NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064349

Metagenome / Metatranscriptome Family F064349

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064349
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 106 residues
Representative Sequence LRTALISAITVCAEQRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRACPECGSDQEHKMILLLEYLCRSRLTNCSLAARAGRT
Number of Associated Samples 96
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 70.40 %
% of genes near scaffold ends (potentially truncated) 28.12 %
% of genes from short scaffolds (< 2000 bps) 69.53 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.656 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(18.750 % of family members)
Environment Ontology (ENVO) Unclassified
(37.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 63.70%    β-sheet: 0.00%    Coil/Unstructured: 36.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF064393keto-disac_hyd 48.44
PF01523PmbA_TldD 4.69
PF16916ZT_dimer 3.91
PF00270DEAD 1.56
PF00106adh_short 0.78
PF13616Rotamase_3 0.78
PF01081Aldolase 0.78
PF00873ACR_tran 0.78
PF05239PRC 0.78
PF14691Fer4_20 0.78
PF00682HMGL-like 0.78
PF03551PadR 0.78
PF00488MutS_V 0.78
PF01242PTPS 0.78
PF02965Met_synt_B12 0.78
PF00375SDF 0.78
PF16576HlyD_D23 0.78
PF15919HicB_lk_antitox 0.78
PF13620CarboxypepD_reg 0.78
PF03737RraA-like 0.78
PF00982Glyco_transf_20 0.78
PF14031D-ser_dehydrat 0.78
PF02223Thymidylate_kin 0.78
PF01128IspD 0.78
PF07973tRNA_SAD 0.78
PF13304AAA_21 0.78
PF13905Thioredoxin_8 0.78
PF02321OEP 0.78
PF00037Fer4 0.78
PF12838Fer4_7 0.78
PF00121TIM 0.78
PF00575S1 0.78
PF01545Cation_efflux 0.78
PF07732Cu-oxidase_3 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 4.69
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.56
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.78
COG0125Thymidylate kinaseNucleotide transport and metabolism [F] 0.78
COG0149Triosephosphate isomeraseCarbohydrate transport and metabolism [G] 0.78
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.78
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.78
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.78
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.78
COG0746Molybdopterin-guanine dinucleotide biosynthesis protein ACoenzyme transport and metabolism [H] 0.78
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.78
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 0.78
COG1207Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferaseCell wall/membrane/envelope biogenesis [M] 0.78
COG12112-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseLipid transport and metabolism [I] 0.78
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.78
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 0.78
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.78
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.78
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.78
COG2068CTP:molybdopterin cytidylyltransferase MocACoenzyme transport and metabolism [H] 0.78
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.78
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.66 %
UnclassifiedrootN/A2.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005533|Ga0070734_10245751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1026Open in IMG/M
3300005538|Ga0070731_10052674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2711Open in IMG/M
3300005591|Ga0070761_10000642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae22372Open in IMG/M
3300005591|Ga0070761_10273003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1013Open in IMG/M
3300005591|Ga0070761_10615270All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300005602|Ga0070762_11306901All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300005712|Ga0070764_10843830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium571Open in IMG/M
3300005921|Ga0070766_10237107All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300005921|Ga0070766_10247717All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300005995|Ga0066790_10145582All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300006052|Ga0075029_100121327All Organisms → cellular organisms → Bacteria1587Open in IMG/M
