Basic Information | |
---|---|
Family ID | F064519 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 37 residues |
Representative Sequence | MAKAKKEGKPKRNRANLVKRLKTIERNVQLLNEYK |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 15.74 % |
% of genes near scaffold ends (potentially truncated) | 8.59 % |
% of genes from short scaffolds (< 2000 bps) | 61.72 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.688 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.531 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.312 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.812 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 3.17% Coil/Unstructured: 63.49% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF12705 | PDDEXK_1 | 18.75 |
PF04984 | Phage_sheath_1 | 3.12 |
PF00534 | Glycos_transf_1 | 2.34 |
PF06841 | Phage_T4_gp19 | 1.56 |
PF01329 | Pterin_4a | 1.56 |
PF00210 | Ferritin | 1.56 |
PF00550 | PP-binding | 0.78 |
PF00535 | Glycos_transf_2 | 0.78 |
PF00254 | FKBP_C | 0.78 |
PF07484 | Collar | 0.78 |
PF14743 | DNA_ligase_OB_2 | 0.78 |
PF00075 | RNase_H | 0.78 |
PF13426 | PAS_9 | 0.78 |
PF03819 | MazG | 0.78 |
PF04023 | FeoA | 0.78 |
PF00574 | CLP_protease | 0.78 |
PF07453 | NUMOD1 | 0.78 |
PF05721 | PhyH | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 3.12 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 1.56 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.78 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.69 % |
All Organisms | root | All Organisms | 45.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109773443 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1275 | Open in IMG/M |
3300003277|JGI25908J49247_10077762 | Not Available | 822 | Open in IMG/M |
3300004240|Ga0007787_10495898 | Not Available | 611 | Open in IMG/M |
3300005527|Ga0068876_10452885 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 710 | Open in IMG/M |
3300005527|Ga0068876_10713247 | Not Available | 535 | Open in IMG/M |
3300005528|Ga0068872_10736449 | Not Available | 516 | Open in IMG/M |
3300005565|Ga0068885_1723397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300005565|Ga0068885_1966006 | All Organisms → Viruses | 1720 | Open in IMG/M |
3300005580|Ga0049083_10213463 | Not Available | 654 | Open in IMG/M |
3300005662|Ga0078894_10043945 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3754 | Open in IMG/M |
3300006802|Ga0070749_10074940 | Not Available | 2025 | Open in IMG/M |
3300006802|Ga0070749_10226096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300006802|Ga0070749_10371381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300006802|Ga0070749_10433004 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300007165|Ga0079302_1016931 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1877 | Open in IMG/M |
3300007171|Ga0102977_1218570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
3300007177|Ga0102978_1023210 | Not Available | 1998 | Open in IMG/M |
3300007538|Ga0099851_1143759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300007541|Ga0099848_1029599 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2286 | Open in IMG/M |
3300007541|Ga0099848_1035312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2065 | Open in IMG/M |
3300007541|Ga0099848_1043852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1822 | Open in IMG/M |
