NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064244

Metagenome / Metatranscriptome Family F064244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064244
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 49 residues
Representative Sequence ENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Number of Associated Samples 104
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 5.43 %
% of genes near scaffold ends (potentially truncated) 92.25 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (89.922 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.279 % of family members)
Environment Ontology (ENVO) Unclassified
(29.457 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.760 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 87.23%    β-sheet: 0.00%    Coil/Unstructured: 12.77%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00072Response_reg 6.98
PF135322OG-FeII_Oxy_2 5.43
PF00210Ferritin 5.43
PF00582Usp 3.10
PF12161HsdM_N 2.33
PF14947HTH_45 0.78
PF00382TFIIB 0.78
PF00171Aldedh 0.78
PF00211Guanylate_cyc 0.78
PF13365Trypsin_2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.78
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.78
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.78
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.92 %
UnclassifiedrootN/A10.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886006|SwRhRL3b_contig_2189459All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon887Open in IMG/M
3300000881|JGI10215J12807_1008591All Organisms → cellular organisms → Archaea1294Open in IMG/M
3300003371|JGI26145J50221_1003389All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1268Open in IMG/M
3300004013|Ga0055465_10110802All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon832Open in IMG/M
3300004480|Ga0062592_100343560All Organisms → cellular organisms → Archaea1156Open in IMG/M
3300005093|Ga0062594_100987953Not Available808Open in IMG/M
3300005186|Ga0066676_10068613All Organisms → cellular organisms → Archaea2073Open in IMG/M
3300005340|Ga0070689_101114893All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon706Open in IMG/M
3300005345|Ga0070692_11111048Not Available558Open in IMG/M
3300005440|Ga0070705_100641646All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon827Open in IMG/M
3300005441|Ga0070700_100212260All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1366Open in IMG/M
3300005457|Ga0070662_101184361All Organisms → cellular organisms → Archaea657Open in IMG/M
3300005458|Ga0070681_11724884Not Available553Open in IMG/M
3300005558|Ga0066698_10023464All Organisms → cellular organisms → Archaea3649Open in IMG/M
3300005617|Ga0068859_102969945All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon518Open in IMG/M
3300006844|Ga0075428_100336110All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1622Open in IMG/M
3300006844|Ga0075428_100417111All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1438Open in IMG/M
3300006844|Ga0075428_100651189All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1123Open in IMG/M
3300006846|Ga0075430_101631305All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon529Open in IMG/M
3300006871|Ga0075434_100939091All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon879Open in IMG/M
3300006880|Ga0075429_100476645All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1093Open in IMG/M
3300006880|Ga0075429_101604686All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon565Open in IMG/M
3300006969|Ga0075419_10034071All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon3167Open in IMG/M
3300006969|Ga0075419_10372372All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon974Open in IMG/M
3300006969|Ga0075419_10896998All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon639Open in IMG/M
3300009081|Ga0105098_10103864All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1230Open in IMG/M
3300009100|Ga0075418_12896734All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon524Open in IMG/M
3300009147|Ga0114129_10932239All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1098Open in IMG/M
3300009147|Ga0114129_11209015All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon941Open in IMG/M
3300009147|Ga0114129_11970228All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon707Open in IMG/M
3300009147|Ga0114129_13331791All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon519Open in IMG/M
3300009156|Ga0111538_11481469All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon856Open in IMG/M
3300009156|Ga0111538_11658065All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon806Open in IMG/M
3300009156|Ga0111538_13518859All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon543Open in IMG/M
3300009799|Ga0105075_1027644All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon632Open in IMG/M
3300009801|Ga0105056_1033366Not Available676Open in IMG/M
3300009803|Ga0105065_1026932All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon715Open in IMG/M
