NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064609

Metagenome / Metatranscriptome Family F064609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064609
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 47 residues
Representative Sequence FMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL
Number of Associated Samples 108
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.03 %
% of genes near scaffold ends (potentially truncated) 91.41 %
% of genes from short scaffolds (< 2000 bps) 92.97 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.875 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.938 % of family members)
Environment Ontology (ENVO) Unclassified
(36.719 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.375 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.28%    β-sheet: 0.00%    Coil/Unstructured: 59.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF01479S4 10.16
PF00107ADH_zinc_N 4.69
PF00571CBS 3.12
PF12833HTH_18 3.12
PF01872RibD_C 2.34
PF06441EHN 1.56
PF08450SGL 1.56
PF01183Glyco_hydro_25 1.56
PF00296Bac_luciferase 1.56
PF03706LPG_synthase_TM 1.56
PF12681Glyoxalase_2 1.56
PF04299FMN_bind_2 0.78
PF13376OmdA 0.78
PF08281Sigma70_r4_2 0.78
PF00440TetR_N 0.78
PF04542Sigma70_r2 0.78
PF01522Polysacc_deac_1 0.78
PF13302Acetyltransf_3 0.78
PF03640Lipoprotein_15 0.78
PF08327AHSA1 0.78
PF00211Guanylate_cyc 0.78
PF03176MMPL 0.78
PF00005ABC_tran 0.78
PF11565PorB 0.78
PF01850PIN 0.78
PF08031BBE 0.78
PF00067p450 0.78
PF01594AI-2E_transport 0.78
PF08352oligo_HPY 0.78
PF01934HepT-like 0.78
PF08241Methyltransf_11 0.78
PF07883Cupin_2 0.78
PF08240ADH_N 0.78
PF10604Polyketide_cyc2 0.78
PF12867DinB_2 0.78
PF06772LtrA 0.78
PF08378NERD 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.34
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.34
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 1.56
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 1.56
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.56
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.56
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.56
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 1.56
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.78
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.78
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.78
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.78
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.78
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.78
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.78
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.78
COG2124Cytochrome P450Defense mechanisms [V] 0.78
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.78
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.78
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.78
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.78
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.78
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.88 %
UnclassifiedrootN/A3.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1255428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium635Open in IMG/M
3300000956|JGI10216J12902_102854412All Organisms → cellular organisms → Bacteria → Terrabacteria group670Open in IMG/M
3300000956|JGI10216J12902_104386044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300000956|JGI10216J12902_107605995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1376Open in IMG/M
3300000956|JGI10216J12902_111132904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300000956|JGI10216J12902_111279069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium788Open in IMG/M
3300002568|C688J35102_117738374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300004081|Ga0063454_100805600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium727Open in IMG/M
3300004156|Ga0062589_102014521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300004156|Ga0062589_102735708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300004157|Ga0062590_102070420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300004463|Ga0063356_100253859All Organisms → cellular organisms → Bacteria → Terrabacteria group2134Open in IMG/M
3300004479|Ga0062595_100252615All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300004479|Ga0062595_101416002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium635Open in IMG/M
3300004479|Ga0062595_101582833All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300004479|Ga0062595_102270015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales534Open in IMG/M
