NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064563

Metagenome / Metatranscriptome Family F064563

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064563
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 111 residues
Representative Sequence MSSRQLIGGFAAALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDSSGDSETRTKTNC
Number of Associated Samples 71
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.19 %
% of genes near scaffold ends (potentially truncated) 32.03 %
% of genes from short scaffolds (< 2000 bps) 69.53 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.875 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(25.781 % of family members)
Environment Ontology (ENVO) Unclassified
(61.719 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.938 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.33%    Coil/Unstructured: 84.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF05532CsbD 7.81
PF03330DPBB_1 6.25
PF01274Malate_synthase 3.91
PF03631Virul_fac_BrkB 2.34
PF11752DUF3309 1.56
PF05239PRC 0.78
PF12680SnoaL_2 0.78
PF01566Nramp 0.78
PF00005ABC_tran 0.78
PF07332Phage_holin_3_6 0.78
PF01638HxlR 0.78
PF01594AI-2E_transport 0.78
PF07876Dabb 0.78
PF02897Peptidase_S9_N 0.78
PF08240ADH_N 0.78
PF07690MFS_1 0.78
PF01244Peptidase_M19 0.78
PF01545Cation_efflux 0.78
PF03063Prismane 0.78
PF03466LysR_substrate 0.78
PF00849PseudoU_synth_2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 7.81
COG2225Malate synthaseEnergy production and conversion [C] 3.91
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.34
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.78
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.78
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.78
COG1151Hydroxylamine reductase (hybrid-cluster protein)Energy production and conversion [C] 0.78
COG1152CO dehydrogenase/acetyl-CoA synthase alpha subunitEnergy production and conversion [C] 0.78
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.78
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.78
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.78
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.78
COG1770Protease IIAmino acid transport and metabolism [E] 0.78
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.78
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.78
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.88 %
UnclassifiedrootN/A3.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006795|Ga0075520_1126879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291133Open in IMG/M
3300006795|Ga0075520_1138428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291072Open in IMG/M
3300006893|Ga0073928_10462823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129916Open in IMG/M
3300009623|Ga0116133_1064991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129909Open in IMG/M
3300014160|Ga0181517_10016663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5280Open in IMG/M
3300014160|Ga0181517_10020385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4594Open in IMG/M
3300014160|Ga0181517_10021244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4473Open in IMG/M
3300014160|Ga0181517_10064848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292201Open in IMG/M
3300014160|Ga0181517_10641121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129530Open in IMG/M
3300014161|Ga0181529_10011318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8241Open in IMG/M
3300014161|Ga0181529_10011432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8186Open in IMG/M
3300014161|Ga0181529_10018878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5824Open in IMG/M
3300014161|Ga0181529_10047470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3058Open in IMG/M
3300014161|Ga0181529_10088610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2008Open in IMG/M
3300014161|Ga0181529_10115481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291685Open in IMG/M
3300014161|Ga0181529_10570059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129593Open in IMG/M
3300014161|Ga0181529_10750848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129501Open in IMG/M
