Basic Information | |
---|---|
Family ID | F064468 |
Family Type | Metagenome |
Number of Sequences | 128 |
Average Sequence Length | 43 residues |
Representative Sequence | NETTGGDLRPLQAEDLGLQLPSREFSFDSIAAPAGLATLSW |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.22 % |
% of genes from short scaffolds (< 2000 bps) | 96.09 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.062 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.156 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.656 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.156 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF04542 | Sigma70_r2 | 42.97 |
PF08281 | Sigma70_r4_2 | 33.59 |
PF13490 | zf-HC2 | 11.72 |
PF03775 | MinC_C | 0.78 |
PF03795 | YCII | 0.78 |
PF01797 | Y1_Tnp | 0.78 |
PF02873 | MurB_C | 0.78 |
PF13602 | ADH_zinc_N_2 | 0.78 |
PF13683 | rve_3 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 42.97 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 42.97 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 42.97 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 42.97 |
COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.78 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.78 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.06 % |
Unclassified | root | N/A | 10.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11310682 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300000956|JGI10216J12902_112369713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2469 | Open in IMG/M |
3300004156|Ga0062589_100674908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300004479|Ga0062595_101131977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300004778|Ga0062383_10042616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1749 | Open in IMG/M |
3300005093|Ga0062594_100623558 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300005330|Ga0070690_100868660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300005331|Ga0070670_101007534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300005347|Ga0070668_100262770 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300005353|Ga0070669_100378058 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300005356|Ga0070674_101428838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300005364|Ga0070673_100942347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300005440|Ga0070705_101254860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300005441|Ga0070700_101374331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300005444|Ga0070694_100203086 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300005457|Ga0070662_100331223 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300005457|Ga0070662_100591220 | Not Available | 933 | Open in IMG/M |
3300005468|Ga0070707_100914717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300005543|Ga0070672_100458405 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300005545|Ga0070695_100448938 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300005545|Ga0070695_101096712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300005578|Ga0068854_100792782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300005598|Ga0066706_10453429 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300005615|Ga0070702_100173703 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300005615|Ga0070702_100381810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300005841|Ga0068863_100797810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300005842|Ga0068858_100259834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1650 | Open in IMG/M |