3300004480|Ga0062592_100284129All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300004480|Ga0062592_100504008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1001Open in IMG/M
3300004480|Ga0062592_100591450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium941Open in IMG/M
3300005093|Ga0062594_100012422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3166Open in IMG/M
3300005176|Ga0066679_10097043All Organisms → cellular organisms → Bacteria → Terrabacteria group1786Open in IMG/M
3300005327|Ga0070658_11513466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300005335|Ga0070666_11239719All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005336|Ga0070680_101580288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi568Open in IMG/M
3300005337|Ga0070682_100448088All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300005344|Ga0070661_100843889All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005354|Ga0070675_100963589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi783Open in IMG/M
3300005438|Ga0070701_11368828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300005445|Ga0070708_100037236All Organisms → cellular organisms → Bacteria4243Open in IMG/M
3300005458|Ga0070681_11320765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium644Open in IMG/M
3300005468|Ga0070707_100002015All Organisms → cellular organisms → Bacteria19451Open in IMG/M
3300005471|Ga0070698_100024782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae6255Open in IMG/M
3300005518|Ga0070699_100651363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300005535|Ga0070684_102038671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium541Open in IMG/M
3300005544|Ga0070686_101202902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium629Open in IMG/M
3300005545|Ga0070695_100456204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi980Open in IMG/M
3300005547|Ga0070693_100539739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi833Open in IMG/M
3300005554|Ga0066661_10310495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300005564|Ga0070664_101254770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium700Open in IMG/M
3300005614|Ga0068856_101827235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300005719|Ga0068861_102518617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae518Open in IMG/M
3300005842|Ga0068858_100543969All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300005937|Ga0081455_10852486All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300006046|Ga0066652_101695292All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300006755|Ga0079222_11148438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium689Open in IMG/M
3300006791|Ga0066653_10118234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1239Open in IMG/M
3300006844|Ga0075428_101486348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium710Open in IMG/M
3300006845|Ga0075421_101835777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium651Open in IMG/M
3300006852|Ga0075433_11804949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi526Open in IMG/M
3300006852|Ga0075433_11842574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300006914|Ga0075436_101450517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300007076|Ga0075435_101899105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300009012|Ga0066710_104489368All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300009094|Ga0111539_11615400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium752Open in IMG/M
3300009098|Ga0105245_11084120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium847Open in IMG/M
3300009100|Ga0075418_12362117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300009101|Ga0105247_11130735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300009148|Ga0105243_10717568Not Available976Open in IMG/M
3300009156|Ga0111538_13270884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300009162|Ga0075423_10795367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1000Open in IMG/M
3300009162|Ga0075423_11245968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium794Open in IMG/M
3300009176|Ga0105242_10171441All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300009176|Ga0105242_10747990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium962Open in IMG/M
3300009868|Ga0130016_10094670All Organisms → cellular organisms → Bacteria2655Open in IMG/M
3300010322|Ga0134084_10351089All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300010335|Ga0134063_10361168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium707Open in IMG/M
3300011119|Ga0105246_10277392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1343Open in IMG/M