3300014167|Ga0181528_10043722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2499Open in IMG/M
3300014168|Ga0181534_10774043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129566Open in IMG/M
3300014168|Ga0181534_10968793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129512Open in IMG/M
3300014169|Ga0181531_10007073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6566Open in IMG/M
3300014199|Ga0181535_10115233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291716Open in IMG/M
3300014200|Ga0181526_10643997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129669Open in IMG/M
3300014201|Ga0181537_10207866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291345Open in IMG/M
3300014490|Ga0182010_10451941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129706Open in IMG/M
3300014490|Ga0182010_10523622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129657Open in IMG/M
3300014491|Ga0182014_10067296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292330Open in IMG/M
3300014491|Ga0182014_10090370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291881Open in IMG/M
3300014491|Ga0182014_10095348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1810Open in IMG/M
3300014491|Ga0182014_10156293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291280Open in IMG/M
3300014492|Ga0182013_10019556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6204Open in IMG/M
3300014492|Ga0182013_10135633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291580Open in IMG/M
3300014492|Ga0182013_10186837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291262Open in IMG/M
3300014493|Ga0182016_10009135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria9886Open in IMG/M
3300014495|Ga0182015_10775391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129603Open in IMG/M
3300014498|Ga0182019_10227545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291218Open in IMG/M
3300014498|Ga0182019_10323213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291035Open in IMG/M
3300014498|Ga0182019_10404102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129932Open in IMG/M
3300014501|Ga0182024_10795086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291154Open in IMG/M
3300014502|Ga0182021_10134850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2870Open in IMG/M
3300014502|Ga0182021_11696119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129761Open in IMG/M
3300014657|Ga0181522_10003983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8207Open in IMG/M
3300014657|Ga0181522_10122326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291512Open in IMG/M
3300014657|Ga0181522_10815926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129573Open in IMG/M
3300014657|Ga0181522_10919315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129540Open in IMG/M
3300014658|Ga0181519_10021883All Organisms → cellular organisms → Bacteria4506Open in IMG/M
3300014839|Ga0182027_10292219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291847Open in IMG/M
3300014839|Ga0182027_11152558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129783Open in IMG/M
3300014839|Ga0182027_11368890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129702Open in IMG/M
3300017948|Ga0187847_10135569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291347Open in IMG/M
3300017988|Ga0181520_10004714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales22488Open in IMG/M
3300017988|Ga0181520_10015651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9210Open in IMG/M
3300017988|Ga0181520_10019913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7733Open in IMG/M
3300017988|Ga0181520_10037840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4865Open in IMG/M
3300017988|Ga0181520_10073303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3071Open in IMG/M
3300017988|Ga0181520_10106389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292387Open in IMG/M
3300017988|Ga0181520_10138698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1999Open in IMG/M
3300017988|Ga0181520_10797739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129637Open in IMG/M
3300018004|Ga0187865_1293226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129537Open in IMG/M