3300005888|Ga0075289_1069646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300006845|Ga0075421_102386521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300006852|Ga0075433_11550757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300006853|Ga0075420_101424808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300006876|Ga0079217_10776367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300006904|Ga0075424_102241506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300006954|Ga0079219_10296501 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300007004|Ga0079218_10105462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1949 | Open in IMG/M |
3300009011|Ga0105251_10476232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300009093|Ga0105240_11707091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300009094|Ga0111539_12451113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300009100|Ga0075418_10128633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2692 | Open in IMG/M |
3300009100|Ga0075418_10351930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1572 | Open in IMG/M |
3300009147|Ga0114129_11021689 | Not Available | 1040 | Open in IMG/M |
3300009156|Ga0111538_13414309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300009171|Ga0105101_10611350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300009174|Ga0105241_10680440 | Not Available | 937 | Open in IMG/M |
3300009176|Ga0105242_10627864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
3300009177|Ga0105248_12804929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300009553|Ga0105249_12982314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300009610|Ga0105340_1507526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300010039|Ga0126309_10478246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300010045|Ga0126311_10247123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1322 | Open in IMG/M |
3300010373|Ga0134128_10666745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
3300010396|Ga0134126_12217019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300010397|Ga0134124_10436882 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300010397|Ga0134124_11918157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300010397|Ga0134124_12410553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300010397|Ga0134124_13000572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300010399|Ga0134127_11073426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300010399|Ga0134127_12071090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300010399|Ga0134127_12777890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300011119|Ga0105246_10670024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
3300011431|Ga0137438_1168388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300012208|Ga0137376_10947735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300012354|Ga0137366_10171918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1627 | Open in IMG/M |
3300012469|Ga0150984_107145453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300012511|Ga0157332_1060841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300012517|Ga0157354_1022154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300012582|Ga0137358_10501850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300012684|Ga0136614_10409535 | Not Available | 990 | Open in IMG/M |
3300012685|Ga0137397_10511733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300012957|Ga0164303_11124028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300012958|Ga0164299_10192621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
3300012989|Ga0164305_10438805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
3300013102|Ga0157371_10270618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1226 | Open in IMG/M |