3300006052|Ga0075029_101161012All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300006059|Ga0075017_101320736All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300006162|Ga0075030_100592326All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300006162|Ga0075030_101066149All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300009029|Ga0066793_10286643All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300009552|Ga0116138_1054877All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300009623|Ga0116133_1138233All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300009632|Ga0116102_1212297All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300009641|Ga0116120_1284482All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300009645|Ga0116106_1127071All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300009764|Ga0116134_1020266All Organisms → cellular organisms → Bacteria → Acidobacteria2718Open in IMG/M
3300010379|Ga0136449_101707218All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300014151|Ga0181539_1199685All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300014153|Ga0181527_1004068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus12716Open in IMG/M
3300014156|Ga0181518_10425479All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300014161|Ga0181529_10075582All Organisms → cellular organisms → Bacteria → Acidobacteria2233Open in IMG/M
3300014162|Ga0181538_10048828All Organisms → cellular organisms → Bacteria → Acidobacteria2655Open in IMG/M
3300014200|Ga0181526_10123102All Organisms → cellular organisms → Bacteria → Acidobacteria1660Open in IMG/M
3300014489|Ga0182018_10022642All Organisms → cellular organisms → Bacteria → Acidobacteria4112Open in IMG/M
3300014489|Ga0182018_10370749All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300014491|Ga0182014_10002647All Organisms → cellular organisms → Bacteria → Acidobacteria22296Open in IMG/M
3300014492|Ga0182013_10398467All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300014493|Ga0182016_10054533All Organisms → cellular organisms → Bacteria → Acidobacteria3082Open in IMG/M
3300014495|Ga0182015_10086452All Organisms → cellular organisms → Bacteria → Acidobacteria2196Open in IMG/M
3300014495|Ga0182015_10142394All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300014838|Ga0182030_10213103All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300016705|Ga0181507_1122730All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300016705|Ga0181507_1396397All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300016750|Ga0181505_10623965All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300016750|Ga0181505_11126556All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300017938|Ga0187854_10372948All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300017943|Ga0187819_10151103All Organisms → cellular organisms → Bacteria → Acidobacteria1383Open in IMG/M
3300017946|Ga0187879_10195420All Organisms → cellular organisms → Bacteria → Acidobacteria1135Open in IMG/M
3300017946|Ga0187879_10322021All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300017946|Ga0187879_10511406All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017946|Ga0187879_10684155All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300017948|Ga0187847_10003578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus11808Open in IMG/M
3300017955|Ga0187817_10822856All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300017988|Ga0181520_10059964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3521Open in IMG/M
3300018013|Ga0187873_1238028All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300018016|Ga0187880_1399681All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300018022|Ga0187864_10125721All Organisms → cellular organisms → Bacteria → Acidobacteria1298Open in IMG/M
3300018026|Ga0187857_10036516All Organisms → cellular organisms → Bacteria → Acidobacteria2598Open in IMG/M
3300018034|Ga0187863_10098425All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300018035|Ga0187875_10016360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4569Open in IMG/M
3300018035|Ga0187875_10134942All Organisms → cellular organisms → Bacteria → Acidobacteria1387Open in IMG/M