3300018034|Ga0187863_10721545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129563Open in IMG/M
3300018035|Ga0187875_10243260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129983Open in IMG/M
3300018037|Ga0187883_10241768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129924Open in IMG/M
3300018038|Ga0187855_10244401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291054Open in IMG/M
(restricted) 3300023060|Ga0224519_1026515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129660Open in IMG/M
3300023090|Ga0224558_1108157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129958Open in IMG/M
3300023091|Ga0224559_1039104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291914Open in IMG/M
3300023091|Ga0224559_1220828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129649Open in IMG/M
3300023311|Ga0256681_11616002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129500Open in IMG/M
3300025650|Ga0209385_1206389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129540Open in IMG/M
3300025891|Ga0209585_10309332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129634Open in IMG/M
3300026450|Ga0247847_1041323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129612Open in IMG/M
3300026450|Ga0247847_1047313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129572Open in IMG/M
3300028090|Ga0255349_1055595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129788Open in IMG/M
3300028268|Ga0255348_1007047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292510Open in IMG/M
3300028745|Ga0302267_10080333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291665Open in IMG/M
3300028762|Ga0302202_10080398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291938Open in IMG/M
3300028762|Ga0302202_10177870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291112Open in IMG/M
3300028762|Ga0302202_10200958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291021Open in IMG/M
3300028785|Ga0302201_10432935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129507Open in IMG/M
3300028882|Ga0302154_10305465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129781Open in IMG/M
3300028882|Ga0302154_10324693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129752Open in IMG/M
3300029883|Ga0311327_10486491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129759Open in IMG/M
3300029907|Ga0311329_10248307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291325Open in IMG/M
3300029907|Ga0311329_10831211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129586Open in IMG/M
3300029911|Ga0311361_10332986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291667Open in IMG/M
3300029915|Ga0311358_10675185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129764Open in IMG/M
3300029922|Ga0311363_10256162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292027Open in IMG/M
3300030000|Ga0311337_10586318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129959Open in IMG/M
3300030045|Ga0302282_1353227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129524Open in IMG/M
3300030225|Ga0302196_10354612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129648Open in IMG/M
3300030877|Ga0265777_118286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129565Open in IMG/M
3300031232|Ga0302323_102718114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129565Open in IMG/M
3300031235|Ga0265330_10011798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans4092Open in IMG/M
3300031235|Ga0265330_10022193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2890Open in IMG/M
3300031235|Ga0265330_10024995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2709Open in IMG/M
3300031235|Ga0265330_10035808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292214Open in IMG/M
3300031235|Ga0265330_10302056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129675Open in IMG/M
3300031239|Ga0265328_10025471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292229Open in IMG/M
3300031239|Ga0265328_10220696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129722Open in IMG/M
3300031239|Ga0265328_10296106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129624Open in IMG/M
