


| Basic Information | |
|---|---|
| Family ID | F064546 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DPDIRKEFEAALAREGVASRMNPEFYQRPPAEGEVVMGDVM |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 94.53 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.469 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.656 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01717 | Meth_synt_2 | 28.12 |
| PF00691 | OmpA | 10.94 |
| PF01977 | UbiD | 6.25 |
| PF03401 | TctC | 5.47 |
| PF02518 | HATPase_c | 1.56 |
| PF09585 | Lin0512_fam | 1.56 |
| PF05685 | Uma2 | 1.56 |
| PF00072 | Response_reg | 0.78 |
| PF13561 | adh_short_C2 | 0.78 |
| PF13432 | TPR_16 | 0.78 |
| PF04055 | Radical_SAM | 0.78 |
| PF12705 | PDDEXK_1 | 0.78 |
| PF05899 | Cupin_3 | 0.78 |
| PF02371 | Transposase_20 | 0.78 |
| PF07724 | AAA_2 | 0.78 |
| PF01315 | Ald_Xan_dh_C | 0.78 |
| PF00528 | BPD_transp_1 | 0.78 |
| PF01075 | Glyco_transf_9 | 0.78 |
| PF05150 | Legionella_OMP | 0.78 |
| PF04909 | Amidohydro_2 | 0.78 |
| PF01208 | URO-D | 0.78 |
| PF07883 | Cupin_2 | 0.78 |
| PF00881 | Nitroreductase | 0.78 |
| PF07730 | HisKA_3 | 0.78 |
| PF10431 | ClpB_D2-small | 0.78 |
| PF02653 | BPD_transp_2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 28.12 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 6.25 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.47 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.56 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.78 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.78 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.78 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.78 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.25 % |
| Unclassified | root | N/A | 18.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078001|ZMR_F548DK202GRL3Y | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300001661|JGI12053J15887_10590831 | Not Available | 528 | Open in IMG/M |
| 3300005363|Ga0008090_10113445 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005435|Ga0070714_101881814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005542|Ga0070732_10415958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300005712|Ga0070764_10859297 | Not Available | 567 | Open in IMG/M |
| 3300005764|Ga0066903_100085347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4154 | Open in IMG/M |
| 3300005764|Ga0066903_100703521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1782 | Open in IMG/M |
| 3300005764|Ga0066903_108229683 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006052|Ga0075029_101329693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300006162|Ga0075030_100368237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300006796|Ga0066665_11462562 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006853|Ga0075420_101368392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300006865|Ga0073934_10702794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300007076|Ga0075435_100610570 | Not Available | 946 | Open in IMG/M |
| 3300009038|Ga0099829_11668606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300009088|Ga0099830_10584128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300009090|Ga0099827_10252601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1482 | Open in IMG/M |
| 3300009100|Ga0075418_11948051 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009137|Ga0066709_100362676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1996 | Open in IMG/M |
| 3300009147|Ga0114129_12037430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 693 | Open in IMG/M |