3300018040|Ga0187862_10299853All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300018040|Ga0187862_10513159All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300018043|Ga0187887_10742420All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300018047|Ga0187859_10414013All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300018047|Ga0187859_10902118All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300018057|Ga0187858_10206115All Organisms → cellular organisms → Bacteria → Acidobacteria1281Open in IMG/M
3300018086|Ga0187769_10305471All Organisms → cellular organisms → Bacteria → Acidobacteria1189Open in IMG/M
3300018088|Ga0187771_10096083All Organisms → cellular organisms → Bacteria → Acidobacteria2380Open in IMG/M
3300018090|Ga0187770_10082652All Organisms → cellular organisms → Bacteria → Acidobacteria2371Open in IMG/M
3300018090|Ga0187770_11580538All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300021433|Ga0210391_11533743All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300022557|Ga0212123_10167635All Organisms → cellular organisms → Bacteria → Acidobacteria1671Open in IMG/M
3300022873|Ga0224550_1008197All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300025412|Ga0208194_1064666All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300025612|Ga0208691_1014235All Organisms → cellular organisms → Bacteria → Acidobacteria1944Open in IMG/M
3300026294|Ga0209839_10008999All Organisms → cellular organisms → Bacteria → Acidobacteria4286Open in IMG/M
3300027652|Ga0209007_1070196All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300027676|Ga0209333_1000727All Organisms → cellular organisms → Bacteria17336Open in IMG/M
3300027745|Ga0209908_10027491All Organisms → cellular organisms → Bacteria → Acidobacteria1130Open in IMG/M
3300027745|Ga0209908_10232618All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300027826|Ga0209060_10447859All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300027853|Ga0209274_10521704All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300027869|Ga0209579_10003773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus10841Open in IMG/M
3300027889|Ga0209380_10073031All Organisms → cellular organisms → Bacteria1961Open in IMG/M
3300027911|Ga0209698_10064361All Organisms → cellular organisms → Bacteria3156Open in IMG/M
3300027911|Ga0209698_10484924All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300027911|Ga0209698_10516299All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300028747|Ga0302219_10274574All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300028762|Ga0302202_10198983All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300028773|Ga0302234_10072153All Organisms → cellular organisms → Bacteria → Acidobacteria1537Open in IMG/M
3300028773|Ga0302234_10537090All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300028798|Ga0302222_10102096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1142Open in IMG/M
3300028879|Ga0302229_10461934All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300029911|Ga0311361_10283978All Organisms → cellular organisms → Bacteria → Acidobacteria1885Open in IMG/M
3300029922|Ga0311363_10391178All Organisms → cellular organisms → Bacteria → Acidobacteria1486Open in IMG/M
3300029943|Ga0311340_10143630All Organisms → cellular organisms → Bacteria2515Open in IMG/M
3300029944|Ga0311352_10957503All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300029944|Ga0311352_11146675All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300029956|Ga0302150_10357324All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300029999|Ga0311339_10004883All Organisms → cellular organisms → Bacteria → Acidobacteria22039Open in IMG/M
3300029999|Ga0311339_10190949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2334Open in IMG/M
3300030053|Ga0302177_10290991All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300030520|Ga0311372_12485308All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300030524|Ga0311357_11577823All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300030743|Ga0265461_12231157All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300030878|Ga0265770_1132553All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300031090|Ga0265760_10111388All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300031234|Ga0302325_10068204All Organisms → cellular organisms → Bacteria → Acidobacteria6905Open in IMG/M