3300031241|Ga0265325_10002357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria12784Open in IMG/M
3300031241|Ga0265325_10204959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129908Open in IMG/M
3300031241|Ga0265325_10252461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129798Open in IMG/M
3300031241|Ga0265325_10346352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129657Open in IMG/M
3300031242|Ga0265329_10122372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129835Open in IMG/M
3300031249|Ga0265339_10009243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6212Open in IMG/M
3300031249|Ga0265339_10054472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2172Open in IMG/M
3300031249|Ga0265339_10448144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129599Open in IMG/M
3300031250|Ga0265331_10164289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291006Open in IMG/M
3300031261|Ga0302140_10267042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291478Open in IMG/M
3300031344|Ga0265316_10241155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291329Open in IMG/M
3300031344|Ga0265316_10331864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291103Open in IMG/M
3300031344|Ga0265316_11127528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129544Open in IMG/M
3300031711|Ga0265314_10086728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1292048Open in IMG/M
3300031711|Ga0265314_10357164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129802Open in IMG/M
3300031788|Ga0302319_10062126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae5819Open in IMG/M
3300031788|Ga0302319_10381686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291585Open in IMG/M
3300032515|Ga0348332_12802677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129530Open in IMG/M
3300032605|Ga0316232_1096425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291337Open in IMG/M
3300033402|Ga0326728_10988568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129584Open in IMG/M
3300033822|Ga0334828_036657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S1291422Open in IMG/M
3300034195|Ga0370501_0185779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129730Open in IMG/M
3300034195|Ga0370501_0351539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129536Open in IMG/M
3300034282|Ga0370492_0038719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1960Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog25.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere17.97%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog13.28%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil7.03%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.12%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.12%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.78%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300023060 (restricted)Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T0EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300026450Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030877Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030907Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0075520_112687913300006795Arctic Peat SoilMSLHRLIGCSAAALVGAGAMLASVAATQATMLPVSRYATPDVQHVDCAVGAHIGPLGACILGNDDNPPVVVEPRAGDAPNPQGADGCATKSVTRTDAEGNSETKTKTNCP*
Ga0075520_113842823300006795Arctic Peat SoilVISDASLPISLSAECERIIDASPSIDDAHTEGMIMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQATDGCSTKSVTRTDQNGGSETHTKTNC*
Ga0073928_1046282323300006893Iron-Sulfur Acid SpringMATATRSLFDPIALLVSARLPIGRTSRAQTEGIVTSLRQLMGCSAAAVVGAGAMLASVAAAQSTMLPVPRYATPYVQHVDCAVGAHVGPLGGCILGHDDNPPPVVIERRAADAPDSRDADGCATKSITRTNGTGDSETKTKTNC*
Ga0116133_106499123300009623PeatlandMIMSSRQLIGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNSPGVVEHRVIDAPDPQAADGCSTKSVTRTDGNGDSETHTKTNC*
Ga0181517_1001666373300014160BogMIMSSRQLIGGFAAALVGAGAMLASVGATQATMLPATHYATPDVQRVDCAIGAHIGPLGGCIIGRDDNPPVVVEHRVIDSPDPRATDGCSTKSVTRTDASGDSETHTKTNC*
Ga0181517_1002038543300014160BogMIMSSRQLIGGLTAALVGAGAMLASVAATQATMLPVSRYATPDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAANGCSTKSVTRTDASGDSETRTKTNC*
Ga0181517_1002124493300014160BogMIMSSRHFIGCFAAALVGAGATLASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDTPDPQAVDGCSTKTVTRTDGNGDSETHTKTNC*