| 3300009792|Ga0126374_11083952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300009792|Ga0126374_11312080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300010045|Ga0126311_10085875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2126 | Open in IMG/M |
| 3300010359|Ga0126376_10804696 | Not Available | 918 | Open in IMG/M |
| 3300010359|Ga0126376_11722338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 662 | Open in IMG/M |
| 3300010360|Ga0126372_11236785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300010362|Ga0126377_11210030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 826 | Open in IMG/M |
| 3300010362|Ga0126377_11489896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300010362|Ga0126377_13383539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300010362|Ga0126377_13618566 | Not Available | 500 | Open in IMG/M |
| 3300010366|Ga0126379_10383218 | Not Available | 1448 | Open in IMG/M |
| 3300010366|Ga0126379_12197410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300010376|Ga0126381_102337803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300010376|Ga0126381_102948773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300010398|Ga0126383_11882031 | Not Available | 686 | Open in IMG/M |
| 3300010398|Ga0126383_12105953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300010401|Ga0134121_11204604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300010403|Ga0134123_11757153 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300011120|Ga0150983_15872468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1694 | Open in IMG/M |
| 3300012189|Ga0137388_10835818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300012189|Ga0137388_11734230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300012199|Ga0137383_10758361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 708 | Open in IMG/M |
| 3300012205|Ga0137362_10802941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300012208|Ga0137376_11206840 | Not Available | 646 | Open in IMG/M |
| 3300012212|Ga0150985_117773192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300012361|Ga0137360_11728205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012392|Ga0134043_1284407 | Not Available | 521 | Open in IMG/M |
| 3300012931|Ga0153915_12952738 | Not Available | 554 | Open in IMG/M |
| 3300012951|Ga0164300_10249598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300012971|Ga0126369_10419981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1380 | Open in IMG/M |
| 3300012971|Ga0126369_12122671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 649 | Open in IMG/M |
| 3300012989|Ga0164305_11154586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300014166|Ga0134079_10417231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300014168|Ga0181534_10795503 | Not Available | 559 | Open in IMG/M |
| 3300014200|Ga0181526_10108766 | Not Available | 1773 | Open in IMG/M |
| 3300014325|Ga0163163_13309338 | Not Available | 502 | Open in IMG/M |
| 3300015242|Ga0137412_11058516 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300015245|Ga0137409_10378500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
| 3300015245|Ga0137409_11490491 | Not Available | 524 | Open in IMG/M |
| 3300015264|Ga0137403_10965945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300016270|Ga0182036_11698753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 533 | Open in IMG/M |
| 3300016357|Ga0182032_10884370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300017965|Ga0190266_10545226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300018062|Ga0187784_10412698 | Not Available | 1091 | Open in IMG/M |
| 3300018422|Ga0190265_11350216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 829 | Open in IMG/M |