3300011119|Ga0105246_10335196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1234Open in IMG/M
3300011119|Ga0105246_11184461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300011400|Ga0137312_1005501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1420Open in IMG/M
3300012203|Ga0137399_11707964All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012362|Ga0137361_10502671All Organisms → cellular organisms → Bacteria → Terrabacteria group1113Open in IMG/M
3300012507|Ga0157342_1043578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300012532|Ga0137373_11220369All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012896|Ga0157303_10066341Not Available788Open in IMG/M
3300012904|Ga0157282_10306279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi561Open in IMG/M
3300012913|Ga0157298_10385436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300012957|Ga0164303_10287235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium963Open in IMG/M
3300012960|Ga0164301_10540705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium849Open in IMG/M
3300012984|Ga0164309_10424065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300012985|Ga0164308_11237674All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012989|Ga0164305_11286462All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300013297|Ga0157378_12602006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → unclassified Sediminibacterium → Sediminibacterium sp. RHBRASLY1558Open in IMG/M
3300013308|Ga0157375_11066068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13945Open in IMG/M
3300013308|Ga0157375_13346606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300014267|Ga0075313_1103608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium704Open in IMG/M
3300014325|Ga0163163_11749580Not Available682Open in IMG/M
3300014745|Ga0157377_10419212All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300014968|Ga0157379_10577585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300014968|Ga0157379_11201500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300015371|Ga0132258_11664800All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1610Open in IMG/M
3300015372|Ga0132256_102499720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300015373|Ga0132257_100766355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1202Open in IMG/M
3300015373|Ga0132257_102771985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium639Open in IMG/M
3300015374|Ga0132255_100838968All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300015374|Ga0132255_102950911All Organisms → cellular organisms → Bacteria → Terrabacteria group726Open in IMG/M
3300018469|Ga0190270_11736860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300018482|Ga0066669_11344946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium647Open in IMG/M
3300022899|Ga0247795_1076358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300025907|Ga0207645_11234671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium501Open in IMG/M
3300025910|Ga0207684_10101799All Organisms → cellular organisms → Bacteria2456Open in IMG/M
3300025913|Ga0207695_11700896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300025914|Ga0207671_11341226All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025922|Ga0207646_10003007All Organisms → cellular organisms → Bacteria19437Open in IMG/M
3300025922|Ga0207646_10081670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2890Open in IMG/M
3300025934|Ga0207686_11196901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300025935|Ga0207709_10842859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300025937|Ga0207669_10153717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1615Open in IMG/M
3300025944|Ga0207661_11588571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium599Open in IMG/M
3300025945|Ga0207679_11465638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300025981|Ga0207640_10882202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300025986|Ga0207658_11610551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300026062|Ga0208654_1052181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300026078|Ga0207702_11835257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium598Open in IMG/M
3300026116|Ga0207674_10278071All Organisms → cellular organisms → Bacteria1622Open in IMG/M
3300026343|Ga0209159_1226422All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300026867|Ga0207475_1011453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium573Open in IMG/M
3300027360|Ga0209969_1052249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300028380|Ga0268265_11509402All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300028784|Ga0307282_10056351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1763Open in IMG/M