Ga0181517_1006484823300014160BogMIMSLRQLIGCSAAALVGAGAVLASAATTQAAMLPVSRLATPYVQYVECAIGAHIGPLGACIIGNDDNQPVVVEHRVVNAPDPQAADGCSTKSVTRTDATGDSETHTKTNC*
Ga0181517_1064112113300014160BogMIMSSRQLIGCFAAALVGAGAMLASVATTQATMLPVSSYATPYVQYVDCAIGAHIGPLGACIIGHDDNSPGVVEHRVIDAPDPQAADGCSTKSVTRTDGNGDSETHTKTNC*
Ga0181529_10011318103300014161BogMIMSSRQLIGGFVAALVGAGAILASVGATQATMLPASHYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQATNGCSTKSVTRTDSGGDSETHTKTNC*
Ga0181529_1001143233300014161BogMSSRQLIGGFAAALVGAGAMLASVGATQATMLPATHYATPDVQRVDCAIGAHIGPLGGCIIGRDDNPPVVVEHRVIDSPDPRATDGCSTKSVTRTDASGDSETHTKTNC*
Ga0181529_1001887843300014161BogVRIIDASPSIVDAHSEGMIMSSRQLIGGFAAALLGAGAMLASVGATQATMLPASHYATPDVQHVDCAIGAHIGPLGGCILGHDDNPPVVVEHRVVDSPDPQAADGCSTKSVTRTDASGDSETHTKTNC*
Ga0181529_1004747063300014161BogMIMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDGSGDSETHTRTNC*
Ga0181529_1008861063300014161BogMIMSSRQLIGGFATALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDSSGDSETHTKTNC*
Ga0181529_1011548133300014161BogMSSRQLIGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAANGCSTKSVTRTDASGDSETRTKTNC*
Ga0181529_1057005913300014161BogIGGFAAALLGAGAMLASIAPTQAAMLPASHYATSNVQQVDCAIGAHIGPLGGCIIGHDDNPPVVVERRVIDSPDPQAADGCSTKSVTRTDASGDSETHTKTNC*
Ga0181529_1075084813300014161BogMSLHQLIGCSAAALIGAGAMLASATATQATILPVSHYATPYVHHVDCAVGAHIGPLGACIIGNDDNPPVVVEHRAVDGPAPQDADGCSTKSVTRTDGMGNSETHTKTNC*
Ga0181528_1004372243300014167BogMSSRQLIGGFAAAVVGAGAMLASVGATQATMLPGSRYSTPYVQNVDCAIGAHIGPLGACIIGHDDNPPVVVEHRAIDAPDPQAADGCSTKSVTRTDGSGDTETHTRTNC*
Ga0181534_1077404313300014168BogMSLNQLVGCSVIALAGAGALLVFVATPQAMTLPVSGYATPEVQNVECAIGAHIGPLGGCILGHDDNPPMPVPVERRAVDAPDSQSPDGCSSKSVTKTDGMGNTETKTKTNC*
Ga0181534_1096879313300014168BogMSSRQLIGGFAAALLGAGAMLASIAPTQAAMLPASHYATSNVQQVDCAIGAHIGPLGGCIIGHDDNPPVVVERRVIDSPDPQAADGCSTKSVTRTDSSGDSETRTKTNC*
Ga0181531_1000707343300014169BogMSDAQTQGMIMSLHQLIGCSAAALVGAGAILATVATTQAVTLPVTRLAAPYIQNVDCAIGAHIGPLGACIIGNDDNPPVVVEHRVVDAPDPQAADGCSTKSVTRTDSSGDSETRTKTNC*
Ga0181535_1011523353300014199BogMIMSSRHFIGCFAAALVGAGATLASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDTPDPQAVDGCSTKTVTRTDGNGDSETHTKTN
Ga0181526_1064399723300014200BogMIMSLRQLIGCSAAALVGAGAVLASAATTQAAMLPVSRLATPYVQYVECAIGAHIGPLGACIIGNDDNPPVVVEHRVVNAPDPQAADGCSTKSVTRTDATGDSETHTKTNC*
Ga0181537_1020786623300014201BogMSDAQTQGMIMSLHQLIGCSAAALVGAGAILATVATTKAVTLPVTRLAAPYIQNVDCAIGAHIGPLGACIIGNDDNPPVVVEHRVVDAPDPQAADGCSTKSVTRTDSSGDSETRTKTNC*
Ga0182010_1045194113300014490FenVISDASLPISLSAECERIIDASPSIDDAHTEGMTMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDLQAADGCSTKSVTRTDGSGASETHTKTNC*
Ga0182010_1052362213300014490FenMSLHQLIGCSAAALVGAGAMLAAATTTQATTLRVSHYATPYVHHVDCAVGAHIGPLGACIIGNDDNPPVVVEHRVVDAPAPQNADGCSTKSVTRTDGMGNTETHTKSNC*
Ga0182014_1006729653300014491BogMSSRQLIGCFAATLVGAGAILASIGATQATMLPVSHYATPDVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAADGCSTKSVTRTDGSGASETQTKTNC*
Ga0182014_1009037033300014491BogMSLHRLIGCSAAALVGAGAMLASVAATQATMLPVSRYATPDVQHVDCAVGAHIGPLGACILGNDEKPPVVVEPRAVDAPNPQGADGCATKSVTRTDAEGNSETKTKTNCPP*
Ga0182014_1009534813300014491BogGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAADGCSTKSVTRTDGNGGSETQTKTNC*
Ga0182014_1015629323300014491BogMIMSSRQLTGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC*
Ga0182013_1001955623300014492BogMVDAHSEGMIMSLRQLIGCSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNSQSSDGCSTKSVTKTDGTGDTETHTKTNC*
Ga0182013_1013563323300014492BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATEGCSTKSVTRTNDSGDTETHTKTNC*
Ga0182013_1018683733300014492BogMVDAHTEGMIMSLRQLIGCSAATLVGAGVILASVATTQAVTLPVSRHAISNVQHVDCAVGAHIGPLGACIIGNDDSPPVVVEHRVVGAPDPQAADGCATKSVTRTDSSGDSETHAKTNC*
Ga0182016_10009135103300014493BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATDGCSTKSVTRTNDSGDTETHTKTDC*
Ga0182015_1077539123300014495PalsaAAALVGAGAMFASVVSTQATMLPASRYATPYVQHVDCAVGAHLGPLGACIVGNDDNGAPAMVEHRSADVPDQRDTNGCASKSVTRTDDTGNSETKTKTNC*
Ga0182019_1022754513300014498FenMVDAHSEGMIMSLRQLIGCSAAALVGAGAMLASVASTQASMIQVSRHATPLVQHVDCAIGAHIGPLGACIIGNNDNPPVVVERPVVDAPAPQANDGCSTKSVTRTNGNGDSETHTSTNC*
Ga0182019_1032321323300014498FenVISDASLPISLSAECERIIDASPSIDDAHTEGMTMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQATDGCSTKSVTRTDQNGGSETHTKTNC*