| 3300020016|Ga0193696_1062455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 976 | Open in IMG/M |
| 3300020583|Ga0210401_10648650 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300021377|Ga0213874_10231611 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021401|Ga0210393_10902493 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021402|Ga0210385_10335022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
| 3300021402|Ga0210385_10726810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctwzt2 | 760 | Open in IMG/M |
| 3300021420|Ga0210394_10817066 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300021420|Ga0210394_11218607 | Not Available | 646 | Open in IMG/M |
| 3300021479|Ga0210410_10483916 | Not Available | 1106 | Open in IMG/M |
| 3300024347|Ga0179591_1076023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2903 | Open in IMG/M |
| 3300025457|Ga0208850_1078813 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025862|Ga0209483_1166503 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025927|Ga0207687_11804059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300025929|Ga0207664_11526553 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025936|Ga0207670_10686209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300026067|Ga0207678_10399888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300026088|Ga0207641_11966143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300027663|Ga0208990_1089155 | Not Available | 868 | Open in IMG/M |
| 3300027671|Ga0209588_1179996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300027748|Ga0209689_1156030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300027882|Ga0209590_10267103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1094 | Open in IMG/M |
| 3300027895|Ga0209624_10850704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 597 | Open in IMG/M |
| 3300027903|Ga0209488_10067217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2654 | Open in IMG/M |
| 3300027903|Ga0209488_10200018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1505 | Open in IMG/M |
| 3300027961|Ga0209853_1148835 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028771|Ga0307320_10061954 | Not Available | 1391 | Open in IMG/M |
| 3300028791|Ga0307290_10023788 | Not Available | 2148 | Open in IMG/M |
| 3300028796|Ga0307287_10060753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1400 | Open in IMG/M |
| 3300028884|Ga0307308_10404544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 654 | Open in IMG/M |
| 3300028906|Ga0308309_10821305 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300030990|Ga0308178_1078171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 668 | Open in IMG/M |
| 3300031198|Ga0307500_10076626 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031562|Ga0310886_11061407 | Not Available | 521 | Open in IMG/M |
| 3300031572|Ga0318515_10285749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300031573|Ga0310915_10255064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300031668|Ga0318542_10364923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300031708|Ga0310686_108637621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300031724|Ga0318500_10266629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300031736|Ga0318501_10540034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031751|Ga0318494_10530354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300031769|Ga0318526_10380585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031771|Ga0318546_10542020 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031780|Ga0318508_1211142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031781|Ga0318547_10080700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1821 | Open in IMG/M |