3300013102|Ga0157371_11640220 | Not Available | 504 | Open in IMG/M |
3300013297|Ga0157378_12616627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300013306|Ga0163162_12268806 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300013308|Ga0157375_10576293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1286 | Open in IMG/M |
3300015371|Ga0132258_11744572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1570 | Open in IMG/M |
3300015371|Ga0132258_13182008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300015374|Ga0132255_103806972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300018052|Ga0184638_1258540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300018061|Ga0184619_10467562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300018466|Ga0190268_11923238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300018469|Ga0190270_10213641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1643 | Open in IMG/M |
3300018469|Ga0190270_11931965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300019361|Ga0173482_10202200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
3300019377|Ga0190264_10416276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300019883|Ga0193725_1037675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
3300020060|Ga0193717_1122739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300021073|Ga0210378_10081708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1265 | Open in IMG/M |
3300021082|Ga0210380_10152491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
3300025321|Ga0207656_10117874 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300025908|Ga0207643_10259680 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300025908|Ga0207643_10759285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300025911|Ga0207654_10712102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300025911|Ga0207654_11384353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300025918|Ga0207662_10062111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2244 | Open in IMG/M |
3300025918|Ga0207662_10887245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300025926|Ga0207659_10086268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2334 | Open in IMG/M |
3300025926|Ga0207659_11736288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300025927|Ga0207687_11249268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300025933|Ga0207706_11157788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300025936|Ga0207670_11667241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300025942|Ga0207689_11112340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300025942|Ga0207689_11551474 | Not Available | 552 | Open in IMG/M |
3300025949|Ga0207667_11940475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300026023|Ga0207677_10746068 | Not Available | 872 | Open in IMG/M |
3300026023|Ga0207677_11689809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300026088|Ga0207641_11926722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300026095|Ga0207676_10861595 | Not Available | 887 | Open in IMG/M |
3300026116|Ga0207674_11924183 | Not Available | 557 | Open in IMG/M |
3300026791|Ga0208072_106307 | Not Available | 589 | Open in IMG/M |
3300027645|Ga0209117_1160381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
3300027735|Ga0209261_10119643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300027775|Ga0209177_10052029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1164 | Open in IMG/M |
3300027787|Ga0209074_10400975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300028381|Ga0268264_10725237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