Ga0182019_1040410223300014498FenMSLHQLIGCSAAALVGAGAMLASATATQATMLPVSHYATPYVHHVDCAVGAHIGPLGACILGNDDNPPVVVEHRVVDGPAPQDADGCSTKSVTRTDGMGNTETHTKSNC*
Ga0182024_1079508623300014501PermafrostMSLRQLIGCSAAALVGAGAMLASVASTRATMLPVSRYATPYVQHVDCAIGAHIGPLGGCILGTDDPRPVVVEPRDANAPGCETKSVTKTDAAGDSETKSKSNC*
Ga0182021_1013485023300014502FenMTSRQLIGSWAAALVGAGAMLASVATTQATMLPVSRYATPDVQYVDCAIGAHIGPLGACILAHDDNRPVEVQRRIIDAPDPQSADGCSTKSVVRTDGNGDSETHAKTNC*
Ga0182021_1169611913300014502FenMFLHRLIGCSAAALVGAGAMLASVAATQATMLPVSRYATPYVQHVDCAVGAHIGPLGACILGNDDNAPVVVEPRAVDAPNPQGADGCATKSVTRTDAEGNSETKTKTNCPP*
Ga0181522_1000398313300014657BogMSSRQWIGGFGAALVGAGAILASASATQATMLPASRFATPYVQPVNCAIGAHIGPLGACIIGHDDNPPVVVEHRVVNAPDAQGGDGCSTRSVT
Ga0181522_1012232643300014657BogPSIVDAHTEGMIMSLRQLIGCSAAALVGAGAVLASAATTQAAMLPVSRLATPYVQYVECAIGAHIGPLGACIIGDDDNQPVVVEHRVVNAPDPQAADGCSTKSVTRTDATGDSETHTKTNC*
Ga0181522_1081592613300014657BogMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDSSGDSETRTKTNC*
Ga0181522_1091931513300014657BogMSLNQLVGFSVIALAGAGALLVFVATPQAMTLPVSGYATPEVQNVECAIGAHIGPLGGCILGHDDNPPMPVPVERRAVDAPDSQSADGCSSKSVTKTDGMGNTETKTKTNC*
Ga0181519_1002188353300014658BogMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDGSGDSETHTRTNC*
Ga0182027_1029221943300014839FenMFTILASVGATQATMLPVSRYATPDVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAADGCSTKSVTRTDGNGGSETQTKTNC*
Ga0182027_1115255813300014839FenMSLHRLIGCSAAALVGAGAMLASVAATQATMLPVSRYATPDVQHVDCAVGAHIGPLGACILGNDDNAPIVVEPRAVDAPTPQGADCCATKSVTRTDAEGNSETKTKTNCPP*
Ga0182027_1136889023300014839FenMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAADGCSTKSVTRTDGSGASET
Ga0187847_1013556923300017948PeatlandMIMSSRQLIGGFMAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0181520_10004714103300017988BogMSSRQLIGGFAAALVGAGAMLASVGATQATMLPATHYATPDVQRVDCAIGAHIGPLGGCIIGRDDNPPVVVEHRVIDSPDPRATDGCSTKSVTRTDASGDSETHTKTNC
Ga0181520_1001565153300017988BogMSSRQLIGGFVAALVGAGAILASVGATQATMLPASHYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQATNGCSTKSVTRTDSGGDSETHTKTNC
Ga0181520_1001991353300017988BogMSSRQLIGGFAAALLGAGAMLASVGATQATMLPASHYATPDVQHVDCAIGAHIGPLGGCILGHDDNPPVVVEHRVVDSPDPQAADGCSTKSVTRTDASGDSETHTKTNC
Ga0181520_1003784043300017988BogMSSRQLIGGLTAALVGAGAMLASVAATQATMLPVSRYATPDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQAANGCSTKSVTRTDASGDSETRTKTNC
Ga0181520_1007330343300017988BogMSSRHFIGCFAAALVGAGATLASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDTPDPQAVDGCSTKTVTRTDGNGDSETHTKTNC
Ga0181520_1010638943300017988BogMSLRQLIGCSAAALVGAGAVLASAATTQAAMLPVSRLATPYVQYVECAIGAHIGPLGACIIGNDDNPPVVVEHRVVNAPDPQAADGCSTKSVTRTDATGDSETHTKTNC
Ga0181520_1013869823300017988BogMSSRQLIGGFATALVGAGAILASVGATQATMLPVSRYATPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCSTKSVTRTDSSGDSETHTKTNC
Ga0181520_1079773913300017988BogMSSRQLIGGFAAALVGAGAMLASVALTQAMMLPASRYATPYVQHVDCAVGAHLGPLGACVIGHDDTPPVVVEHRVVDGPDPQAPDGCATKSVTTTDGNGDT
Ga0187865_129322613300018004PeatlandLSPSIVDAHTEGMIMSSRQLIGCSAAALVGAGAMLASVGATQATMLPATHYAAPYVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQAADGCSTKSVTRTDGNGDSETHTKTNC
Ga0187863_1072154513300018034PeatlandMSSRQLIGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0187875_1024326013300018035PeatlandMIMSSRQLIGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0187883_1024176823300018037PeatlandMIMSSRQLIGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKT
Ga0187855_1024440113300018038PeatlandVISDASLPIPLGAECARIVDASPSINDAHTEGMIMSSRQLIGGFMAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
(restricted) Ga0224519_102651523300023060SoilMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATDGCSTKSVTRTNDSGDTETHTKTDC
Ga0224558_110815743300023090SoilQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPIVVEHRVIDAPDLQAADGCSTKSVTRTDGSGASETHTKTNC
Ga0224559_103910433300023091SoilMSSRQLIGGFAAALLGAGAMLASVAPTQATMLPTSHYATPYVQHVDCAIGAHIGPLGGCIIGHDDNPPVVVEHRVIDSPDPQAADGCSTKSVTRTDDSGASETHTKTNC
Ga0224559_122082813300023091SoilHTEGMTMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYARPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDLQAADGCSTKSVTRTDQNGGSETHTKTNC
Ga0256681_1161600223300023311FreshwaterAAALVGAGALLASVATTQATMLPVSRYATPDVQYVDCAIGAHIGPLGACILGHDDNPPVGVQRRVIDAPDPQSADGCSTKSVVRTDGNGDSETHIETNC