| 3300031797|Ga0318550_10148754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300031832|Ga0318499_10147742 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300031890|Ga0306925_11685812 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031893|Ga0318536_10009792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4062 | Open in IMG/M |
| 3300031893|Ga0318536_10700156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300031894|Ga0318522_10018951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2207 | Open in IMG/M |
| 3300031896|Ga0318551_10900154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031912|Ga0306921_11832805 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031945|Ga0310913_10288768 | Not Available | 1156 | Open in IMG/M |
| 3300031954|Ga0306926_11318864 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300031981|Ga0318531_10562475 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032013|Ga0310906_10523290 | Not Available | 806 | Open in IMG/M |
| 3300032043|Ga0318556_10512155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300032060|Ga0318505_10608358 | Not Available | 514 | Open in IMG/M |
| 3300032068|Ga0318553_10699180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300032160|Ga0311301_11782569 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032892|Ga0335081_10654679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300034680|Ga0370541_030270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.34% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere | 0.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078001 | Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Host-Associated | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ZMR_661580 | 2044078001 | Switchgrass, Maize And Miscanthus Rhizosphere | VATQSPYHMEDPAIRREFEAELGREGVASRMNPAWYERAPTEGEDLPPNM |
| JGI12053J15887_105908311 | 3300001661 | Forest Soil | EDPAVRKEFEEALKREGVASRMNREFYQRPPAEGEAVMDDVM* |
| Ga0008090_101134451 | 3300005363 | Tropical Rainforest Soil | EDPAIRTEFEAALAREGVASRMNPEFYQRPPAAGETVMGDVM* |
| Ga0070714_1018818141 | 3300005435 | Agricultural Soil | YHQEDPAIRREFSEALAREGVASRMNPEFYERPPGEGEEVMGDVM* |
| Ga0070732_104159581 | 3300005542 | Surface Soil | DPFIRQEFSETLKREGLANRMNPEFYDRPPAEGEVVIGDVM* |
| Ga0070764_108592972 | 3300005712 | Soil | IRQEFEAILKREGLPSRMNPEFYERPPGEGEVVMGDVM* |
| Ga0066903_1000853476 | 3300005764 | Tropical Forest Soil | EFAQALAREGVASRMNPEFYQRPPGAGEEVMGDVM* |
| Ga0066903_1007035213 | 3300005764 | Tropical Forest Soil | PYHQEDPAIRKEFQAALAKEGVKSRMNPEFYERPPAEGEVVMGDVM* |
| Ga0066903_1082296832 | 3300005764 | Tropical Forest Soil | SAIPYHQEDPAIRTEFEAALAREGVASRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0075029_1013296931 | 3300006052 | Watersheds | IPYHQEDPAIRQEFAETLAREGVASRMNPEFYERPPGEGEEVMGDVM* |
| Ga0075030_1003682373 | 3300006162 | Watersheds | HQEDPAIRQEFGQALARAGVASRMNPEFYQRPPGEGEEVMGDVM* |
| Ga0066665_114625621 | 3300006796 | Soil | IPYHQEDPAIRKEFEQALKREGVASRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0075420_1013683922 | 3300006853 | Populus Rhizosphere | MEDPAIRAEFDATLRREGMTSRMKEAWYERPPTEGEDLPPNM* |
| Ga0073934_107027942 | 3300006865 | Hot Spring Sediment | FEERLAREGVKSRMNPEFYERPPAEGETVMGDVM* |
| Ga0075435_1006105703 | 3300007076 | Populus Rhizosphere | FTEALNREGVACRMNPEFYERPPAEGEVVMGDVM* |
| Ga0099829_116686062 | 3300009038 | Vadose Zone Soil | AIPYHQEDPAIRAEFEQALRREGVASRMNPEFYQRPAAEGEVVMGDVM* |
| Ga0099830_105841281 | 3300009088 | Vadose Zone Soil | AIPYHEEDLAIRREFEGALACEGLVSRMKPEFYQRPPAEGEMVMGDVM* |
| Ga0099827_102526011 | 3300009090 | Vadose Zone Soil | SAIPYHQEDPAIRKEFEEALKREGVASRMNAEFYQRPPAEGEVVMGDVM* |