3300007541|Ga0099848_1208000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300007542|Ga0099846_1271494 | Not Available | 585 | Open in IMG/M |
3300007593|Ga0102918_1213714 | Not Available | 587 | Open in IMG/M |
3300007960|Ga0099850_1136113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300008114|Ga0114347_1002567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14520 | Open in IMG/M |
3300008266|Ga0114363_1001461 | Not Available | 27287 | Open in IMG/M |
3300008266|Ga0114363_1005223 | Not Available | 6681 | Open in IMG/M |
3300008266|Ga0114363_1015700 | Not Available | 3778 | Open in IMG/M |
3300008266|Ga0114363_1103660 | Not Available | 1019 | Open in IMG/M |
3300008266|Ga0114363_1120965 | Not Available | 1548 | Open in IMG/M |
3300008267|Ga0114364_1000512 | Not Available | 23502 | Open in IMG/M |
3300008267|Ga0114364_1001789 | Not Available | 12581 | Open in IMG/M |
3300008267|Ga0114364_1003204 | Not Available | 10836 | Open in IMG/M |
3300008267|Ga0114364_1004104 | Not Available | 9993 | Open in IMG/M |
3300008267|Ga0114364_1038524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1805 | Open in IMG/M |
3300008267|Ga0114364_1042663 | All Organisms → Viruses | 1680 | Open in IMG/M |
3300008267|Ga0114364_1175733 | Not Available | 553 | Open in IMG/M |
3300008267|Ga0114364_1189526 | Not Available | 517 | Open in IMG/M |
3300008448|Ga0114876_1027982 | All Organisms → Viruses | 2801 | Open in IMG/M |
3300008448|Ga0114876_1264586 | Not Available | 520 | Open in IMG/M |
3300008450|Ga0114880_1269601 | Not Available | 517 | Open in IMG/M |
3300008459|Ga0114865_1002116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12187 | Open in IMG/M |
3300008510|Ga0110928_1020201 | Not Available | 740 | Open in IMG/M |
3300009085|Ga0105103_10037277 | Not Available | 2431 | Open in IMG/M |
3300009687|Ga0116144_10617280 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 525 | Open in IMG/M |
3300010354|Ga0129333_10743498 | Not Available | 840 | Open in IMG/M |
3300012013|Ga0153805_1059070 | Not Available | 649 | Open in IMG/M |
3300012970|Ga0129338_1376660 | Not Available | 602 | Open in IMG/M |
3300013004|Ga0164293_10708329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10016010 | Not Available | 5406 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10485870 | Not Available | 715 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10497910 | Not Available | 771 | Open in IMG/M |
3300017747|Ga0181352_1149987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300017754|Ga0181344_1013303 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300017766|Ga0181343_1102447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300017785|Ga0181355_1170477 | All Organisms → Viruses | 870 | Open in IMG/M |
3300017788|Ga0169931_10199291 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
3300017788|Ga0169931_10488890 | Not Available | 873 | Open in IMG/M |
3300018416|Ga0181553_10092990 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1879 | Open in IMG/M |
3300019784|Ga0181359_1024623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2297 | Open in IMG/M |
3300019784|Ga0181359_1036249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1911 | Open in IMG/M |
3300019784|Ga0181359_1080720 | Not Available | 1219 | Open in IMG/M |
3300020159|Ga0211734_10730367 | Not Available | 3927 | Open in IMG/M |