3300028791|Ga0307290_10228480All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300028807|Ga0307305_10264959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium784Open in IMG/M
3300028828|Ga0307312_10735764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium653Open in IMG/M
3300028884|Ga0307308_10528587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300031547|Ga0310887_10800299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300031902|Ga0302322_102626481All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031908|Ga0310900_11763498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium526Open in IMG/M
3300034668|Ga0314793_041045Not Available816Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil9.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere7.03%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026867Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_125542823300000881SoilTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
JGI10216J12902_10285441223300000956SoilWMREENDQLPAEVVDHAFRSLVLPGVSNVLELDLEVPKSL*
JGI10216J12902_10438604413300000956SoilFIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVGNVLELQLELPRSL*
JGI10216J12902_10760599543300000956SoilVGTFIGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELELELPTSL*
JGI10216J12902_11113290423300000956SoilWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
JGI10216J12902_11127906923300000956SoilGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
C688J35102_11773837413300002568SoilEWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0063454_10080560013300004081SoilFQFETLVRFLVGTFVGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPASL
Ga0062589_10201452113300004156SoilFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLEFPRAL*
Ga0062589_10273570813300004156SoilFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGIANVLELDLELPLAL*
Ga0062590_10207042013300004157SoilRLETVVRFLVGTFVGFMDWWMRDENAHLPPELVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0063356_10025385943300004463Arabidopsis Thaliana RhizosphereFMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELELPKSL*
Ga0062595_10025261533300004479SoilMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0062595_10141600213300004479SoilWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
Ga0062595_10158283313300004479SoilLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELELELPKSL*
Ga0062595_10227001513300004479SoilFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0062592_10028412933300004480SoilVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0062592_10050400813300004480SoilFMDWWMREENENLPAEQVDHAFRSLVLPGVATVLELDLELPKSL*
Ga0062592_10059145013300004480SoilGFMDWWMREENEHLPPELVDHAYRLLVLPGVANVLELDLELPMAP*
Ga0062594_10001242213300005093SoilMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0066679_1009704313300005176SoilLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL*
Ga0070658_1151346613300005327Corn RhizosphereTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELEIDLPTSL*
Ga0070666_1123971923300005335Switchgrass RhizosphereFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL*
Ga0070680_10158028823300005336Corn RhizosphereDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0070682_10044808833300005337Corn RhizosphereLQTVVRFLVGTFMGFMDWWMRDENDHLPAEDVDHAFRTLALPGVANVLELRLNLPKSL*
Ga0070661_10084388933300005344Corn RhizosphereTFIGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELTLDVPESL*
Ga0070675_10096358913300005354Miscanthus RhizosphereGFMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELELPKSL*
Ga0070701_1136882813300005438Corn, Switchgrass And Miscanthus RhizosphereFIGFMDWWMREENEHLPAEVVDHAYRSLVLPGVANVLELDLELPKAL*
Ga0070708_10003723613300005445Corn, Switchgrass And Miscanthus RhizosphereIVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070681_1132076513300005458Corn RhizosphereFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0070707_100002015233300005468Corn, Switchgrass And Miscanthus RhizosphereFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070698_10002478283300005471Corn, Switchgrass And Miscanthus RhizosphereVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070699_10065136333300005518Corn, Switchgrass And Miscanthus RhizosphereMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL*
Ga0070684_10203867113300005535Corn RhizosphereETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0070686_10120290213300005544Switchgrass RhizosphereFLVGTFIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0070695_10045620423300005545Corn, Switchgrass And Miscanthus RhizosphereTVVRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0070693_10053973923300005547Corn, Switchgrass And Miscanthus RhizosphereTFIGFMDWWMREENEHLPAEVVDHAYRSLVLPGIANVLEVDLELPKAL*