| Ga0075418_119480512 | 3300009100 | Populus Rhizosphere | FEERLAREGVKSRMNPEFYERPPGEGEVVMGDVM* |
| Ga0066709_1003626761 | 3300009137 | Grasslands Soil | QEDPAIRTKFQKAPAREGVANRKNQEIYQRPPPEGEVVVGDVM* |
| Ga0114129_120374302 | 3300009147 | Populus Rhizosphere | HQEDPYIRQEFTEALKREGVACRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126374_110839521 | 3300009792 | Tropical Forest Soil | SAIPYHQEDPAIRTEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM* |
| Ga0126374_113120801 | 3300009792 | Tropical Forest Soil | QEDPAIRKEFEQALAREGVASRMNPEFYERPPGEGEVVMGDVM* |
| Ga0126311_100858751 | 3300010045 | Serpentine Soil | HLEDPAVRAEYEERLKREGVTPRMNPEFYKRPPGEGEEVVGDVM* |
| Ga0126376_108046962 | 3300010359 | Tropical Forest Soil | FIEALKREGIDCRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126376_117223382 | 3300010359 | Tropical Forest Soil | PYHQEDPAIRKEFQEALKKEGIESRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126372_112367851 | 3300010360 | Tropical Forest Soil | AIPYHQEDPAIRAEFQAALAREGVASRMNPEFYERPQGEGEVVIGDVM* |
| Ga0126377_112100301 | 3300010362 | Tropical Forest Soil | HMEDPAIRKEFEATLAREGVASRMNPAFYERPPAEGEEVPPDM* |
| Ga0126377_114898961 | 3300010362 | Tropical Forest Soil | IRKEFTEALKREGIECRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126377_133835392 | 3300010362 | Tropical Forest Soil | KEFIEALKREGIDCRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126377_136185662 | 3300010362 | Tropical Forest Soil | HQEDPYIRKEFIEALKREGIECRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126379_103832181 | 3300010366 | Tropical Forest Soil | SAIPYHQEDPAIREEFVQALAREGVAGRMNPEFYERPPQEGEVVMGDVM* |
| Ga0126379_121974101 | 3300010366 | Tropical Forest Soil | IRTEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM* |
| Ga0126381_1023378031 | 3300010376 | Tropical Forest Soil | RTEFEAALAREGVASRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0126381_1029487731 | 3300010376 | Tropical Forest Soil | DPAIRTEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM* |
| Ga0126383_118820312 | 3300010398 | Tropical Forest Soil | KEYEATLKREGVVSRMNPEFYERPPAEGEVVMGDVM* |
| Ga0126383_121059531 | 3300010398 | Tropical Forest Soil | AIRTEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM* |
| Ga0134121_112046041 | 3300010401 | Terrestrial Soil | IEQALAKEGVATRMNAEFYERPPADGEVVMGDVM* |
| Ga0134123_117571531 | 3300010403 | Terrestrial Soil | IRQEFTEALKKEGVAGRMNPEFYERPPAEGEVVLGDVM* |
| Ga0150983_158724683 | 3300011120 | Forest Soil | QEFEATLTREGLPSRMNAEFYARPPNEGEVVMGDVM* |
| Ga0137388_108358182 | 3300012189 | Vadose Zone Soil | RAEFEQALKREGVASRMNPEFYQRPAAEGEVVMGDVM* |
| Ga0137388_117342301 | 3300012189 | Vadose Zone Soil | EFEEALKREGVASRMNAEFYQRPPAEGEVVMGDVM* |
| Ga0137383_107583612 | 3300012199 | Vadose Zone Soil | DPNIRKEFSEVLKKGGIASRMNPEFYERPPAGGEVVMGDVM* |
| Ga0137362_108029412 | 3300012205 | Vadose Zone Soil | AIPYHQEDPAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0137376_112068401 | 3300012208 | Vadose Zone Soil | EEFTATLAKEGVQNRMNPEFYERPPADGEDVMGDVM* |
| Ga0150985_1177731922 | 3300012212 | Avena Fatua Rhizosphere | FEETLAREGVKSRMNPEFYERPPAEGEAVMGDVM* |
| Ga0137360_117282052 | 3300012361 | Vadose Zone Soil | FEAALARQSVVSRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0134043_12844071 | 3300012392 | Grasslands Soil | AIRLEFDQTVAQEGVKSRMNPVFYERPPAAGEEVPADM* |
| Ga0153915_129527382 | 3300012931 | Freshwater Wetlands | AIPYHQEDPAIRKEFFEALAREGVPSRMNPEFYERPPGEGDEVMGDVM* |
| Ga0164300_102495982 | 3300012951 | Soil | DPAIRKEFEAALAREGVAGRMNPEFYQRPPAGGEVVMGDVM* |
| Ga0126369_104199812 | 3300012971 | Tropical Forest Soil | DPDIRKEFEAALAREGVASRMNPEFYQRPPAEGEVVMGDVM* |