3300020160|Ga0211733_11102877 | All Organisms → Viruses | 1793 | Open in IMG/M |
3300020179|Ga0194134_10150601 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
3300020183|Ga0194115_10001816 | Not Available | 26384 | Open in IMG/M |
3300020183|Ga0194115_10209774 | All Organisms → Viruses | 953 | Open in IMG/M |
3300020562|Ga0208597_1067193 | Not Available | 638 | Open in IMG/M |
3300021424|Ga0194117_10029440 | All Organisms → Viruses | 3446 | Open in IMG/M |
3300021961|Ga0222714_10657813 | Not Available | 516 | Open in IMG/M |
3300021962|Ga0222713_10463249 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 766 | Open in IMG/M |
3300021963|Ga0222712_10123162 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1783 | Open in IMG/M |
3300021963|Ga0222712_10273610 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1070 | Open in IMG/M |
3300021963|Ga0222712_10740433 | All Organisms → Viruses | 549 | Open in IMG/M |
3300022179|Ga0181353_1013983 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2065 | Open in IMG/M |
3300022179|Ga0181353_1055177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300022179|Ga0181353_1094538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300022213|Ga0224500_10121187 | Not Available | 988 | Open in IMG/M |
3300022407|Ga0181351_1030043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2310 | Open in IMG/M |
3300023174|Ga0214921_10284896 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 935 | Open in IMG/M |
3300024480|Ga0255223_1027885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300025646|Ga0208161_1063699 | All Organisms → Viruses | 1122 | Open in IMG/M |
3300025889|Ga0208644_1056858 | All Organisms → Viruses | 2130 | Open in IMG/M |
3300026415|Ga0256298_1023880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300026425|Ga0256300_1019243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300027125|Ga0255106_1000372 | Not Available | 10250 | Open in IMG/M |
3300027499|Ga0208788_1047311 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1166 | Open in IMG/M |
3300027593|Ga0255118_1002617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4212 | Open in IMG/M |
3300027777|Ga0209829_10094220 | Not Available | 1464 | Open in IMG/M |
3300027798|Ga0209353_10092388 | Not Available | 1369 | Open in IMG/M |
3300027899|Ga0209668_11104814 | Not Available | 534 | Open in IMG/M |
3300031746|Ga0315293_10354131 | Not Available | 1165 | Open in IMG/M |
3300031758|Ga0315907_10270768 | Not Available | 1403 | Open in IMG/M |
3300031758|Ga0315907_10311695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
3300031758|Ga0315907_10343068 | Not Available | 1217 | Open in IMG/M |
3300031787|Ga0315900_10007550 | Not Available | 14243 | Open in IMG/M |
3300031787|Ga0315900_10962535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300031857|Ga0315909_10068032 | All Organisms → Viruses | 3200 | Open in IMG/M |
3300031857|Ga0315909_10343843 | All Organisms → Viruses | 1094 | Open in IMG/M |
3300031951|Ga0315904_10085229 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3369 | Open in IMG/M |
3300031963|Ga0315901_10561158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300031963|Ga0315901_10689647 | Not Available | 759 | Open in IMG/M |
3300032116|Ga0315903_11144535 | Not Available | 530 | Open in IMG/M |