3300028536|Ga0137415_10486598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300030620|Ga0302046_10852858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300031852|Ga0307410_10561692 | Not Available | 947 | Open in IMG/M |
3300031911|Ga0307412_10536703 | Not Available | 980 | Open in IMG/M |
3300031911|Ga0307412_11676984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300031995|Ga0307409_100042025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3420 | Open in IMG/M |
3300032002|Ga0307416_103356551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300032004|Ga0307414_10512432 | Not Available | 1063 | Open in IMG/M |
3300032075|Ga0310890_11790489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300032205|Ga0307472_101892812 | Not Available | 595 | Open in IMG/M |
3300033412|Ga0310810_10903020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.03% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.69% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.12% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.34% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.34% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.56% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.56% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.78% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026791 | Grasslands soil microbial communities from Kansas, USA that are Nitrogen fertilized - NN591 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_113106821 | 3300000787 | Soil | LGANLRSLDAADLGLQLATRELSFDAIAAPAGLATLSWQ* |
JGI10216J12902_1123697131 | 3300000956 | Soil | ERAGEIVSETTGSVLQPLDAHDLGLVIPGRDLSFDAIAAPTGLASLSF* |
Ga0062589_1006749081 | 3300004156 | Soil | DTLGGDLRLLEAEDLGLLLPTRELSFDAIAAPAGLAALS* |
Ga0062595_1011319771 | 3300004479 | Soil | AGEIVGETLGTNLRSLDAADLGLQLVTRELSFDAIAAPSGLATLSWQ* |
Ga0062383_100426161 | 3300004778 | Wetland Sediment | GDIVNETLGADLRSLDAKDLGLQLATRELSFDAIAAPAGLAMMSWQ* |
Ga0062594_1006235583 | 3300005093 | Soil | GEIVNETTGDDLRPLEAEDLGLQLPNRDFSFDSIAAPAGLATLSW* |
Ga0070690_1008686601 | 3300005330 | Switchgrass Rhizosphere | EIVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0070670_1010075342 | 3300005331 | Switchgrass Rhizosphere | GEIVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0070668_1002627703 | 3300005347 | Switchgrass Rhizosphere | IVNETTGGTLEPLDAEDLGLLLPGRELSFDAIAAPAGLATLSF* |
Ga0070669_1003780583 | 3300005353 | Switchgrass Rhizosphere | LVNETTGGDLHLLEAEELGLLLPTRDLSFDAIAAPAGLAALS* |
Ga0070674_1014288382 | 3300005356 | Miscanthus Rhizosphere | TTGGTLRPLDAHDLGLLLPGRELSFDAIAAPAGLASLSF* |
Ga0070673_1009423471 | 3300005364 | Switchgrass Rhizosphere | TRERAGEIVNETTGGTLRPLDAHDLGLLLPGRDLSFDAIAAPAGLASLSF* |
Ga0070705_1012548601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AGEIVTETLGANLRSLDAADLGLQLVTRELSFDAIAAPAGLATLSWQ* |
Ga0070700_1013743312 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ETTGDDLRPLEAHDLGLQLPSRDFSFDSIAAPAGLATLSW* |
Ga0070694_1002030861 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | REIVNETTGGTLEPLDAEDLGLLLPGRELSFDAIAAPAGLATLSF* |
Ga0070662_1003312233 | 3300005457 | Corn Rhizosphere | IVNETTGDNLHTLEAHHLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0070662_1005912203 | 3300005457 | Corn Rhizosphere | TMGIELTPLEAEDLGLTLPGRDLSFDVVAAPAGLATLSL* |
Ga0070707_1009147171 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NETTGGTLEPLDAEDLGLLLPGRELSFDAIAAPAGLATLSF* |
Ga0070672_1004584051 | 3300005543 | Miscanthus Rhizosphere | TTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0070695_1004489381 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GKAFTAIRAQEIVNETTGEHLRPLSANDVGLNLPGRELDFDVIAGPAGLATLSF* |