Ga0209385_120638913300025650Arctic Peat SoilVISDASLPISLSAECERIIDASPSIDDAHTEGMIMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQATDGCSTKSVTRTDQNGGSETHTK
Ga0209585_1030933213300025891Arctic Peat SoilMSSRQLIGGFAAALVGAGAILASVGATQATMLPVSHYATPYVQHVDCAVGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDLQAADGCSTKSVTRTDGSGASETHSKTNC
Ga0247847_104132323300026450SoilMSSRHLIGYCAAALVGAGAMLASAASTQAMMFPASRHAAPYVRHIDCAIGAHIGPLGACIIGNDDNPPVVVEHRAPDSPDSGTANGCSTKS
Ga0247847_104731313300026450SoilSDASLPISLRAECRRIIHASPSIVDAHTEGMIMSSRQLTGGFTAALVGAGAMLASVVATQATMLPASRYATPYLQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0255349_105559523300028090SoilMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATEGCSTKSVTRTNDSGDTETHTK
Ga0255348_100704713300028268SoilVRSSNASLPPSPSMVDAHTEGMIMSLRQLIGCSAATLVGAGVILASVATTQAVTLPVSRHAISNVQHVDCAVGAHIGPLGACIIGNDDSPPVVVEHRVVGAPDPQAADGCATKSVTRTDSSGDSETHAKTNC
Ga0302267_1008033333300028745BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATEGCSTKSVTRTNDSGDTETHTKTDC
Ga0302202_1008039813300028762BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATEGCSTKSVTRTNDSGDTETHTKTNC
Ga0302202_1017787023300028762BogMSSRQLIGCLAAALVGAGAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0302202_1020095813300028762BogMSSRQLTGGFTAALVGAGAMLASVVATQATMLPASRYATPYLQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0302201_1043293513300028785BogCGRIIDASPSIVDAHTEGRIMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0302154_1030546523300028882BogMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATK
Ga0302154_1032469313300028882BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATDGCSTKSVTRTNDSGDTETHTKTNC
Ga0311327_1048649123300029883BogMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRT
Ga0311329_1024830713300029907BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATDGCSTKSVTRTNDSGDTETHTKT
Ga0311329_1083121113300029907BogMTFHQLVGGSTAALIGVGAMLASVGGAQAAMLPPSRVATAYVQNVDCAVGAHLGPLGACILGNDDPPPVVVEHRAVEAPVPANPDGCATKSVTRTDGAGNSETHTQTNC
Ga0311361_1033298623300029911BogMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0311358_1067518513300029915BogMSSRQLTGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTR
Ga0311363_1025616233300029922FenRIMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0311352_1058641023300029944PalsaMALHRLIGYSAAAILGVGTMFTSVIPTQATMFPLVRYAAPYVQHVDCAVGAHIGPLGGCILGTDDSRPAVVEHPDNANPGCETKSVTRTDASGNSETKTKTNC
Ga0311337_1058631813300030000FenMSLRQLIGCSTAALVGAGAMLASVATTQATMLPVSRYATPDVQYVDCAIGAHIGPLGACILAHDDNRPVEVQRRIIDAPDPQSADGCSTKSVVRTDGNGDSETHVGTNC
Ga0302282_135322713300030045FenMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATDGCSTK
Ga0302196_1035461213300030225BogGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0265777_11828623300030877SoilWRFASAVVGAQTEGNVMSSHHLIGCSIAALVGAGALFASVAGAQAVMPPVSHYATPAVQYVDCAVGAHIGPLGACVLGRDDNPPVVVERNPPVVVEHRVVDAPDPQRADGCATKSVTKTDGTGDSETKTKTNC
Ga0074013_1163684413300030907SoilMTLHQFVGYSAATLLGAGTMLTSVLPTQAAMFPLVRYSAPYVQHVDCALGAHIGPLGGCILGTDDPRPVVVEHPDNAPNAGCETKSVTRTDASGNTETKTKSNC
Ga0302323_10271811413300031232FenMEGMLMSLRQLIGCSAAALVGAGAILASVTATQAVTLPVTRHAASNVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAADGCSTKSVTRTDSSG
Ga0265330_1001179833300031235RhizosphereMSSRQLIGGFTAALLGAGAILASAGATQATMLPASRFATPYVQSVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVITAPDPQGGDGCSTKSVTRTDGNGDSETHTQTNC
Ga0265330_1002219323300031235RhizosphereMSLRQLIGRSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNSQSSDGCSTKSVTKTDGTGDTETHTKTNC
Ga0265330_1002499533300031235RhizosphereMSSRQLIGCFAAALVGAGAMLASVGATQATMLPAPHYAAPSVQYVDCAIGAHLGPLGACIIGHDDNPPVVVEHRVIDAPDPQAVDGCATKSVTRTDGSGASETQTKTNC
Ga0265330_1003580833300031235RhizosphereMSLRQLIGCSAAALVGAGAILASVTATQAVTLPVTRHATSNVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAADGCSTKSVTRTDSSGDSETHTKTNC
Ga0265330_1030205613300031235RhizosphereMSSRQLIGCFAAALVGAGAVVASGGATQATMLPVTHYATPDLVEVDCAIGAHIGPLGACIIGHDDNPPVVVERRVIDSPDPQAADGCSTKSVTRTDGSGASETQTKTNC
Ga0265328_1002547133300031239RhizosphereMSSRQLIDCFAAALVGAGAMLASVGATQAAMLPAPHYAAPTVQYVDCAIGAHLGPLGACIIGHDDNPPAVMEHRVIDAPDPQAVDGCATKSVTRTDGSGASETQTKTNC
Ga0265328_1022069613300031239RhizosphereMSSRQLIGGFAAAFVGAGAILASVGATQATMLPVSRYASPYVQQVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQAADGCSTQSVTKTDGSGDSETH