| Ga0126369_121226711 | 3300012971 | Tropical Forest Soil | NEFIEALKREGIACRMNPEFYERPPAEGEVVMGDVM* |
| Ga0164305_111545862 | 3300012989 | Soil | YHQEDPAIRTEFEAALAREGVAGRMNQEFYQRPPAEGDVVMGDVM* |
| Ga0134079_104172312 | 3300014166 | Grasslands Soil | EFQEALAREGVASRMNKEFYERPPGEGEVVMGDVM* |
| Ga0181534_107955031 | 3300014168 | Bog | EDPAIRAEFERRLKAEGVASRMNPDFYVGPPAEGAEVPGDAF* |
| Ga0181526_101087661 | 3300014200 | Bog | QEFEAILKREGLSSRMNPEFYERPPSEGEVVMGDVM* |
| Ga0163163_133093382 | 3300014325 | Switchgrass Rhizosphere | AIRREFEATLALEGVASRMNPAFYERPPADGEDVPPDM* |
| Ga0137412_110585161 | 3300015242 | Vadose Zone Soil | IPYHQEDPAIRQEFGEALKSEGVPSRMNPEFYQRPPGEGEDVMGDVM* |
| Ga0137409_103785001 | 3300015245 | Vadose Zone Soil | NAIPYHMEDPAIRLEFEQTVAQEGVKSRMNPVFYERPPTVGEEIPADM* |
| Ga0137409_114904911 | 3300015245 | Vadose Zone Soil | HQEDPAIRQEFEATLKREGLPSRMNPEFYARPPGEGDVVMGDVM* |
| Ga0137403_109659452 | 3300015264 | Vadose Zone Soil | IPYHQEDPAIRAEFQAALAREGVASRMNPEFYQRPPGEGEVVMGDVM* |
| Ga0182036_116987531 | 3300016270 | Soil | SAIRKEFEAALAPEGVASRMNPEFYQRPPAEGEEVMGDVM |
| Ga0182032_108843702 | 3300016357 | Soil | PYHQEDPAIRTEFEAALAREGVASRMNPEFYQRPPAEGEEVMGDVM |
| Ga0190266_105452261 | 3300017965 | Soil | PAIRKQFEERLAREGVTSRMNPEFYERPPADGEAVLGDVM |
| Ga0187784_104126981 | 3300018062 | Tropical Peatland | QEDPAIRTEFEATLEREGLPSRMNPEFYERPPNEGEVVMGDVM |
| Ga0190265_113502161 | 3300018422 | Soil | HQEDPAIRAQFTERLAREGVKSRMNPEFYDRPPTEGEAVMGDVM |
| Ga0193696_10624551 | 3300020016 | Soil | EFEEALKREGVASRMNLEFYQRPLAEGEAVMDDVM |
| Ga0210401_106486501 | 3300020583 | Soil | YHQEDPAIRQEFEATLKREGLPSRMNPEFYERPPGEGEVVMGDVM |
| Ga0213874_102316112 | 3300021377 | Plant Roots | DPAIREEFAQALAHEGVASRMNPEFYERPPGEGEEVMGDVM |
| Ga0210393_109024931 | 3300021401 | Soil | PAIRQEFAETLGREGVASRMNPEFYERPPGEGEEVMGDVM |
| Ga0210385_103350223 | 3300021402 | Soil | AIGYHQEDPAIRKEFEETLKREGLPSRMKPEFYERPPNEGEVVMGDVM |
| Ga0210385_107268101 | 3300021402 | Soil | EDPAIRKEFEETLKREGLPSRMNAEFYQRPPNEGEVVMGDVM |
| Ga0210394_108170661 | 3300021420 | Soil | YYQEDRAIRQEFEAILKREGLPSRMNPEFYERPPGDGEVVMGDVM |
| Ga0210394_112186072 | 3300021420 | Soil | RQEFEATLKREGLPSRMNPEFYERPPGDGEVVMGDVM |
| Ga0210410_104839161 | 3300021479 | Soil | SAIPYHQEDPAIRQEFSETLAREGVASRMNPEFYERPPGAGEEVMGDVM |
| Ga0179591_10760234 | 3300024347 | Vadose Zone Soil | YHQEDPYIREEFTEALKREGIDCRMNPEFYERPPAEGEVVMGDVM |
| Ga0208850_10788132 | 3300025457 | Arctic Peat Soil | EFEAILKREGLPSRMNPEFYERPPSEGEVVMGDVM |
| Ga0209483_11665032 | 3300025862 | Arctic Peat Soil | HQEDPAIRAEFDATLKREGLESRMKPEFYERPPAEGDVVMGDVM |
| Ga0207687_118040591 | 3300025927 | Miscanthus Rhizosphere | PYHQEDPAIRKEFEATLAREGVKSRMNPEFYERPPAEGEAVMGDVM |
| Ga0207664_115265532 | 3300025929 | Agricultural Soil | IPYHQEDPAIRREFSEALAREGVASRMNPEFYERPPGEGEEVMGDVM |
| Ga0207670_106862091 | 3300025936 | Switchgrass Rhizosphere | QEDPYIRQEFTEALSREGVACRMNPEFYERPPAEGEVVMGDVM |
| Ga0207678_103998882 | 3300026067 | Corn Rhizosphere | IRQEFTEALSREGVACRMNPEFYERPPAEGEVVMGDVM |
| Ga0207641_119661432 | 3300026088 | Switchgrass Rhizosphere | IPYHQEDPYIRQEFTEALSREGVACRMNPEFYERPPAEGEVVMGDVM |
| Ga0208990_10891553 | 3300027663 | Forest Soil | EDPYIRQEFTEVLKTESIACRMNPEFYERPPADGEDVMGDVM |
| Ga0209588_11799962 | 3300027671 | Vadose Zone Soil | EDPAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0209689_11560302 | 3300027748 | Soil | EFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0209590_102671031 | 3300027882 | Vadose Zone Soil | QEDPAIRKEFEEALKREGVASRMNAEFYQRPPAEGEVVMGDVM |
| Ga0209624_108507041 | 3300027895 | Forest Soil | EDPAIRREFEAILKREGLPSRMNPEFYERPPSEGEVVMGDVM |
| Ga0209488_100672172 | 3300027903 | Vadose Zone Soil | IPYHQEDPAIRKEFGETLAREGIAGRMNPEFYQRPPGEGEDVLGDVM |