Ga0070695_1010967122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RAGEIVNETLGANLRPLRAADLGLQLATRELSFDAIAGPAGLATLSWQ* |
Ga0068854_1007927821 | 3300005578 | Corn Rhizosphere | VRETMGIDLTPLEAEDLGLTLPGRDLSFDVVAAPAGLATMSL* |
Ga0066706_104534291 | 3300005598 | Soil | LRALDAEDLGLQLPSSDLSFDAIAAPAGLATLSQ* |
Ga0070702_1001737033 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RASEIVNETTGDNLHTLEAHHLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0070702_1003818101 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DLITKERAGEIVGETLGASLRPLAAADLGLQLASRELNFDSIAAPAGLATLSWQ* |
Ga0068863_1007978101 | 3300005841 | Switchgrass Rhizosphere | EIVNETTGGDLRPLQAEDLGLQLPNRDFSFDSIAAPAGLATLSW* |
Ga0068858_1002598341 | 3300005842 | Switchgrass Rhizosphere | TTGDDVRSLRAEDLGLQLPNRDFSFDSIAAPAGLATMSW* |
Ga0075289_10696461 | 3300005888 | Rice Paddy Soil | TLGTDLRPLEAFDLGLELPSRDIPFDSIAAPAGLATLSWQ* |
Ga0075421_1023865212 | 3300006845 | Populus Rhizosphere | TGGDLRPLEAHDLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0075433_115507571 | 3300006852 | Populus Rhizosphere | NETLGANLRALDPADIGLQIPPGPLDFNAIAAPAGLAILAGK* |
Ga0075420_1014248081 | 3300006853 | Populus Rhizosphere | EIVNETTGGDLRPLDAHDLGLQLPSRDFSFDSIAAPAGLATMSF* |
Ga0079217_107763671 | 3300006876 | Agricultural Soil | SEIVNETTGGDLRPVGAEDLGLQLPNRDFNFDAIAAPAGLATLSW* |
Ga0075424_1022415062 | 3300006904 | Populus Rhizosphere | IGEHLRPLSATDLGLMLPGRELDFDAIAAPAGLATLSF* |
Ga0079219_102965013 | 3300006954 | Agricultural Soil | TGGDLRPLAADELGLQLPSRDFSLDAIAAPAGLATLSW* |
Ga0079218_101054624 | 3300007004 | Agricultural Soil | VVGEMLNKQRVGDIVNETLGTDLRPLDASDLGLHLASRELSFDAIAAAARLATLAWR* |
Ga0105251_104762321 | 3300009011 | Switchgrass Rhizosphere | RDRAEMIVRETMGIDLTPLEAEDLGLTLPGRDLSFDVVAAPAGLATLSL* |
Ga0105240_117070911 | 3300009093 | Corn Rhizosphere | GGDLRPLAAEDLGLQLPSRDFSFDSIAAPAGLATLSW* |
Ga0111539_124511131 | 3300009094 | Populus Rhizosphere | RAGEIVNETTGGDLRPLGAEELGLQLPSRDFSFDSIAAPAGLATLSW* |
Ga0075418_101286331 | 3300009100 | Populus Rhizosphere | GVRKEHVCALVNETIGGDLRLLEAEDLGLLLPTRELSFDAIAAPAGLAALS* |
Ga0075418_103519304 | 3300009100 | Populus Rhizosphere | TGGDLRVLEAQDLGLQLPSHDFSFDSIAAPAGLATLSW* |
Ga0114129_110216891 | 3300009147 | Populus Rhizosphere | NETTGGDLRPLQAEDLGLQLPNRDFSIDSIAAPAGLATLSW* |
Ga0111538_134143091 | 3300009156 | Populus Rhizosphere | TTGGDLRPLQAEDLGLQLPNRDFSFDSIAAPAGLATLSW* |
Ga0105101_106113501 | 3300009171 | Freshwater Sediment | NKTLGTDIRPHEAQDLGLELPSGDSPFDSNAAPPGLLTLSWQ* |
Ga0105241_106804402 | 3300009174 | Corn Rhizosphere | CRLVNETTGGDLHLLEAEELGLLLPTRDLSFDAIAAPAGLAALS* |
Ga0105242_106278641 | 3300009176 | Miscanthus Rhizosphere | AGEIVTETLGTNLRSLDAADLGLQLATRELSFDAIAAPAGLATLSWQ* |
Ga0105248_128049291 | 3300009177 | Switchgrass Rhizosphere | TTGGNLEPLDAEDLGLVLPTRNFSFDAIAAPAGLATLSF* |
Ga0105249_129823141 | 3300009553 | Switchgrass Rhizosphere | DLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATMSW* |
Ga0105340_15075261 | 3300009610 | Soil | ETIGNDVATLEAEDVGLMLPGRDLTFDSIAAPAGLATLSF* |
Ga0126309_104782462 | 3300010039 | Serpentine Soil | GGDLRPLQAEDLGLQLPSREFNFDSIAAPAGLATMSW* |
Ga0126311_102471233 | 3300010045 | Serpentine Soil | LEVHLRALGPVEVGLALPSSELSFDAIAAPAGLATLAW* |
Ga0134128_106667453 | 3300010373 | Terrestrial Soil | AGEIVNETTGGDLRPLQAEDLGLQLPNSEFSFDSIAAPAGLATMSW* |
Ga0134126_122170192 | 3300010396 | Terrestrial Soil | AGEIVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0134124_104368821 | 3300010397 | Terrestrial Soil | TTGGDLRPLQAEDLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0134124_119181571 | 3300010397 | Terrestrial Soil | IVNETTGGDLRPLQAEDLGLQLPSHEFSFDSIAAPAGLATLSW* |
Ga0134124_124105531 | 3300010397 | Terrestrial Soil | ETLGTNLRPLAAADLGLQLASRELNFDSIAAPAGLATLSWQ* |