Ga0265328_1029610623300031239RhizosphereMSLRQLIGCSAAALIGAGAILASVTATQAVTLPVTRLAASNVQYVDCAIGAHIGPLGACIIGTDDNPPVVVEHRVVDAPDPQAADGCSTKSVTRTDSSGDSETHTKTNC
Ga0265325_1000235753300031241RhizosphereMSSRQLIGCFAAALVGAGAMLASVGAAQATMLPAPHYAAPSVQYVDCAIGAHLGPLGACIIGHDDNPPVVVEHRVIDAPDPQAVDGCATKSVTRTDGSGASETQTKTNC
Ga0265325_1001155283300031241RhizosphereVISEASLRTSLSAEFERITLPFPSMVDAHSEGMIMSLRQLIGCSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNSQSSDGCSTKSVTKTDGTGDTETHTKTNC
Ga0265325_1020495923300031241RhizosphereMSSHQLIGCSVAALVGVGAMLASVASTQASMIQASRHATPFVQHVDCAIGAHLGPLGACIIGHDDNPPVVVEHRVVDAPGPQGADGCATTSVTRTDGTGDTETHTKTNC
Ga0265325_1025246113300031241RhizosphereSAAALVGAGAILASVTATQAVTLPVTRHATSNVQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAADGCATKSVTRTDSSGDSETRTKTNC
Ga0265325_1034635213300031241RhizosphereMIMSSRQLIGGFTAALLGAGAILASAGATQATMLPASRFATPYVQSVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVITAPDPQGGDGCSTKSVTRTDGNGDSETHTQTNC
Ga0265329_1012237213300031242RhizosphereMSSRQLIGCFAAALVGTGAVLASVGTTQATMFPVSHYATPDLVQVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVTDSPDPQAADGCSTKSVTRTDGSGA
Ga0265339_1000924343300031249RhizosphereMVDAHSEGMIMSLRQLIGCSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNSQSSDGCSTKSVTKTDGTGDTETHTKTNC
Ga0265339_1005447233300031249RhizosphereMSSRQLIGGFAAAFVGAGAILASVGATQATMLPVSRYASPYVQQVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDAPDPQAADGCSTQSVTKTDGSGDSETHTRTNC
Ga0265339_1044814413300031249RhizosphereMSLRQLIGGSAVAFVGAAALLASVAATQAVTLPVTHYPSPPVRQVDCAVGAHIGPLGACILGNEDNPPVVVEHRVIDGADPQAADGCSTKSVTRTDPSGVSETRTKTNC
Ga0265331_1016428923300031250RhizosphereMSSRQLIGCFAAALVGAGAMLASVGAAQATMLPAPHYAAPSVQYVDCAIGAHLGPLGACIIGHDDNPPAVMEHRVIDAPDPQAVDGCATKSVTRTDGSGASETQTKTNC
Ga0302140_1026704223300031261BogMSSRQLIGCLAAALVGASAMLASVATTQATMLPVSRYATHDVQPVDCAIGAHIGPLGACIVGHDDNPPVVVEHRVIDAPNPQAADGCATKSVTRTDASGDSETRTKTNC
Ga0265316_1024115513300031344RhizosphereMSLRQLIGCSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNSQSSDGCSTKSVTKTDGTGDTETHTKTNC
Ga0265316_1033186433300031344RhizosphereMSSRQLIDCFAAALVGAGAMLASVGATQAAMLPAPHYAAPTVQYVDCAIGAHLGPLGACIIGHDDNPPAVMEHRVIDAPDPQAVDGCATKSVTRTDGSGASETQT
Ga0265316_1112752823300031344RhizosphereDAHTEGMLMSLRQLIGCSAAALVGAGAILASVTATQAVTLPVARHPTANIQHVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDAPDPQAADGCATKSVTRTDSSGDSETHTKTNC
Ga0302320_1160477813300031524BogVISEASLRTSLSAEFERITLPFPSMVDAHSEGMIMSLRQLIGCSAAALVGTGALLASVATSQAAMLPVSHLATPYVQYVDCAIGAHVGPLGACIIGSDDSPPVVVEHRVDAPNS
Ga0265314_1008672843300031711RhizosphereMSSRQLIDCFAAALVGAGAMLASVGATQAAMLPAPHYAAPTVQYVDCAIGAHLGPLGACIIGHDDNPPAVVEHRVIDAPDPQAVDGCATKSVTRTDGSGVS
Ga0265314_1035716423300031711RhizosphereVTLMSLRQLIGGSAVAFVGAAALLASVAATQAVTLPVTHYPSPPVRQVDCAVGAHIGPLGACILGNEDNPPVVVEHRVIDGADPQAADGCSTKSVTRTDPSGVSETRTKTNC
Ga0302319_1006212633300031788BogMSSRQLIGGVAAALVGAGAMLASVGATQATMLPAPHYAAPSVQYVDCAIGAHLGPLGACIIGHDDNPPVVVEHRVVDAPDPQAVDGCATKSVTRTDGSGASETQTKTNC
Ga0302319_1038168623300031788BogMSSRQLIGGLAAALVGAGAILASVAATPATMFPASQFATPEVQRVDCAVGAHIGPLGACIIGQDDNRPVVVEHRVTDSPGPQATEGCSTKSV
Ga0348332_1280267713300032515Plant LitterRFASAVVGAQTEGNVMSSHHLIGCSIAALVGAGALFASVAGAQAVMPPVSHYATPAVQYVDCAVGAHIGPLGACVLGRDDNPPVVVERNPPVVVEHRVVDAPDPQRADGCATKSVTKTDGTGDSETKTKTNC
Ga0316232_109642513300032605FreshwaterMSLRQLIGCSAAALVGAGAILASVTATQAVTLPATRHATSNVQHVDCAIGAHIGPLGACIIGHDDNPPVVIEHRVVDAPDPQAADGCSTKSVTRTDSSGDSETHIKTNC
Ga0326728_1098856813300033402Peat SoilMFSRQLIGCFAVALVGAGALLASVAATQATMFPVSRYATPYVQHVDCAIGAHIGPLGACIFGHDDNPPVVVEHRVIDAPDPQAADGCSTKSVTRTDGNGDSETHTKTNC
Ga0334828_036657_70_4053300033822SoilMIMSSRQLTGGFTAALVGAGAMLASVVATQATMLPASRYATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVIDSPDPQSTDGCSTKSVTRTDASGDSETRTKTNC
Ga0370501_0185779_157_4863300034195Untreated Peat SoilMSSRQWIGCLAAALVGAGAILASVGATQATMLPASRFATPYVQPVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVNGPDPQGGDGCSAKSVTRTDGNGDSETHTQTNC
Ga0370501_0351539_207_5363300034195Untreated Peat SoilMSLRQLIGFSAAALVGAGAILASIATTQAVTLPVTRHATPNVQQVDCAIGAHIGPLGACIIGHDDNPPVVVEHRVVDSPDPQAADGCATKSVTRTDSNGDSETHAKTNC
Ga0370492_0038719_574_9603300034282Untreated Peat SoilLTRIIRTSIPANVDAHTEGKTMSLHQLIGCSAAAIVGAGALFATATGAQATMLPASHYATSYVQHVDCALGAHIGPLGACIIGVDDNPPVVVEHRTADAPQGGDGCSTKSVTRTDGAGNTETHTNSNC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.