Ga0066661_1031049523300005554SoilWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL*
Ga0070664_10125477033300005564Corn RhizosphereFMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0068856_10182723513300005614Corn RhizosphereNEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0068861_10251861713300005719Switchgrass RhizosphereFIGFMDWWMREENEHLPAEGVDHAFRSLVLPGVANVLELDLELPTRL*
Ga0068858_10054396913300005842Switchgrass RhizosphereIGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL*
Ga0081455_1085248623300005937Tabebuia Heterophylla RhizosphereFLVGTFIGFMDWWMRKENEHLPAEQVDHAFRSLVLPGVSNVLGLRLELPKAL*
Ga0066652_10169529213300006046SoilGFMDWWMREENDHLPAEQVDHAYRSLVLPGLANVLELELELPKSL*
Ga0079222_1114843813300006755Agricultural SoilMREENEHVPPEQVDHAFRSLALPGVANVLELDIELPKAL*
Ga0066653_1011823423300006791SoilFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLDLELELPKSL*
Ga0075428_10148634813300006844Populus RhizosphereTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELELELPKAL*
Ga0075421_10183577713300006845Populus RhizosphereFMDWWMREENEHLPAEQVDHAFRSLALPGVTTVLELDLELPTSL*
Ga0075433_1180494913300006852Populus RhizosphereFLVGTFIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVASVLQLDLELPRSL*
Ga0075433_1184257423300006852Populus RhizosphereGFMDWWLRAENEHLPAEQVDHAFRSLVLPGVANALELEIELPTSL*
Ga0075436_10145051713300006914Populus RhizosphereVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0075435_10189910523300007076Populus RhizosphereWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0066710_10448936813300009012Grasslands SoilGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0111539_1161540013300009094Populus RhizosphereIRFMDRWFREENHHFPPEQVDHAFRSLVLPGVARVLELELDLPSAL*
Ga0105245_1108412013300009098Miscanthus RhizosphereEENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL*
Ga0075418_1236211723300009100Populus RhizosphereDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELELELPKAL*
Ga0105247_1113073533300009101Switchgrass RhizosphereVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELEIDLPTSL*
Ga0105243_1071756823300009148Miscanthus RhizosphereFIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0111538_1327088413300009156Populus RhizosphereEHVPPAQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0075423_1079536733300009162Populus RhizosphereREENDHLPPEQVDHAFRTLVLPGVARVLELELDLPGAL*
Ga0075423_1124596813300009162Populus RhizosphereNDHLPPEQVDHAFRSLVLPGVARVLELELDLPSAL*
Ga0105242_1017144113300009176Miscanthus RhizosphereMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0105242_1074799013300009176Miscanthus RhizosphereMDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLKLELELPESL*
Ga0130016_1009467023300009868WastewaterMEWWMREENDGVPPEVVDHAFRSLVLPGVSNVLGLEIDLPTKL*
Ga0134084_1035108913300010322Grasslands SoilVVGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLDLELELPKSL*
Ga0134063_1036116823300010335Grasslands SoilMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL*
Ga0105246_1027739243300011119Miscanthus RhizosphereFRVETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPSVANVLELDLELPTAL
Ga0105246_1033519633300011119Miscanthus RhizosphereVWDWWLREENDQIPAEQFDHAFRSLVLPGVARVLELEIDPPATL*
Ga0105246_1118446123300011119Miscanthus RhizosphereLVGTFIGFMDWWMREENEHLPAEVVDHAYRSLVLPGVANVLELDLELPKAL*
Ga0137312_100550113300011400SoilGTFIGFMDWWMREENEHLPAEQVDHIFRSLALPGVANVLELELELPTTL*
Ga0137399_1170796423300012203Vadose Zone SoilMREENDHLPAEQVDHAFRALVLPGVANALELKLDVPESL*
Ga0137361_1050267113300012362Vadose Zone SoilLRLEIVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL
Ga0157342_104357813300012507Arabidopsis RhizosphereEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0137373_1122036913300012532Vadose Zone SoilENEHLPAEQVDHAFRSLVLPGVANVLELELELPKSL*
Ga0157303_1006634113300012896SoilTVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0157282_1030627913300012904SoilIGFMDWWMREENEHLPPEQVDHAFRSLVLPGVANVLELQMEIPRSL*
Ga0157298_1038543623300012913SoilVRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL*
Ga0164303_1028723513300012957SoilGFMDWWLRAENEHLPAERVDHAFRSLVLPGVANALELEIELPTSL*
Ga0164301_1054070513300012960SoilMSEENEHLPAEQVDRAFRALVLPGVANVLELDLELPMSL*
Ga0164309_1042406533300012984SoilMDWWMREENDHLPAEQVDHAFRALALPGVANVLELKLDVPESL*
Ga0164308_1123767433300012985SoilFMDWWMREENDNLPAEQVDHAFRTLALPGVAHVLELRLNLPKSL*
Ga0164305_1128646233300012989SoilGTFIGFMDWWIREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL*
Ga0157378_1260200623300013297Miscanthus RhizosphereFMGFMDWWMRDENDHLPAEDVDHAFRTLALPGVANVLELRLNLPKSL*