3300031234|Ga0302325_10171597All Organisms → cellular organisms → Bacteria → Acidobacteria3816Open in IMG/M
3300031525|Ga0302326_12147940All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031525|Ga0302326_13493618All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300032160|Ga0311301_10001272All Organisms → cellular organisms → Bacteria97571Open in IMG/M
3300032160|Ga0311301_10035982All Organisms → cellular organisms → Bacteria12331Open in IMG/M
3300032160|Ga0311301_10267564All Organisms → cellular organisms → Bacteria2789Open in IMG/M
3300032770|Ga0335085_10000061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia376257Open in IMG/M
3300032783|Ga0335079_10676780All Organisms → cellular organisms → Bacteria → Acidobacteria1080Open in IMG/M
3300032783|Ga0335079_12121970All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300032805|Ga0335078_10014737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia11601Open in IMG/M
3300032805|Ga0335078_10038840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7060Open in IMG/M
3300032805|Ga0335078_10168059All Organisms → cellular organisms → Bacteria → Acidobacteria3083Open in IMG/M
3300032805|Ga0335078_10781787All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300032892|Ga0335081_10460333All Organisms → cellular organisms → Bacteria → Acidobacteria1614Open in IMG/M
3300032892|Ga0335081_11083743All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300032893|Ga0335069_11886437All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300032898|Ga0335072_10157650All Organisms → cellular organisms → Bacteria → Acidobacteria2770Open in IMG/M
3300033822|Ga0334828_024745All Organisms → cellular organisms → Bacteria → Acidobacteria1837Open in IMG/M
3300033823|Ga0334837_009783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4428Open in IMG/M
3300033887|Ga0334790_008553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales5693Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland18.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa14.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.25%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.47%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.12%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.12%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.12%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa3.12%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.12%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.34%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.56%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.56%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.78%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070734_1024575123300005533Surface SoilLRTALISAIAACAAKRFRKTARNFLQGLSTDELQYIAEYLGACVLESVEGAALSRAELAAGIAQFARVRQGNRPRGKDYEHKMILLLEYLCRCQLTHCSPGVRARGEPEPAL*
Ga0070731_1005267433300005538Surface SoilLRTALISAIAECAEKRLRTKARRFLQGLSRDELQYIAQFLGACVLESAGRAACSRDQLADGIAYFEHVRSVQNGCLRDPEHKMILLLEYLCLCRIYSAAFNSRIQMFR*
Ga0070761_10000642223300005591SoilVRTALISAIAACAEQRFQRKAHKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRDLADGIAQFEQVRHGRTGLLADREHKMILLLEYLCRSRLTYCCLAMRAERT*
Ga0070761_1027300323300005591SoilLISAIAACAERHFQRKARKFLQGLSTDELQYIADFLGACVLESLGRSACSRRELAESIAQFDQVRCAASDRPGDRQHKMILLLEYLCRTRLTHCSLALRAERT*
Ga0070761_1061527013300005591SoilLRTALISAITACAEQRFQKRARSFLLGLSKDELQYIAEFLGACMLESVGRSAFSRRELAEGIAQFEQVRRAPADSLCDQEHKMILLLEYLCRSQLTHCSVAVRAART*
Ga0070762_1130690123300005602SoilLRTALISAIAASAEQRFRKKARNFLLGLSRDELQYIAEFLGACVLESVGRSACSRQELAEGIAQFELVRRTPAESFHDQEHKMILLLEYLCISRLTHYSLAMRAERA*
Ga0070764_1084383023300005712SoilLRTALISAIAACAEQPLQKKARKFLLGLSTDELQYIAEFLGACVLESSARSTLNRRELADGIGQFEHVRQGCAGCPGDREHKMILLLEYLSRSRTYCAVLSSRIQMFR*
Ga0070766_1023710723300005921SoilVRTGLISAIAACAERHFQRKARKFLQGLSTDELQYIADFLGACVLESLGRSACSRRELAESIAQFDQVRCAASDRPGDRQHKMILLLEYLCRTRLTHCSLALRAERT*
Ga0070766_1024771723300005921SoilLRTALISAITACAEQRFQKRARSFLLGLSKDELQYIAEFLGACMLESVGRSAFSRRELAEGIAQFEQVRRAPADSLCDQEHKMILLLEYLCRSRTYSAVFNSRIQMLR*
Ga0066790_1014558223300005995SoilLRFALISAIALCAEPRFQKKARGFLQGLSTDELQYIAEFLGACMLETSWRSDAFSRADMAEGIFQYEQICHAHQDSPADPEHKMILLLEYLCRSQLTHCALAVRAERL*
Ga0075029_10012132723300006052WatershedsLISAITAFADPRFQKKARKFLLGLSTDEMQYIAEFLGACILESLGRSAFSRRELAEGIAQFEQVGRGPSACLGDREHKMILLLEYLCRSQLTHCSLAVRAERT*