Ga0134124_130005722 | 3300010397 | Terrestrial Soil | GANLRSLNAADLGLQLATRELSFDAIAAPAGLATLSWQ* |
Ga0134127_110734261 | 3300010399 | Terrestrial Soil | LGVDLRPLEAEDLGLELSSSELSFDSIAAPAGLATLSWK* |
Ga0134127_120710901 | 3300010399 | Terrestrial Soil | DLRPLAAEDLGLQLPNREFRFDSIAAPAGLATLSW* |
Ga0134127_127778902 | 3300010399 | Terrestrial Soil | NETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATMSW* |
Ga0105246_106700241 | 3300011119 | Miscanthus Rhizosphere | RAGEIVGETLGASLRPLAAADLGLQLASREINFDSIAAPAGLATLSWQ* |
Ga0137438_11683882 | 3300011431 | Soil | LRSLDAADLGLQLVTRELSFDAIAAPAGLATLSWQ* |
Ga0137376_109477352 | 3300012208 | Vadose Zone Soil | GSSIRPLNAADVGLTLPEGDFSFDRVAAPAGLATLAWSE* |
Ga0137366_101719181 | 3300012354 | Vadose Zone Soil | ADLRPLQAGDLGLELPTNEISFDAIAAPAGLATLSWKG* |
Ga0150984_1071454531 | 3300012469 | Avena Fatua Rhizosphere | RAGEIVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0157332_10608411 | 3300012511 | Soil | IGQSLPKERAGSIVRETMGIDLTPLEAEDLGLTLPGRDLSFDVVAAPAGLATMSL* |
Ga0157354_10221542 | 3300012517 | Unplanted Soil | TRERAGEIVNETTGGNLRPLDAQDLGLHLPGRDLSFDAIAAPAGLASLSF* |
Ga0137358_105018502 | 3300012582 | Vadose Zone Soil | VRDTLGVDLRPLEAEDLGLQLSTRELSFDSIAAPAGLATLSWQ* |
Ga0136614_104095351 | 3300012684 | Polar Desert Sand | ARASEIVNETLGGNLRALEAEDLGLHLPTKDLSFDAIAAPAGLAALSR* |
Ga0137397_105117331 | 3300012685 | Vadose Zone Soil | CAIVNETLGADLHSLGAADLGLQLATRELSFDAIAAPAGLATLSWQ* |
Ga0164303_111240281 | 3300012957 | Soil | LEPLDAEDLGLLLPGRELSFDAIAAPAGLATLSF* |
Ga0164299_101926213 | 3300012958 | Soil | EIVNETTGGDLRPLEADDLGLHLPGRDLSFDAIAAPAGLATLSF* |
Ga0164305_104388053 | 3300012989 | Soil | GEIVNETTGGTLRPLNAQDLGLHLPGRDLSFDSIAAPAGLASLSF* |
Ga0157371_102706181 | 3300013102 | Corn Rhizosphere | NETTGGDLRPLQAEDLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0157371_116402202 | 3300013102 | Corn Rhizosphere | AGEIVNETTGGDLRPLQAEDLGLQLPSREFSFDSIAAPAGLATLSW* |
Ga0157378_126166271 | 3300013297 | Miscanthus Rhizosphere | IVSETTGGDLRPVAAEDLGLQLPSREFNFDSIAAPAGLATLSW* |
Ga0163162_122688061 | 3300013306 | Switchgrass Rhizosphere | TTGGDLRPLQAEDLGLQLPSRDFSFDSIAAPAGLATLSW* |
Ga0157375_105762933 | 3300013308 | Miscanthus Rhizosphere | DDVRSLRAEDLGLQLPNRDFSFDSIAAPAGLATMSW* |
Ga0132258_117445724 | 3300015371 | Arabidopsis Rhizosphere | LEPLDAEDLGLVLPTRNFSFDAIAAPAGLATLSF* |
Ga0132258_131820081 | 3300015371 | Arabidopsis Rhizosphere | RATELVNETTGGSLRPLGAADLGLNLPTQDLSFDVIAAPAGLATLSFR* |
Ga0132255_1038069722 | 3300015374 | Arabidopsis Rhizosphere | IVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW* |
Ga0184638_12585401 | 3300018052 | Groundwater Sediment | GEIVTETLGANLRSLNAADLGLQLVTRELSFDAIAAPAGLATLSWQ |
Ga0184619_104675621 | 3300018061 | Groundwater Sediment | ACAIVNETLEADLRWLGAEDLGLQLSTRELKFDAIAAPAGLATFSWQ |
Ga0190268_119232382 | 3300018466 | Soil | IVSETTGDDLRPLEAHDLGLQLPSRDFNFDSIAAPAGLATLSW |
Ga0190270_102136414 | 3300018469 | Soil | EIVNETTGGDLRPLEAEDLGLQLPSREFSFDSIAAPAGLATLSW |
Ga0190270_119319651 | 3300018469 | Soil | NETLGTDLRPLQAADLGLQLSSKELSFDAIAAPAGLATLSWQ |
Ga0173482_102022002 | 3300019361 | Soil | GGTLEPLDAEDLGLLLPGRELSFDAIAAPAGLATLSF |
Ga0190264_104162762 | 3300019377 | Soil | GTDLRPLEASDLGLQLASRELSFDAIAAPAGLATLAWR |
Ga0193725_10376751 | 3300019883 | Soil | NLRSLDAQDLGLQLVTRELSFDAIAAPAGLATLSWQ |
Ga0193717_11227391 | 3300020060 | Soil | EILSETLGTDLKPLDAHDLGLQLMTRELSFDAIAAPAGLATLSWQ |
Ga0210378_100817083 | 3300021073 | Groundwater Sediment | ETLGADLRSLNAADVGLQLATRELSFDAIAAPAGLATLSWQ |
Ga0210380_101524914 | 3300021082 | Groundwater Sediment | EVATLEAEDVGLMLPGRDLTFDSIAAPAGLATLSF |
Ga0207656_101178741 | 3300025321 | Corn Rhizosphere | GDLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0207643_102596803 | 3300025908 | Miscanthus Rhizosphere | GDLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATMSW |
