGAHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDPPIKYHDKMRQWAPGTWPVYHTWNDDFDHATYHQEVDDGTDDNEVLNLHLKEEKTKY
Ga0073987_1108008613300030912MarineKFVLALVALAATSQAVQLEGVPKKELMKGSHWRKPWPEGVDDSTDDENVMNWMRKRKGPDPPIEYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEIDDGTDDNEVVDMVQTHQEKTHY
Ga0073986_1195005313300031038MarineKMKFVFALVALAATSQAVQLEGVPKKELMKGAHWRKAWPEGVDDSTDDENVMNWMRKRKGPDPPIQYHDKMRQWEPGTWPVYHTWDKKMNWATQHHEIDDGTDDNEVVDMLQTRQEKTHY
Ga0307388_1090395113300031522MarineKMKFVFALLALTATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0308134_116118913300031579MarineEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0302121_1017437413300031626MarineMKFVFALLALAATSQAVQLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY
Ga0307394_1032122413300031735MarineKFVFALLALSATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0307404_1039958813300031752MarineATSQAVQLEGIPKKELMNGSHWRKAWPEGVDDSTNDEDVMNWMRKRKGPDAPIQYHDKMRQWEAGTWPVYHTWDGKMNWATQKHEIDDGTDDNEVVDMIQTRHENTHY
Ga0314680_1072405813300032521SeawaterKMKFVFALLALAATSQAVKLEGVPKKELMKGSHWRKAWPEGVDDSTNDEDVMNWMRARKGPDDPIKYHDKMRQWAPGTWPVYHTWNDDFDHATIHHQIDDGSDDNEVVDMIQTRAQKTHY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.