Ga0075029_10116101213300006052WatershedsLRTPLISAITVCAEQRFQKKARKFLQGLSKDELQYIAEFLGACVLESVGRSAVSRRELADRIAQFEQARRAPAGSFNDQEHKMIPLLEYLCRSQFTHCFLAVRAERM*
Ga0075017_10132073623300006059WatershedsLRTALISAITACAEQRFQKKARRFLQGLSKDELQYIAEFLGACVLESVGRAALSRCELADGIAQFEQVRRAPAAGLGDREYKMILLLEYLSRGQLTHCSLVVRAGRM*
Ga0075030_10059232623300006162WatershedsVRTALISAITAFADPRFQKKARKFLLGLSTDEMQYIAEFLGACILESLGRSAFSRRELADGIAQFEQVGRGPSACLGDREHKMILLLEYLCRSQLTHCSLAVRAERT*
Ga0075030_10106614913300006162WatershedsLRTTLISAITACAEQRLQKKARKFLQGLSRDELQYIAEFLGACVLESLGRNDLSRRELAEGIAHFEHIRHTPLDCSGDQEHKMILLLEYLCRSQLTHCPLAMRAGRT*
Ga0066793_1028664313300009029Prmafrost SoilLISAIALCAEPRFQKKARGFLQGLSTDELQYIAEFLGACMLETSWRSDAFSRADMAEGIFQYEQICHAHQDSLADPEHKMILLLEYLCRSQLTHYSLPVRAERM*
Ga0116218_109175923300009522Peatlands SoilLHPAFLSGIINITDVIARLETRSSGLRTALISAIAVCAEQRFQKKARNFLQGLSTDELQYIAEFLGACVLESLGHSAFTRRELAEGIAHFEQVRGAPAECAGDREHKMILLLEYLCRSQLAHCSLAVRAGRT*
Ga0116138_105487723300009552PeatlandLISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLESVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLCRSGLTNWSMAVRAGPT*
Ga0116133_113823323300009623PeatlandLISAIAVCAEQRFQRKARKFLQGLSLDELQYIGEFLGACVLETLGHSALSRLELAEGIAQFEQARPARPARPDCTGDREHKMIVLLEYLCRSRLTHCSLALRAGRT*
Ga0116102_121229713300009632PeatlandLISAIAACAEQRFQKKAREFLQGLSRDELQYIAEFLGACVLESVGHSALSRRELADGIAQFEQVRRASPDGGDREHKMILLLEYLCRSQLTHCSLAVRAGRT*
Ga0116120_128448213300009641PeatlandGLRTALISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLECVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLCRSGLTNWSMAVRAGPT*
Ga0116106_112707113300009645PeatlandLVSAATACVEERLQKKARRFLQGLSTDELQYIAEFLGACVLESWGRAACSRSQLADGIAHFDQFRCAPTGCVSDQEHKMILLLEYLCRCKLMHCSLAAPAGRM*
Ga0116134_102026633300009764PeatlandLVSAATACVEERLQRKARKFLQGLSTDELQYIAEFLGACVLESWGDTACSRSQLADGIAHFDRFRPAPAGCLSDQEHKMILLLEYLCRCKLTHCSLAARAERM*
Ga0136449_10170721823300010379Peatlands SoilLISAISACAEQRFQRKARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELAEGIAQFEQIRRESAERFNDREHKMILLLEYLCRSQLTHCSLALPAERT*
Ga0181539_119968523300014151BogLISAIAACAEQRFQKKAREFLQGLSRDELQYIAEFLGACVLESVGHSALSRRELADGIAQFEQVRRASPDGGGDREHKMILLLEYLCRSQLTHCSLAVRAGRA*
Ga0181527_100406843300014153BogLISAIAACAEQRFQKKAREFLQGLSRDELQYIAEFLGACVLESVGHSALSRRELADGIEQFEQVRRASPDGGGDREHKMILLLEYLCRSQLTHCSLAVRAGRA*
Ga0181518_1042547923300014156BogLISAIAVCAEQRFQKNARRFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDQEHKMILLLEYLCRSRLTNCSLAAPAGRL*
Ga0181529_1007558223300014161BogLISAITVCAERRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRSELADGIAHFEQVRRASPDCGSDQEHKMILLLEYLCHSRITNCSLAAPAGRL*
Ga0181538_1004882823300014162BogLISAIAVCAEQRFQKNARRFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRCASPDCGGDQEHKMILLLEYLCRSRLTNCSLAAPAGRL*
Ga0181526_1012310213300014200BogLISAIAACAEQRLQKKARRFLLGLSTDELQYIAEFLGACVLESLGNSALSRRELAEGIAQFEQVRARADRPDREHKMILLLEYLCRSRLTHCSFALRAERT*
Ga0182018_1002264243300014489PalsaMNITDVSVDAIVRLETRSSGLRTALISAIAACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRASADCLGDQEHKMILLLEYLCRSRLTHCSLALRAERT*
Ga0182018_1037074913300014489PalsaMNNTDAIARPANRSSGLRTALISALTASAPRRFQKSAGKFLLGLSTDELQYIADYLGACVLESLGSSSLSRRELAGGIAHFEQCRYAPAGRRTDHEHKMILLLEYLCRSRLTHCALAVRAGRT*
Ga0182014_1000264733300014491BogLISAIALCAERRFQKNARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDREHKMILLLEYLCRSQLTNCSLAAPAGRL*
Ga0182013_1039846723300014492BogLISAITVCAERRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRSELADGIAHFEQVGRASPDCGSDQEHKMILLLEYLCHSRITNCSLAAPAGRL*
Ga0182016_1005453313300014493BogPVRTTLIFAIAAYADRRFQKKARSFLRGLSTGELQYIAEFLGACVLESAGRSPASRRDLAQGIAQYEQVRSGTASGPSDHDHKMILLLEYLCRSQLSVSIPPVLSIP*
Ga0182015_1008645223300014495PalsaVRTALISAITVCAERRFQKKARKFLLGLSTDELQYIAEFLGACILESAGRSAFSRRELAEGVAQFEMERRASAHGQGDREHKMILLLEYLCRSRVGRPILAAGRL*
Ga0182015_1014239423300014495PalsaMNNTDAIARPPNRSSGLRTALISALTASAPRRFQKSAGKFLLGLSTDELQYIADYLGACVLESLGSSSLSRRELAGGIAHFEQCRYAPAGRRTDHEHKMILLLEYLCRSRLTHCALAVRAGRT*
Ga0182030_1021310333300014838BogLISAITVCAERRFQKKARKFLLGLSTDELQYIAGFLGACVLESAGNSALSRRDLAEAIAEFEQIRGASGASLADPEHKMILLLEYLCRARLTHYSLALRAART*
Ga0181507_112273013300016705PeatlandVDVDVRLETRSSGLRTALISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLESVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLCRSGLTNWSMAVRAGPT
Ga0181507_139639713300016705PeatlandNRQHRCYGSPRDRSSGLRTALISAIAVCAEQRFQKNARRFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDQEHKMILLLEYLCRSRLTNCSLAAPAGRL