3300009813|Ga0105057_1104336All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon527Open in IMG/M
3300009816|Ga0105076_1032157Not Available928Open in IMG/M
3300009817|Ga0105062_1015746All Organisms → cellular organisms → Archaea1236Open in IMG/M
3300009818|Ga0105072_1021572All Organisms → cellular organisms → Archaea1177Open in IMG/M
3300009820|Ga0105085_1104672Not Available556Open in IMG/M
3300009837|Ga0105058_1045481All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon974Open in IMG/M
3300010029|Ga0105074_1045258All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon771Open in IMG/M
3300012519|Ga0157352_1092073All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon525Open in IMG/M
3300012908|Ga0157286_10075573All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon933Open in IMG/M
3300012912|Ga0157306_10335326All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon568Open in IMG/M
3300013102|Ga0157371_11131167All Organisms → cellular organisms → Archaea601Open in IMG/M
3300015077|Ga0173483_10710524All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon569Open in IMG/M
3300015372|Ga0132256_103406001All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon535Open in IMG/M
3300015372|Ga0132256_103811828All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon507Open in IMG/M
3300015373|Ga0132257_102345163All Organisms → cellular organisms → Archaea692Open in IMG/M
3300015373|Ga0132257_102542196All Organisms → cellular organisms → Archaea665Open in IMG/M
3300015374|Ga0132255_104657632All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon581Open in IMG/M
3300017997|Ga0184610_1028649All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1549Open in IMG/M
3300018027|Ga0184605_10189557All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon932Open in IMG/M
3300018028|Ga0184608_10266239All Organisms → cellular organisms → Archaea754Open in IMG/M
3300018028|Ga0184608_10333530All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon666Open in IMG/M
3300018031|Ga0184634_10475877All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon560Open in IMG/M
3300018031|Ga0184634_10518100All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon531Open in IMG/M
3300018051|Ga0184620_10015048Not Available1833Open in IMG/M
3300018052|Ga0184638_1016219All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales2588Open in IMG/M
3300018052|Ga0184638_1017682Not Available2494Open in IMG/M
3300018052|Ga0184638_1335187All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon508Open in IMG/M
3300018053|Ga0184626_10229937All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon781Open in IMG/M
3300018054|Ga0184621_10039396All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1543Open in IMG/M
3300018054|Ga0184621_10175067All Organisms → cellular organisms → Archaea771Open in IMG/M
3300018061|Ga0184619_10030218All Organisms → cellular organisms → Archaea2279Open in IMG/M
3300018074|Ga0184640_10438527All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon582Open in IMG/M
3300018075|Ga0184632_10042020All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales1965Open in IMG/M
3300018075|Ga0184632_10045332Not Available1892Open in IMG/M
3300018075|Ga0184632_10108377All Organisms → cellular organisms → Archaea1219Open in IMG/M
3300018076|Ga0184609_10581011All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon504Open in IMG/M
3300018082|Ga0184639_10546655All Organisms → cellular organisms → Archaea576Open in IMG/M
3300018920|Ga0190273_12022069All Organisms → cellular organisms → Archaea534Open in IMG/M
3300019867|Ga0193704_1043480All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon890Open in IMG/M
3300019867|Ga0193704_1052595All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon794Open in IMG/M
3300019869|Ga0193705_1012216All Organisms → cellular organisms → Archaea1877Open in IMG/M
3300021073|Ga0210378_10213684All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon734Open in IMG/M
3300021078|Ga0210381_10018169All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1829Open in IMG/M
3300021078|Ga0210381_10057614All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1181Open in IMG/M
3300021344|Ga0193719_10212064All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon825Open in IMG/M
3300021510|Ga0222621_1098713All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon619Open in IMG/M
3300022534|Ga0224452_1009505All Organisms → cellular organisms → Archaea2506Open in IMG/M
3300022534|Ga0224452_1134911Not Available760Open in IMG/M
3300022694|Ga0222623_10257779All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon672Open in IMG/M
3300022899|Ga0247795_1048491All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon711Open in IMG/M
3300023071|Ga0247752_1034222All Organisms → cellular organisms → Archaea760Open in IMG/M
3300023261|Ga0247796_1089010All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon581Open in IMG/M