| Ga0209488_102000181 | 3300027903 | Vadose Zone Soil | YHMEDPAIRQEFEATLALQGVASRMNPAFYERPPADGEEVPADM |
| Ga0209853_11488352 | 3300027961 | Groundwater Sand | IRKEFTEALNREGVGCRMNPEFYERPPAEGEVVMGDVM |
| Ga0307320_100619542 | 3300028771 | Soil | EFEEALKREGVASRMNRKFYQRPPAEGEAVMGDVM |
| Ga0307290_100237881 | 3300028791 | Soil | EDPAVRKEFEEALKREGVASRMNREFYQRPPAEGEAVMGDVM |
| Ga0307287_100607532 | 3300028796 | Soil | HQEDPAVRKEFEEALKREGVASRMNLEFYQRPLAEGEAVMDDVM |
| Ga0307308_104045443 | 3300028884 | Soil | YHQEDPAVRKEFEEALKREGVASRMNREFYQRPPAEGEAVMDDVM |
| Ga0308309_108213051 | 3300028906 | Soil | QEDPAIRQEFSETLAREGVASRMNPEFYERPPGAGEEVMGDVM |
| Ga0308178_10781712 | 3300030990 | Soil | DPAVRKEFEEALKREGVASRMNLEFYQRPLAEGEAVMDDVM |
| Ga0307500_100766261 | 3300031198 | Soil | KEFTEALKREGIDCRMNPEFYERPPAEGEEVMGDVM |
| Ga0310886_110614072 | 3300031562 | Soil | DPAIRAEFDATLRKEGVASRMNPAFYERPPADGEDVPPDM |
| Ga0318515_102857491 | 3300031572 | Soil | TEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM |
| Ga0310915_102550641 | 3300031573 | Soil | AIRREFEAALEREGVASRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318542_103649231 | 3300031668 | Soil | TEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0310686_1086376211 | 3300031708 | Soil | HQEDPAIRKEFEATLAGEGLPSRMKPEFYQRPPTEGEVVMGDVM |
| Ga0318500_102666292 | 3300031724 | Soil | AIPYHQEDPAIRREFEAALEREGVASRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318501_105400342 | 3300031736 | Soil | AIPYHQEDPAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318494_105303542 | 3300031751 | Soil | IPYHQEDPAIRKEFEAALKREGVASRMNLEFYERPPAEGEVVMGDVM |
| Ga0318526_103805851 | 3300031769 | Soil | AIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318546_105420202 | 3300031771 | Soil | IPYHQEDPAIREEFGQALAHEGVASRMNAEFYERPPQEGEVVMGDVM |
| Ga0318508_12111422 | 3300031780 | Soil | RKEFEAALAREGVASRMNAEFYQRPPAAGEMVMGDVM |
| Ga0318547_100807003 | 3300031781 | Soil | EFEAALAREGVASRMNAEFYQRPPAAGEMVMGDVM |
| Ga0318550_101487541 | 3300031797 | Soil | GYHQEDAAIRKEFEATLAREGLASRMKPEFYERPPNEGEVVMGDVM |
| Ga0318499_101477421 | 3300031832 | Soil | SAIPYHQEDPSIRAEFVQALAHEGVASRMNAEFYERPPQEGEVVMGDVM |
| Ga0306925_116858121 | 3300031890 | Soil | IPYHQEDPAIRAEFGEALAHEGVASRMNAEFYERPPQEGEVVMGDVM |
| Ga0318536_100097924 | 3300031893 | Soil | HQEDPAIRREFEAALEREGVASRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318536_107001562 | 3300031893 | Soil | AIRTEFEAALAREGVASRMNPEFYQRPPAAGEVVMGDVM |
| Ga0318522_100189513 | 3300031894 | Soil | IRKEFEAALAREGVASRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318551_109001542 | 3300031896 | Soil | PAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0306921_118328051 | 3300031912 | Soil | AIRAEFVQALAHEGVASRMNAEFYERPPQEGEVVMGDVM |
| Ga0310913_102887681 | 3300031945 | Soil | EFVQALAHEGVASRMNAEFYERPPQEGEVVMGDVM |
| Ga0306926_113188641 | 3300031954 | Soil | HQEDPYIRKEFSETLNKEGLQNRMNAEFYERPPAEGEMVMGDVM |
| Ga0318531_105624751 | 3300031981 | Soil | RKEFAETLGREGVSSRMNPEFYERPPAEGEVVMGDVM |
| Ga0310906_105232902 | 3300032013 | Soil | NAIPYHMEDPAIRAEFDATLRKEGVASRMNPAFYERPPADGEDVPPDM |
| Ga0318556_105121552 | 3300032043 | Soil | DPAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0318505_106083581 | 3300032060 | Soil | SAIGYHQEDAAIRKEFEATLAREGLASRMKPEFYERPPNEGEVVMGDVM |
| Ga0318553_106991802 | 3300032068 | Soil | HQEDPAIRTEFEAALAREGVAGRMNPEFYQRPPAEGEVVMGDVM |
| Ga0311301_117825691 | 3300032160 | Peatlands Soil | QDDPAIRQEFEAILKREGLPSRMNPEFYERPPSEGEVVMGDVM |
| Ga0335081_106546793 | 3300032892 | Soil | IGYHQEDPAIRKEFEATLKREGLPSRMNPEFYERPPAEGEVVMGDVM |
| Ga0370541_030270_521_649 | 3300034680 | Soil | EDPYIREEFTEALKREGIDCRMNPEFYERPPAEGEVVMGDVM |
| ⦗Top⦘ |