Ga0181505_1062396523300016750PeatlandSGLRTALISAIAVCAEQRFQKNARRFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDQEHKMILLLEYLCRSRLTNCSLAAPAGRL
Ga0181505_1112655613300016750PeatlandLRTALISAIAACAEQRFQKKAREFLQGLSRDELQYIAEFLGACVLESVGHSALSRRELADGIAQFEQVRRASPDGGGDREHKMILLLEYLCRSQLTHCSLAVRAGRA
Ga0187854_1037294823300017938PeatlandLRTALISAIVACAEQRLHRKARRFLLGLSTDELQYIAEFLGACVLESLGNSALSRRELAEGIAQFEQVRGARAECPGDQEHKMILLLEYLCSSRLTHCSFALRAQRM
Ga0187819_1015110323300017943Freshwater SedimentMRTALISAIAACAEERLQKKARRFLQGLSRDELLYIAEFLGACVIESPEHGACSRSELAESIAHFEQARSAPAGRRGDREHKMILVLEYLRACNYSAASLSSRIQMLR
Ga0187879_1019542013300017946PeatlandKPGVRVLRTALISAISVCAEQRLQAKARNFLQGLSTDELQYIAEFLGTCVLESVGHSPFDRRELAEGIAEFDQARRPAAQCRGDREHKMILLLEYLCHSQLTQCSLAARAGRS
Ga0187879_1032202113300017946PeatlandVRTALISAITASAEGRFQEKARKFLQGLSTDELQYIAEFLGACVLESLGRSAHSRRELADGIAQFEQVRRASADCFDDQEHKMILLLEYLCRSRLTHCSPTMRAERI
Ga0187879_1051140613300017946PeatlandLRTALISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLESVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLCRSGLTNWSMAVRAGPT
Ga0187879_1068415523300017946PeatlandRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRSELADGIAHFEQVRRASPDCGSDQEHKMILLLEYLCHSRITNCSLAAPAGRL
Ga0187847_1000357883300017948PeatlandLRTALISAITVCAERRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRSELADGIAHFEQVRRASPDCGSDQEHKMILLLEYLCHSRITNCSLAAPAGRL
Ga0187817_1082285613300017955Freshwater SedimentLRTALISAITACAEQRLQKKARKFLLGLSTDELQYIAEFLGACVLESLGPSARSRRELAEGIAQFEQVRCAPRDCATGREHKMILLLEYLCRSQLTHGGLALPAERT
Ga0181520_1005996423300017988BogLRTALISAIAVCAEQRFQKNARRFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDQEHKMILLLEYLCRSRLTNCSLAAPAGRL
Ga0187873_123802813300018013PeatlandLRTALISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLESVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLCRSGLTN
Ga0187880_139968113300018016PeatlandLRAALISAIALCAERRFQKNARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDREHKMILLLEYLCRSQLTNCSLAAPAGRL
Ga0187864_1012572123300018022PeatlandLRTALISAITVCAERRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEHIRRAPADCPSDQEHKMILLLEYLCRSQLTHCSVAVRAERT
Ga0187857_1003651623300018026PeatlandVRRALVSAATACVEERLQRKARKFLQGLSTDELQYIAEFLGACVLESWGDTACSRSQLADGIAHFDRFRPAPAGCLSDQEHKMILLLEYLCRCKLTHCSLAARAERM
Ga0187863_1009842523300018034PeatlandLRTALISAISVCAEQRLQAKARNFLQGLSTDELQYIAEFLGTCVLESVGHSPFDRRELAEGIAEFDQARRPAAQCRGDREHKMILLLEYLCHSQLTQCSLAARAGRS
Ga0187875_1001636023300018035PeatlandLRTALISAITVCAEQRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRACPECGSDQEHKMILLLEYLCRSRLTNCSLAARAGRT
Ga0187875_1013494213300018035PeatlandTRIESGVRVRTTLISAITACAERRFQKKARNFLLGLSTDELQYIAEFLGACVLDSVGRSAYSRRELAEGIAQFEQVRPAPAESLHDQEHKMILLLEYLCRSRLTYCSLAVRAERT
Ga0187862_1029985323300018040PeatlandLRTALISAITACADQRFQKKARKFLSGLSTDELQYVAEFLGACVLESVGRSGLSRGELAEDIAQFELVRRAPAHGPSDREHKMILLLEYLC
Ga0187862_1051315913300018040PeatlandLISAITVCAEQRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRACPECGSDQEHKMILLLEYLCRSRLTNCSLAARAGRT
Ga0187887_1046900423300018043PeatlandLRPAFLFGIINITDVIARLEARSSGLRTVLISAITVCAEHRFQKKARRFLLGLSTDELQYIAEFLGACVLESVGRSAASRRDLADGIAQFQQVRRAPADCLADQEHKMILLLEYLCRSQLTHCSLAERA
Ga0187887_1074242013300018043PeatlandYGSPRDRSSGLRTALISAITVCAEQRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRACPECGSDQEHKMILLLEYLCRSRLTNCSLAARAGRT
Ga0187859_1041401313300018047PeatlandRTALISAISVCAEQRLQAKARNFLQGLSTDELQYIAEFLGTCVLESVGHSPFDRRELAEGIAEFDQARRPAAQCRGDREHKMILLLEYLCHSQLTQCSLAARAGRS
Ga0187859_1090211813300018047PeatlandLRTALISAIVACAEQRLHRKARRFLLGLSTDELQYIAEFLGACVLESLGNSALSRRELAEGIAQFEQVRGARAECPGDQEHKMILLLEYLCSSRLTHCSFA
Ga0187858_1020611513300018057PeatlandKARRFLLGLSTDELQYIAEFLGACVLESLGNSALSRRELAEGIAQFEQVRGARAECPGDQEHKMILLLEYLCSSRLTHCSFALRAQRM
Ga0187769_1030547123300018086Tropical PeatlandLRTALISAIAACAEQRLQKKARKFLLGLSTDELQYIAEFLGACVLESLGRSSLSRRELANGIAQFEQIRPSRAEFRHDREHKMILLLEYLCRSQLTQCGLALPAERT
Ga0187771_1009608323300018088Tropical PeatlandLRTALISAISACAEQHFQKKARKFLQGLSTDELQYIAEFLGACVLESVGRSALSRRELAEGIAQFEQARRARADCLGDQQHKMILLLEYLCRSQLAHCSLALPAGRT
Ga0187770_1008265233300018090Tropical PeatlandSGLRTALISAIAACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESLGRSLCSRRELADGIAQFEQARCAPAYRAGDQEHKMILLLEYLCRSRLTHCSLAVRAERT