3300033978|Ga0334977_0533661 | Not Available | 531 | Open in IMG/M |
3300033981|Ga0334982_0107610 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1463 | Open in IMG/M |
3300034022|Ga0335005_0748603 | Not Available | 511 | Open in IMG/M |
3300034061|Ga0334987_0183958 | Not Available | 1489 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.53% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.72% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.94% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.59% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.03% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.25% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.91% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.12% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.56% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.56% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.78% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.78% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.78% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.78% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1097734434 | 3300002408 | Freshwater | MAKARKEGKAKRNRANLVKRLKLIQKNQEIINQLTR* |
JGI25908J49247_100777621 | 3300003277 | Freshwater Lake | MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQSETH* |
Ga0007787_104958981 | 3300004240 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIKRNEQILNEYKKTAGPFASYS |
Ga0068876_100402151 | 3300005527 | Freshwater Lake | MAKARKEGKPKRNRQNLVKNLMRMKKNYDLIKRIEKEL* |
Ga0068876_100586462 | 3300005527 | Freshwater Lake | MARARKEGKPKRNRANLVKKMNMIQSNQEKLQKFFEKKN* |
Ga0068876_104528852 | 3300005527 | Freshwater Lake | MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEENL* |
Ga0068876_107132472 | 3300005527 | Freshwater Lake | MAKARKEGKPKRNRVNLTKRLGIIKRNEELLKQYNQNNN* |
Ga0068872_107364491 | 3300005528 | Freshwater Lake | MAKAKKEGKPKKNRGNLVKRLKMIARNQELLKQYENK* |
Ga0068885_17233972 | 3300005565 | Freshwater Lake | MAKARKEGKPKRNRGNLVKRLNMIARNQQLLKQYENE* |
Ga0068885_19660065 | 3300005565 | Freshwater Lake | MSKAKKEGKQKRNRGNLAKRLKLIEKNTQLLNKFQETA* |
Ga0049083_100046754 | 3300005580 | Freshwater Lentic | MAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ* |
Ga0049083_102134632 | 3300005580 | Freshwater Lentic | MAKAKKEGKPKRNRENLVKKLQRIERNAELIKQFE |
Ga0049081_101593691 | 3300005581 | Freshwater Lentic | ITMAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ* |
Ga0078894_100439456 | 3300005662 | Freshwater Lake | MAKARKEGKPKRNRANLVKRLKMIQKNQELINQLTK* |
Ga0078894_106300652 | 3300005662 | Freshwater Lake | MAKARKEGKPKRNRANLVKRLKLIKQNEEVLKSLRAQ* |
Ga0070749_100749402 | 3300006802 | Aqueous | MARARKEGSKNRNRKNLSKQLKRITRNQQLLKQYE* |
Ga0070749_102260963 | 3300006802 | Aqueous | MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKTK* |
Ga0070749_103713811 | 3300006802 | Aqueous | MAKAKKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA* |
Ga0070749_104330042 | 3300006802 | Aqueous | MAKARKEGKPKRNRANLAKRLAMINRNEELLKQYNQNNN* |
Ga0079302_10169315 | 3300007165 | Deep Subsurface | MAKARKEGKPKRNRVNLTKRLAIIKHNEELLKQYNQNNK* |
Ga0102977_12185701 | 3300007171 | Freshwater Lake | MAKARKEGKPKRNRANLVKRLKMIEKNSQLLKAYE* |
Ga0102978_10232104 | 3300007177 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIEHNEKILNEYKKTA* |
Ga0099851_11437593 | 3300007538 | Aqueous | MAKARKEGKPKRNRGNLVKRLKVIEHNEKILNEYKKTA* |
Ga0099848_10295998 | 3300007541 | Aqueous | MAKARKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA* |
Ga0099848_10353127 | 3300007541 | Aqueous | MAKARKEDKPKRNRANLVKRLKTIKRNIQLLNEYSK* |
Ga0099848_10438527 | 3300007541 | Aqueous | MAKARKEGKPKRNRANLAKRLKMIEKNNQLLNQYK* |
Ga0099848_12080003 | 3300007541 | Aqueous | MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKKTA* |
Ga0099846_12714941 | 3300007542 | Aqueous | MAKAKKEGKPKRNRANLAKRLKMIEKNNQLLNQYK* |
Ga0102918_12137142 | 3300007593 | Estuarine | MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEETL* |
Ga0099850_11361133 | 3300007960 | Aqueous | MAKARKEGKPKRNRANLVKRLKTIKRNIQLLNEYSK* |
Ga0114347_10025679 | 3300008114 | Freshwater, Plankton | MAKARKEGKPKKNRGNLVKRLNMIAKNQELIKEYENK* |
Ga0114363_10014612 | 3300008266 | Freshwater, Plankton | MAKARKEGKPKRNRANLVKRLKTMERNQQLLEQYK* |
Ga0114363_100522310 | 3300008266 | Freshwater, Plankton | MAKARKEGKQKRNRANLAKRIKLIDKNTQLLNKFKETA* |
Ga0114363_10157004 | 3300008266 | Freshwater, Plankton | MAKARKEGKPKRNRANLVKRLKTIERNIQLINEYSK* |
Ga0114363_11036602 | 3300008266 | Freshwater, Plankton | MAKARKEGKPKRNQANLVKRLKMIERNQQLLEKYK* |
Ga0114363_11209652 | 3300008266 | Freshwater, Plankton | MAKARKEGKPKRNRANLAKRLKMIERNNQLLNEYK* |
Ga0114364_100051240 | 3300008267 | Freshwater, Plankton | MAKAKKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK* |
Ga0114364_10017896 | 3300008267 | Freshwater, Plankton | MAKAKKEGKPKKNRGNLVKRLNMIAKNQELLKQYENK* |
Ga0114364_10028257 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRTNLAKHLNRIARNQQLLKQYENG* |
Ga0114364_100320413 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRTNLVKRLKTIEKNTQLLKQYES* |
Ga0114364_10041046 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRRNLVKKLRLIDKNHELLKQYEENL* |
Ga0114364_10385246 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRANLVKRLKTIERNIQLINEYK* |
Ga0114364_10426632 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRANLVKRLKTIERNQQLLEKYK* |
Ga0114364_11757332 | 3300008267 | Freshwater, Plankton | MAKARKEGKPKRNRANLVKRLKTIERNIQLLESYK* |
Ga0114364_11895261 | 3300008267 | Freshwater, Plankton | MAKAKKEGKPKRNRANLVKRLRVIKNNEELISKYMKTLED* |
Ga0114876_10279827 | 3300008448 | Freshwater Lake | MAKAKKEGKPKRNRANLVKRLKTIERNIQLLNEYSK* |
Ga0114876_12645862 | 3300008448 | Freshwater Lake | MAKARKEGKPKRNRGNLVKRLNMIARNQQLLEQYK* |
Ga0114880_12696012 | 3300008450 | Freshwater Lake | KKEGKPKRNRGNLAKRLKLIEHNEKIINEYKKSKND* |
Ga0114865_100211612 | 3300008459 | Freshwater Lake | MAKARKEGKPKRNRVNLAKRAKIIARNQALLKQYENEK* |
Ga0110928_10202011 | 3300008510 | Water Bodies | MAKARKEGKPKRNRANLVKRLAIIKHNEELLKQYNQNNN* |
Ga0105103_100372773 | 3300009085 | Freshwater Sediment | MAKAKKEGKPKRNRGNLVKRLKVIERNNQLLNEFKETA* |
Ga0105102_105077471 | 3300009165 | Freshwater Sediment | MAKAKKEGKPKGNRGNILKNMRRIEENLRILKELSSKK* |
Ga0116144_106172802 | 3300009687 | Anaerobic Digestor Sludge | MAKAKKEGKPKRNRANLVKKLRLIEKNQILIKQYEENL* |
Ga0129333_107434981 | 3300010354 | Freshwater To Marine Saline Gradient | MAKAKKEGKPKKNRGNLVKRLNMIAKNQELIKQYENK* |
Ga0153805_10590702 | 3300012013 | Surface Ice | MAKAKKEGKPKRNRGNLVKRLRMIERNTQLLNKYSK* |
Ga0157210_100046420 | 3300012665 | Freshwater | MAKARKEGKAKRNRVNLLKRLKMIQKNNEILKSLTAQ* |
Ga0129338_13766602 | 3300012970 | Aqueous | MAKAKKEGKPKRNRANLVKRLKVIKHNEKILNEYKTK* |