Ga0157375_1106606833300013308Miscanthus RhizosphereWWMREENEHLPAEGVDHAFRSLVLPGVANVLKLDLELPRSL*
Ga0157375_1334660623300013308Miscanthus RhizosphereFLVGTFIGFMDWWLRDENRQLSAEQVDQSFRSLVLPGVSNVLELEIAVPKSP*
Ga0075313_110360833300014267Natural And Restored WetlandsGAFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELELELPKAL*
Ga0163163_1174958013300014325Switchgrass RhizosphereGTFIGFMDWWMREENEHVPPEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0157377_1041921213300014745Miscanthus RhizosphereMREKNNHLPAEQVDHAFRALVLPGVANVLELTLDVPESL*
Ga0157379_1057758533300014968Switchgrass RhizosphereAFRVETVVRFLVGTFIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPTAL*
Ga0157379_1120150023300014968Switchgrass RhizosphereIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLKLELELPESL*
Ga0132258_1166480023300015371Arabidopsis RhizosphereVVRFLVGTFIGFMDWWMREENEHLPPELVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0132256_10249972023300015372Arabidopsis RhizosphereFRLETVVRFLVGTFIGFMDWWMREENEHLPPEQVDRAFRSLVLPGVANVLELDLELPTSL
Ga0132257_10076635523300015373Arabidopsis RhizosphereLETVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRTL*
Ga0132257_10277198523300015373Arabidopsis RhizosphereMDWWMREENEHLPAEQVDHALRSLVLPGVANVLELEIDLPTSL*
Ga0132255_10083896843300015374Arabidopsis RhizosphereFIGFMDWWVREENEQLSAETVDKAFRSLVLPGLANVLDLEIDVPKAL*
Ga0132255_10295091133300015374Arabidopsis RhizosphereFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL*
Ga0190270_1173686033300018469SoilGFMDWWMREENDHLPAEQVDHAFRALVLPGVAKVLELELDLPKSL
Ga0066669_1134494623300018482Grasslands SoilVGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0247795_107635813300022899SoilNEHLPAEQVDHAFRSLVLPGVTNVLELDLELPKAL
Ga0207645_1123467113300025907Miscanthus RhizosphereGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207684_1010179913300025910Corn, Switchgrass And Miscanthus RhizosphereVVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207695_1170089613300025913Corn RhizosphereENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207671_1134122613300025914Corn RhizosphereGTFVGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0207646_10003007233300025922Corn, Switchgrass And Miscanthus RhizosphereREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0207646_1008167013300025922Corn, Switchgrass And Miscanthus RhizosphereMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPHAL
Ga0207686_1119690133300025934Miscanthus RhizosphereFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0207709_1084285913300025935Miscanthus RhizosphereFIGFMDWWMREENEHLPAERVDHAFRSLVLPGVANVLELDLELPKAL
Ga0207669_1015371743300025937Miscanthus RhizosphereFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207661_1158857123300025944Corn RhizosphereVWDWWLREENDQIPAEQFDHVFRSLVLPGVARVLELEIDPPATL
Ga0207679_1146563823300025945Corn RhizosphereGFMDWWMREENEHLPAEQVDRAFRSLVLPGVASVLELDLELPTSL
Ga0207640_1088220233300025981Corn RhizosphereFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPKAL
Ga0207658_1161055113300025986Switchgrass RhizosphereWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPRAL
Ga0208654_105218123300026062Natural And Restored WetlandsVVRFLVGAFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVSNVLELDLELPKAL
Ga0207702_1183525723300026078Corn RhizosphereRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0207674_1027807143300026116Corn RhizosphereVRFLVGTFVGFMDWWMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0209159_122642223300026343SoilRFVVGTFIGFMDWWMREENEHLPAEQVDHAYRSLVLPGLANVLELELELPKSL
Ga0207475_101145313300026867SoilVRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0209969_105224913300027360Arabidopsis Thaliana RhizosphereRFLVGTFIGFMDWWMREENEHLPAEQVDHAFRSLVLPGVANVLELNLELPTAL
Ga0268265_1150940233300028380Switchgrass RhizosphereMREENDHLPAEQVDHAFRALVLPGVANVLELKLDVPESL
Ga0307282_1005635123300028784SoilMREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307290_1022848013300028791SoilSFQLETIVHFLVGTFIGFMDWWMRKENDHLPAEQVDHAFRSLVLPGVANVLELDLQLPRS
Ga0307305_1026495923300028807SoilLVGTFIGFMDWWMREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307312_1073576413300028828SoilMDWWMREENEHLPAEQVDHTFRSLVLPGVANVLELELELPKSL
Ga0307308_1052858723300028884SoilALRLEIVVRFLVGTFIGFMDWWMREENEHLPAAQVDHAFRSLVLPGVASVLELDLELPRA
Ga0310887_1080029923300031547SoilWWMREENDHLPAEQVDHAFRSLVLPGVANVLELDLELPTAL
Ga0302322_10262648113300031902FenEENGHLPPEAVDHAFRSLVLPGIANVLELDIELPRNL
Ga0310900_1176349813300031908SoilVVRFLVGTFIGFMDWWMREENDHLPAEQVDHAFRSLVLPGVASVLELDLELPKSL
Ga0314793_041045_695_8143300034668SoilMWDWWLREERDQIPAEQFDHAFRSLVLRGVARVLELEIDL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.