Ga0187770_1158053813300018090Tropical PeatlandLRKALISAIAACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESLGSSALSRRWLADGIAQFEHIRRARTDYPGDHEHKMILLL
Ga0210391_1153374313300021433SoilLRTGLISAITEFAERRFQRKARKFLLGLSTDELQYIAEFLGACILESAGRSACSRRELAEAIAQFEYVGRASAHGLGDREHKMILLLEYLCRSRIAHASLVVRAGRV
Ga0212123_1016763523300022557Iron-Sulfur Acid SpringVRTALISAIAACAEERLRKKARRFLQGLSRDELQYVAEFLGACVLETSRQIALSRGELAECIAQFAQLRRASAHSATDEEHKMILLLEYLCRSKPIYCAASFSSRIQMLR
Ga0224550_100819723300022873SoilVRTALVSAIAACAERRFQRKARKFLLGLSTDELQYIAEFLGACILESAGRSAFSRRELAEGVAQFEMERRASAHGQGDREHKMILLLEYLCRSRVGRPILAAGRL
Ga0208194_106466623300025412PeatlandLRTSLISAIAVCAEQRLQRKARKFLQGLSLDELQYIGEFLGACVLETLGHSALSRLELAEGIAQFEQARPARPARPDCTGDREHKMIVLLEYLCRSRLTHCSL
Ga0208691_101423523300025612PeatlandLKRALISAITVCAERRFQKKARKFLHGLSTDELQYIAEFLGACVLESLGRSAATRRELADGIAQFEQFRPARAENPSDQQHKMILLLEYLCRSRTYSAVLSSRIQMLR
Ga0209839_1000899953300026294SoilLRFALISAIALCAEPRFQKKARGFLQGLSTDELQYIAEFLGACMLETSWRSDAFSRADMAEGIFQYEQICHAHQDSPADPEHKMILLLEYLCRSQPTHCALAVRAERL
Ga0209007_107019613300027652Forest SoilLRTSLISAITACADDRLQKKARWFLQGLSNDELQYIAEFLGACVLESSRQEACSRRQLADGIAQFNRFRCAPCGGLNDPEHKMIVLLEYLCRCNLTRYSLAMRA
Ga0209333_1000727173300027676Forest SoilLISAITVSAEQRFQKKARKFLHGLSTDELQYIAEFLGACVLESWGRSAASRRELADGIAQFEQFRPARADHPGDQEHKMILLLEYLCRSRTYSAVLSSRIQILR
Ga0209908_1002749123300027745Thawing PermafrostMNITDVSVDAIVRLETRSSGLRTALISAIAACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRASADCLGDQEHKMILLLEYLCRSRLTHCSLALRAERT
Ga0209908_1023261823300027745Thawing PermafrostFQKKARKFLHGLSTDELQYIAEFLGACMLESLDGSALSRRELADGIAQFEQFRRAPAGCLSDQEHKMILLLEYLCYSRLTHCCLALRAERT
Ga0209060_1044785923300027826Surface SoilLRTALISAIAACAAKRFRKTARNFLQGLSTDELQYIAEYLGACVLESVEGAALSRAELAAGIAQFARVRQGNRPRGKDYEHKMILLLEYLCRCQLTHCSPGVRARGEPEPAL
Ga0209274_1052170413300027853SoilLISAIAACAERHFQRKARKFLQGLSTDELQYIADFLGACVLESLGRSACSRRELAESIAQFDQVRCAASDRPGDRQHKMILLLEYLCRTRLTHCSLALRAERT
Ga0209579_1000377323300027869Surface SoilLRTALISAIAECAEKRLRTKARRFLQGLSRDELQYIAQFLGACVLESAGRAACSRDQLADGIAYFEHVRSVQNGCLRDPEHKMILLLEYLCLCRIYSAAFNSRIQMFR
Ga0209380_1007303123300027889SoilVRTGLISAIAACAERHFQRKARKFLQGLSTDELQYIADFLGACVLESLGRSACSRRELAESIAQFDQVRCAASDRPGDRQHKMILLLEYLCRTRLTHCSLALRAERT
Ga0209698_1006436133300027911WatershedsLRTPLISAITVCAEQRFQKKARKFLQGLSKDELQYIAEFLGACVLESVGRSAVSRRELADRIAQFEQARRAPAGSFNDQEHKMIPLLEYLCRSQFTHCFLAVRAERM
Ga0209698_1048492423300027911WatershedsLRTTLISAITACAEQRLQKKARKFLQGLSRDELQYIAEFLGACVLESLGRNDLSRRELAEGIAHFEHIRHTPLDCSGDQEHKMILLLEYLCRSQLTHCPLAMRAGRT
Ga0209698_1051629923300027911WatershedsVRTALISAITAFADPRFQKKARKFLLGLSTVEMQYIAEFLGACILESLGRSAFSRRELADGIAQFEQVGRGPSACLGDREHKMILLLEYLCRSQLTHCSLAVRAERT
Ga0302219_1027457413300028747PalsaISAITACAEQRLQRKAHKFLLGLSTDELQYIAEFLGACVLESAGRAAFSRRDLAEGIAQFEQVRRATLDCCDDRAHKMILLLEYLCVSRLTYCSLAMRAERA
Ga0302202_1019898323300028762BogVRTALISAITVCAERRFQKKARKFLLGLSTDELQYIAGFLGACVLESAGNSALSRRDLAEAIAEFEQIRGASGASLADPEHKMILLLEYLCRTRLTHYSLALRAART
Ga0302234_1007215323300028773PalsaLRTALISAITACADDRLQKKARWFLQGLSNDELQYIAEFLGACVLESSRHEACISRRELADGIAHFDRLRSAPSGGPNDPEHKMIVLLEYLCRCKLTRYSLALRAERTL
Ga0302234_1053709013300028773PalsaISAITACAEQRFQKKARRFLLGLSTDELQYIAAFLGACVLESLGRSALRRHESADGTAELEQVGCARANRLSDQEHKMILLLEYLRRSRTYSAVLNSRIQMLR
Ga0302222_1010209623300028798PalsaLRTALISAITACADDRLQKKARWFLQGLSNDELQYIAEFLGACVLESSRHEACISRRELADGIAHFDRLRSAPGAGPHDQEHKMIVLLEYLCRCKLMRYSLAVRAGHTS
Ga0302229_1046193423300028879PalsaACAEQRFQKKARRFLLGLSTDELQYIAAFLGACVLESLGRSALRRHESADGTAELEQVGCARANRLSDQEHKMILLLEYLRRSRTYSAVLNSRIQMLR
Ga0311361_1028397823300029911BogVRTALISAITVCAERRFQKKARKFLLGLSTDELQYIAGFLGACVLESAGNSALSRRDLAEAIAEFEQIRGASGASLADPEHKMILLLEYLCRARLTHYSLALRAART
Ga0311363_1039117823300029922FenVRTALISAITVCAERRFQKKARKFLLGLSTDELQYIAGFLGACVLESAGNFALSRRELAEAIAEFEQIRGASGASLADPEHKMILLLEYLCRARLTHYSLALRAART
Ga0311340_1014363023300029943PalsaLRRALISAIAVCAAQRFQKKAREFLHGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRARAACLGDQEHKMIVLLEYLCRSRIYSAVLSSRIQMLR
Ga0311352_1095750313300029944PalsaPGSSGLRAALISAITACAEQRLQRKAHKFLLGLSTDELQYIAEFLGACVLESAGRAAFSRRDLAEGIAQFEQVRRATLDCCDDRAHKMILLLEYLCVSRLTYCSLAMRAERA
Ga0311352_1114667513300029944PalsaSAITACAEQRFQKKARRFLLGLSTDELQYIAAFLGACVLESLGRSALRRHESADGTAELEQVGCARANRLSDQEHKMILLLEYLRRSRTYSAVLNSRIQMLR
Ga0302150_1035732413300029956BogLITGVRVRTALISAITVCAERRFQKKARKFLLGLSTDELQYIAGFLGACVLESAGNSALSRRDLAEAIAEFEQIRGASGASLADPEHKMILLLEYLCRARLTHYSLALRAART