Ga0207643_107592851 | 3300025908 | Miscanthus Rhizosphere | GGDLRPLDAEDLGLRLPGSGLDFDAIAAPAGLATLSWT |
Ga0207654_107121022 | 3300025911 | Corn Rhizosphere | TTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATMSW |
Ga0207654_113843532 | 3300025911 | Corn Rhizosphere | LTRERAGEIVNETTGGTLRPLDAHDLGLLLPGRDLSFDAIAAPAGLASLSF |
Ga0207662_100621114 | 3300025918 | Switchgrass Rhizosphere | TTGDDVRSLRAEDLGLQLPNRDFSFDSIAAPAGLATMSW |
Ga0207662_108872451 | 3300025918 | Switchgrass Rhizosphere | ETLGANLRSLDAADLGLQLATRELSFDAIAAPAGLATLSWQ |
Ga0207659_100862684 | 3300025926 | Miscanthus Rhizosphere | EIVNETTGGTLRPLDAHDLGLLLPGRDLSFDAIAAPAGLASLSF |
Ga0207659_117362882 | 3300025926 | Miscanthus Rhizosphere | GEIVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATMSW |
Ga0207687_112492681 | 3300025927 | Miscanthus Rhizosphere | DLITKQRAGEIVGETLGASLRPLAAADLGLQLASRELNFDSIAAPAGLATLSWQ |
Ga0207706_111577881 | 3300025933 | Corn Rhizosphere | PTAPPLDAQDLGLHLPGRDLSFDAIAAPAGLASLSF |
Ga0207670_116672412 | 3300025936 | Switchgrass Rhizosphere | TTGGDLRPLDAHDLGLQLPSRDFSFDAIAAPAGLATLSF |
Ga0207689_111123402 | 3300025942 | Miscanthus Rhizosphere | GGDLRPLGAEELGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0207689_115514742 | 3300025942 | Miscanthus Rhizosphere | KETTGGNLEPVEADDVGLLLPGRDISFDAIAAPAGLATLSL |
Ga0207667_119404752 | 3300025949 | Corn Rhizosphere | ETTGGDLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0207677_107460683 | 3300026023 | Miscanthus Rhizosphere | MAITETTGGDLRPLQAEDLGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0207677_116898091 | 3300026023 | Miscanthus Rhizosphere | HVCALVNETIGGDLRLLEAEDLGLLLPTRELSFDAIAAPAGLATLS |
Ga0207641_119267221 | 3300026088 | Switchgrass Rhizosphere | HLRPLNPTDLGLVLPGRELDFDAIAAPAGLATLSF |
Ga0207676_108615953 | 3300026095 | Switchgrass Rhizosphere | DLRPLQAEDLGLQLPNRDFSFDSIAAPAGLATLSW |
Ga0207674_119241831 | 3300026116 | Corn Rhizosphere | NETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW |
Ga0208072_1063072 | 3300026791 | Soil | NETTGGNLRPLQAEDLGLQLPSGEFSFDSIAAPAGLATLSW |
Ga0209117_11603812 | 3300027645 | Forest Soil | VNETLGANLHSLNAEDLGLQLATRELSFDAIAAPAGLAALQFRSSKPEART |
Ga0209261_101196431 | 3300027735 | Wetland Sediment | DRACEIVSETVGANLRSLDAADLGLQLVTRELSFDAIAAPSGLATLSWQ |
Ga0209177_100520291 | 3300027775 | Agricultural Soil | NETTGGDLRPLQAEELGLQLPSRELSFDSIAAPAGLATLSW |
Ga0209074_104009752 | 3300027787 | Agricultural Soil | NETTGGDLRPLQAEDLGLQLPSREFSFDSIAAPAGLATLSW |
Ga0268264_107252373 | 3300028381 | Switchgrass Rhizosphere | IVNETTGGDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW |
Ga0137415_104865981 | 3300028536 | Vadose Zone Soil | GGQLRALSAEDVGLQLPATDLSFDHIAAPAGLATLHWS |
Ga0302046_108528582 | 3300030620 | Soil | ANETLGTSLRALAATDVGLELPGSELPFDTVAAPAGLATLSWQ |
Ga0307410_105616921 | 3300031852 | Rhizosphere | GEIVNETTGRDLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0307412_105367031 | 3300031911 | Rhizosphere | ITKQRAGEIVNETTGDDLRPLEAEDLGLQLPNRDFSFDSIAVPAGLAILSW |
Ga0307412_116769841 | 3300031911 | Rhizosphere | TGRDLRPLEAEDLGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0307409_1000420251 | 3300031995 | Rhizosphere | RAGEIVNETTGDDLRPLQAEDLGLQLPNREFSFDSIAAPAGLATLSW |
Ga0307416_1033565512 | 3300032002 | Rhizosphere | EIVNETTGGDLRPLEAEDLGLQLPNRDFSFDSIAAPAGLATLSW |
Ga0307414_105124323 | 3300032004 | Rhizosphere | QRAEEIVNETTGGDLRPLGAEELGLQLPSRDFSFDSIAAPAGLATLSW |
Ga0310890_117904891 | 3300032075 | Soil | ETLGGNLRALEAEDVGLQLPTRELSFDAIAAPAGLAALSL |
Ga0307472_1018928121 | 3300032205 | Hardwood Forest Soil | VNETIGEHLRPVNPADLGLVLPGRELDFDAIAAPAGLATLSF |
Ga0310810_109030201 | 3300033412 | Soil | LRPLEAEDLGLQLSTRQLSFDSIAAPAGLATLSWQ |
⦗Top⦘ |