Ga0164293_107083292 | 3300013004 | Freshwater | MAKARKEGKPKRNRANLVKRLRMIQQNHEILNKLKEENL* |
(restricted) Ga0172365_100160109 | 3300013127 | Sediment | MAKARKEGKPKRNRANLVKHLNRIARNQQLLEQYK* |
(restricted) Ga0172365_104858702 | 3300013127 | Sediment | MAKARKEGKPKRNRRNLVKTLKMILKNQELLKKYQS* |
(restricted) Ga0172364_104979102 | 3300013129 | Sediment | MAKARKEGKQKRNRGNLAKRIKLIDKNTQLLNKFKETA* |
Ga0181352_11499873 | 3300017747 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKMIEKNVQLLNEYSK |
Ga0181344_10133033 | 3300017754 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLRLIENNQKLIKEYQSNL |
Ga0181343_11024473 | 3300017766 | Freshwater Lake | MAKAKKEGKPKRNRGNLAKRLKVIERNEQILNELNKK |
Ga0181355_11704772 | 3300017785 | Freshwater Lake | MAKAKKEGKPKRNRANLVKRLKTIERNVQLLNEYK |
Ga0169931_101992912 | 3300017788 | Freshwater | MAKARKEGKPKRNRANLAKRLGIIKHNEELLKQYNQNNN |
Ga0169931_104888902 | 3300017788 | Freshwater | MAKARKEGKPKRNRRNLVKTLKMILKNQELLKKYQS |
Ga0181553_100929903 | 3300018416 | Salt Marsh | MAKAKKEGKAKKNRGNLVKRLNMIKKNEEILKQYTSNL |
Ga0181359_10246232 | 3300019784 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIERNEQILNEYKKTA |
Ga0181359_10362492 | 3300019784 | Freshwater Lake | MAKARKEGKPKRNRANLVKRLKTIERNIQLLNEYSK |
Ga0181359_10807201 | 3300019784 | Freshwater Lake | MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQSETH |
Ga0181359_11996242 | 3300019784 | Freshwater Lake | MAKSQKNGKPTRNRTNLAKRLAMIKNNEQLLNQYNKIQNNK |
Ga0211734_107303675 | 3300020159 | Freshwater | MAKARKEGKSKRNRGNLVKRLKVITRNQQLLEQYK |
Ga0211733_111028772 | 3300020160 | Freshwater | MAKARKEGKQKRNRANLVKRIKLIDKNTQLINKFKETA |
Ga0211726_101182963 | 3300020161 | Freshwater | MAKARKEGKKKRNRANLVKNLKRIQKTEEIIAKFKQL |
Ga0194134_101506014 | 3300020179 | Freshwater Lake | MAKARKEGKPKRNRGNLAKRAKILARNEVFLKQYEDEK |
Ga0194115_1000181635 | 3300020183 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIERNEQILNEYKKK |
Ga0194115_102097743 | 3300020183 | Freshwater Lake | VARAKKEGKQKRNRSNLAKRLKLIEKNNQLLNEFKIK |
Ga0208597_10671932 | 3300020562 | Freshwater | MAKARKEGKAKRNRANLVKRLKLIQKNQEIINQLTR |
Ga0194117_100294402 | 3300021424 | Freshwater Lake | VARAKKEGKQKRNRSNLAKRLKLIEKNNQLLNKFKETA |
Ga0222714_106578132 | 3300021961 | Estuarine Water | MAKAKKEGKPKRNRKNLSIKLKRIMRNQELLNEYKLD |
Ga0222713_103404951 | 3300021962 | Estuarine Water | TMAKAKKEGKPKRNRGNLVKNLKRIKHNEEVLKSLSQK |
Ga0222713_104632492 | 3300021962 | Estuarine Water | MAKARKEGKPKRNRANLVKRLKLIKQNEEILKRIKNQ |
Ga0222712_100206263 | 3300021963 | Estuarine Water | MAKARKEGKAKRNRANLVKRLKLIKQNEEVLKSLRAQ |
Ga0222712_100232168 | 3300021963 | Estuarine Water | MAKAKKEGKPKRNRGNLVKNLKRIKHNEEVLKSLSQK |
Ga0222712_101231624 | 3300021963 | Estuarine Water | MAKARKEGKPKRNRANLVKRLKLIKQNEELLKNLKAQ |
Ga0222712_102736103 | 3300021963 | Estuarine Water | MAKARKEGKPKRNRANLVKRLKMIQKNQEIINQLTK |
Ga0222712_107404332 | 3300021963 | Estuarine Water | MAKARKEGKQKRNRANLAKRIKLIDKNTQLLNKFKETA |
Ga0181353_10139836 | 3300022179 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIKRNEQILNEYKKTA |
Ga0181353_10551773 | 3300022179 | Freshwater Lake | MAKAKKEGKPKRNRANLVKRLKTIERNIQLLNEYSK |
Ga0181353_10875571 | 3300022179 | Freshwater Lake | MAKARKEGKQKRNRTNLVKRLKIIAENERLINQYKTA |
Ga0181353_10945381 | 3300022179 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKVIKRNNQLLNEFEKK |
Ga0224500_101211872 | 3300022213 | Sediment | MAKSRKEGKPKRNRRNLAKKLARIENNMVLLKKYENK |
Ga0181351_10300431 | 3300022407 | Freshwater Lake | MAKAKKEGKPKRNRSNLIKRLNLIKKNEEILKNLRDQ |
Ga0214921_102848962 | 3300023174 | Freshwater | MAKARKEGKAKRNRANLLKRLKMIQKNNEILKSLTA |
Ga0255223_10278851 | 3300024480 | Freshwater | MAKAKKEGKPKRNRANLVKRLRVIERNEQILNEYKKTA |
Ga0208161_10636992 | 3300025646 | Aqueous | MAKAKKEGKPKRNRGNLVKRLKVIERNEKILNEYKKTA |
Ga0208644_10568582 | 3300025889 | Aqueous | MAKAKKEGKPKRNRGNLVKRLKVIEHNEKIINEYKKTA |
Ga0256298_10238803 | 3300026415 | Freshwater | MAKAKKEGKPKRNRANLVKRLKVIEHNEKILNEYKKT |
Ga0256300_10192433 | 3300026425 | Freshwater | MAKAKKEGKPKRNRANLVKRLKVIEHNEKILNEYKKTA |
Ga0255106_10003722 | 3300027125 | Freshwater | MAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQTETH |
Ga0208788_10473113 | 3300027499 | Deep Subsurface | MAKARKEGKPKRNRVNLTKRLAIIKHNEELLKQYN |
Ga0255118_100261718 | 3300027593 | Freshwater | TMAKAKKGGKPKRNRANLVKSLKRIKNNEELIKKYQTETH |
(restricted) Ga0247833_11132702 | 3300027730 | Freshwater | MAKAKKEGKPKRNRENLLKKLRRIEANSEILKRLSESN |
Ga0209829_100942202 | 3300027777 | Freshwater Lake | MAKAKKEGKPKRNRGNLVKRLKMINANHEILAAFAKQQNAE |
Ga0209353_100923882 | 3300027798 | Freshwater Lake | MAKAKKEGKPKRNRENLVKKLQRIERNAELIKQFEK |
Ga0209777_101744782 | 3300027896 | Freshwater Lake Sediment | MAKAKKEGKPKRNRGNLVKNLKRIFRNHDLISKMEEK |
Ga0209668_111048142 | 3300027899 | Freshwater Lake Sediment | MAKAKKEGKQKRNRGNLAKRLKLIEKNNQLLNEFKKTA |
Ga0315293_103541311 | 3300031746 | Sediment | MAKARKEGSSKGNRANLVKRLKVMEKNRELIKQYE |
Ga0315907_102707683 | 3300031758 | Freshwater | MSKAKKEGKQKRNRGNLAKRLKLIEKNTQLLNKFQETA |
Ga0315907_103116954 | 3300031758 | Freshwater | MAKARKEGKPKRNRGNLVKRLNMIARNQQLLKQYENE |
Ga0315907_103430684 | 3300031758 | Freshwater | MAKARKEGKPKRNRANLVKKLKLIEKNRELLAKYEK |
Ga0315900_1000755016 | 3300031787 | Freshwater | MAKARKEGKPKRNRANLAKRLKMIERNNQLLNEYK |
Ga0315900_109625352 | 3300031787 | Freshwater | MAKAKKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK |
Ga0315909_100680321 | 3300031857 | Freshwater | MAKARKEGKPKRNRGNLVKRLNMIARNQQLLEQYK |
Ga0315909_103438432 | 3300031857 | Freshwater | MAKARKEGKPKRNRANLVKRLKTMERNQQLLEQYK |
Ga0315904_100852295 | 3300031951 | Freshwater | MAKARKEGKPKRNRGNLAKKLRLINNNQQLIKQYEENL |
Ga0315901_105611582 | 3300031963 | Freshwater | MAKARKEGKPKRNRANLIKRLKTIEKNVQLLNEYSK |
Ga0315901_106896472 | 3300031963 | Freshwater | MAKAQKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN |
Ga0315903_111445352 | 3300032116 | Freshwater | KIMAKAQKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN |
Ga0315903_112056732 | 3300032116 | Freshwater | MAKAKKEGKPKKNRGNLVKRLNMIAKNQELIKQYENK |
Ga0334977_0533661_330_449 | 3300033978 | Freshwater | MAKAKKEGKPKRNRANLIKSLKRIKNNEELIKKYQSETH |
Ga0334982_0107610_30_149 | 3300033981 | Freshwater | MAKARKEGKPKRNRANLAKRLAIIKHNEELLKQYNQINN |
Ga0335005_0748603_31_138 | 3300034022 | Freshwater | MAKARKEGKPKRNRGNVFKRLKRIQEVEKALESFK |
Ga0334987_0183958_688_804 | 3300034061 | Freshwater | MAKAKKEGKPKRNRGNLVKRLKVIKRNNQLLNEFKKTA |
Ga0335000_0082694_383_499 | 3300034063 | Freshwater | MAKARKEGKTKRNRINLTKKLNRIKRNVELIKEYEMNL |
Ga0310130_0005033_2334_2447 | 3300034073 | Fracking Water | MAKAKKEGKPKRNRRNLAKKLARIENNMVLLKKYENK |
Ga0334997_0176101_1_105 | 3300034280 | Freshwater | MAKARKEGKTKRNRINLTKKLNRIKRNVELIKEYE |
⦗Top⦘ |