Ga0311339_1000488333300029999PalsaLRAALISAITACAEQRFQKKARRFLLGLSTDELQYIAAFLGACVLESLGRSALRRHESADGTAELEQVGCARANRLSDQEHKMILLLEYLRRSRTYSAVLNSRIQMLR
Ga0311339_1019094933300029999PalsaARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRASADCLGDQEHKMILLLEYLCRSRLTHCSLALRAERT
Ga0302177_1029099123300030053PalsaAIVRLETRSSGLRTALISAIAACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRASADCLGDQEHKMILLLEYLCRSRLTHCSLALRAERT
Ga0302184_1012812723300030490PalsaDRLQKKARWFLQGLSNDELQYIAEFLGACVLESSRHEACISRRELADGIAHFDRLRSAPSGGPNDPEHKMIVLLEYLCRCKLTRYSLALRAERTL
Ga0311372_1248530813300030520PalsaIRSSGLRTGLISAITACAERRFQKKARKFLHGLSTDELQYIAEFLGACMLESLDGSALSRRELADGIAQFEQFRRAPAGCLSDQEHKMILLLEYLCYSRLTHCCLALRAERT
Ga0311357_1157782313300030524PalsaRSSGLRRALISAIAVCAAQRFQKKAREFLHGLSTDELQYIAEFLGACVLESLGRSALSRRELADGIAQFEQVRRARAACLGDQEHKMIVLLEYLCRSRIYSAVLSSRIQMLR
Ga0265461_1223115713300030743SoilLRTALISAITACAEQRFQKRARSFLLGLSKDELQYIAEFLGACMLESVGRSAFSRRELAEGIAQFEQVRRAPADSLCDQEHKMILLLEYLCRSQLTHCSVAVRAART
Ga0265770_113255323300030878SoilAIVAYAEERLQTKARKFLQGLSQDELQYIAEFLGACALESVGDRTSNREELAEGIAQFERVRDAQAGRPSDREHKMILLLEYLCRANLTHCCFAARRVDGGSYSAASFNSRIQMLR
Ga0265760_1011138813300031090SoilKAREFLQGLSTDELQYIAEFLGACVLESVGHSPFDRRELAEGISQFDQARRPAVQCCSDREHKMILLLEYLCHSRLTQCSLAARAGRS
Ga0302325_1006820453300031234PalsaLRTGLISAITACAERRFQKKARKFLHGLSTDELQYIAEFLGACMLESLDGSALSRRELADGIAQFEQFRRAPAGCLSDQEHKMILLLEYLCYSRLTHCCLALRAERT
Ga0302325_1017159753300031234PalsaLRTALISAITACAEQRFQKKARKFLLGLSTDELQYIAEFLGACVLESGGSAALTRRELAYGIAQFEQVRRAPLNLLGDQEHKMILLLEYLCRSQLTHCSLAARAEQT
Ga0302326_1214794023300031525PalsaLRNALISAIVASVEQRFQRKARKFLLGLSTDELQYIAEFLGACILESAGGPALNRCELSESIAQFEQVRRARPASPPNQEHKMILLLEYLYRTQSTRCSLAARTERG
Ga0302326_1349361813300031525PalsaLRAALISAITACAEQRLQRKARKFLLGLSTDELQYIAEFLGACVLESAGRAAFSRRDLAEGIAQFEQVRRATLDCCDDRAHKMILLLEYLCVSRLTHCSLAVRA
Ga0311301_10001272353300032160Peatlands SoilLRTALISAIAVCAEQRFQKKARNFLQGLSTDELQYIAEFLGACVLESLGHSAFTRRELAEGIAHFEQVRGAPAECAGDREHKMILLLEYLCRSQLAHCSLAVRAGRT
Ga0311301_1003598263300032160Peatlands SoilLRTALISAITACTEQRFRKKARNFLQGLSRDELQYIAEFLGACVLESEGRSALSRRELADDIAQFEQVRCAPPDSPRDREHLMILLLEYLCRSRTYSAALSSRIQMLR
Ga0311301_1026756433300032160Peatlands SoilLRTALISAISACAEQRFQRKARKFLLGLSTDELQYIAEFLGACVLESLGRSALSRRELAEGIAQFEQIRRESAERFNDREHKMILLLEYLCRSQLTHCSLALPAERT
Ga0335085_10000061543300032770SoilLISAIAACVDQRLQRQARKFLLGLSTDELQYIADFLGACALESVVRSTATRRELAEHVAHFSHLRASARAAGPRDRDHKMILLWEYLRRCEPAQQSHAAGEA
Ga0335079_1067678013300032783SoilLRTALISAISACAGPRFRKKARRFLQGLSRDELQYIAEFLGACVLESSGRRAGRRRQLAEGVAHFAQLRRAPLGCDEDQAHKMILLLEYLCRCRLTCGTLPARDERTNPDLLSRL
Ga0335079_1212197013300032783SoilKKARTFLQGLSRDELQYIAEYLGACVLESVDRAARSRAELAGGIAQFDQMRTARVACLDDHEHKMILLLEYLSCCNLSYCSLAARAGRV
Ga0335078_1001473763300032805SoilLRTALISAITVCAEERFQKKARKFLLGLSRDELQYIAEFLGACVLESWGPAPLGRRELADGIAHFEQVRSACRNRGGDREHKMILLLEYLCRSRLTHCSLAVRTERT
Ga0335078_1003884063300032805SoilLRTALISAITECAEQRFQKKARRFLLGLSIDELQYIAEFLGACVLESLGSSALSRRELADGIAQFEQVRYTRADCPSDQEHKMILLLEYLCRSRLMHCPLALRAERA
Ga0335078_1016805933300032805SoilVRPALISAIAACAEHRSQRKARKFLQGLSTDELQYIAEFLGAYVLESGQPGFSRRELADHIARFEQVRCAPPKCRADQDHKMILLLEYMCSSGSGRLALRA
Ga0335078_1078178723300032805SoilLRTALISAISACAGPRFRKKARRFLQGLSRDELQYIAEFLGACVLESSGRRAGRRRQLAEGVAHFAQLRRAPLGCDEDQAHKMILLMEYLCRCRLTCGTLPARDERTNPDLLSRL
Ga0335081_1046033333300032892SoilRKKARRFLQGLSRDELQYIAEFLGACVLESSGRRAGRRRQLAEGVAHFAQLRRAPLGCDEDQAHKMILLMEYLCRCRLTCGTLPARDERTNPDLLSRL
Ga0335081_1108374333300032892SoilKALVCAAAAYVDERLQKKARRFLQGLSTDELQYIAEFLGACVIESWGNAVCSRRRLADGIAYFDRCRSTPAGCLSDQEHKMILLLEYLCRCQLTHYSLAERAGRT
Ga0335069_1188643723300032893SoilLRTTLVSAIAACVDQRLQRKARKFLLGLSTDELQYIADFLGACALESVARSTATRGELADHVAHFSHLRGAARAAGPGDRDHKMILLWEYLRRCQPAHSSRAARAGQP
Ga0335072_1015765023300032898SoilLRTALISAITASAERRFQKKARDFLLGLSTDELQYIAEFLGACVLESAGRAAISRRELAEGIALFEHTRHTAAGRLDDREHKMILLLEYLCRSRLAYCSLAMRAGSA
Ga0334828_024745_206_5173300033822SoilLISAITVCAERRFQKKARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRSELADGIAHFEQVGRASPDCGSDQEHKMILLLEYLCHSRITNCSLAAPAGRL
Ga0334837_009783_3313_36243300033823SoilLISAIALCAERRFQKNARKFLQGLSRDELQYIAEFLGACVLESLGRSALSRRELADGIAHFEQVRRASPDCGGDREHKMILLLEYLCRSQLTNCSLAAPAGRL
Ga0334790_008553_2434_27453300033887SoilLITAITACAEQRLQRKARRFLAGLSTDELQYIAEFLGACVLECSGRPAASRGELAEGIAQFEQVRHARPDCPADREHKMILLLEYLCRSRVAHCSLGLRAERA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.