3300023274|Ga0247763_1230081All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon527Open in IMG/M
3300025795|Ga0210114_1011103All Organisms → cellular organisms → Archaea2023Open in IMG/M
3300025904|Ga0207647_10078060Not Available1989Open in IMG/M
3300025912|Ga0207707_10177346All Organisms → cellular organisms → Archaea1861Open in IMG/M
3300025926|Ga0207659_11479696All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon581Open in IMG/M
3300025942|Ga0207689_10709352Not Available848Open in IMG/M
3300025961|Ga0207712_10360883All Organisms → cellular organisms → Archaea1210Open in IMG/M
3300025986|Ga0207658_11272948All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon672Open in IMG/M
3300026095|Ga0207676_10138909All Organisms → cellular organisms → Archaea2077Open in IMG/M
3300026116|Ga0207674_10267402All Organisms → cellular organisms → Archaea1657Open in IMG/M
3300026118|Ga0207675_100382569All Organisms → cellular organisms → Archaea1384Open in IMG/M
3300026142|Ga0207698_11602592Not Available666Open in IMG/M
3300026324|Ga0209470_1031563All Organisms → cellular organisms → Archaea2714Open in IMG/M
3300027364|Ga0209967_1031662All Organisms → cellular organisms → Archaea792Open in IMG/M
3300027490|Ga0209899_1028917All Organisms → cellular organisms → Archaea1212Open in IMG/M
3300027526|Ga0209968_1011137All Organisms → cellular organisms → Archaea1389Open in IMG/M
3300027614|Ga0209970_1002415All Organisms → cellular organisms → Archaea3181Open in IMG/M
3300027682|Ga0209971_1051341All Organisms → cellular organisms → Archaea996Open in IMG/M
3300027722|Ga0209819_10015260All Organisms → cellular organisms → Archaea2514Open in IMG/M
3300028381|Ga0268264_11030181All Organisms → cellular organisms → Archaea830Open in IMG/M
3300028715|Ga0307313_10221248All Organisms → cellular organisms → Archaea588Open in IMG/M
3300028807|Ga0307305_10161020All Organisms → cellular organisms → Archaea1035Open in IMG/M
3300028814|Ga0307302_10210364All Organisms → cellular organisms → Archaea950Open in IMG/M
3300028828|Ga0307312_10098654All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1808Open in IMG/M
3300028828|Ga0307312_10758192All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon643Open in IMG/M
3300028875|Ga0307289_10143935All Organisms → cellular organisms → Archaea979Open in IMG/M
3300028884|Ga0307308_10425060All Organisms → cellular organisms → Archaea637Open in IMG/M
3300028885|Ga0307304_10406441All Organisms → cellular organisms → Archaea615Open in IMG/M
3300030990|Ga0308178_1024227All Organisms → cellular organisms → Archaea989Open in IMG/M
3300030993|Ga0308190_1040520All Organisms → cellular organisms → Archaea862Open in IMG/M
3300031538|Ga0310888_10085011All Organisms → cellular organisms → Archaea1574Open in IMG/M
3300031854|Ga0310904_10008725All Organisms → cellular organisms → Archaea3990Open in IMG/M
3300031854|Ga0310904_10964667All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon605Open in IMG/M
3300031913|Ga0310891_10285255All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon578Open in IMG/M
3300031944|Ga0310884_10163100All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1161Open in IMG/M
3300032000|Ga0310903_10283988All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon808Open in IMG/M
3300032421|Ga0310812_10049874All Organisms → cellular organisms → Archaea1608Open in IMG/M
3300033417|Ga0214471_11196216All Organisms → cellular organisms → Archaea578Open in IMG/M
3300034644|Ga0370548_026851All Organisms → cellular organisms → Archaea918Open in IMG/M
3300034644|Ga0370548_089246All Organisms → cellular organisms → Archaea609Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.28%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment15.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.95%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand8.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.10%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.55%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.55%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886006Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300003371Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PMHost-AssociatedOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009813Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300023274Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL3b_0651.000008802162886006Switchgrass RhizosphereMHENAVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
JGI10215J12807_100859143300000881SoilANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
JGI26145J50221_100338913300003371Arabidopsis Thaliana RhizosphereQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0055465_1011080213300004013Natural And Restored WetlandsENSVQYYKQKANEELDKMEKNIQSGNKLSAINGKLLADTYISFATTI*
Ga0062592_10034356013300004480SoilKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0062594_10098795313300005093SoilQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI*
Ga0066676_1006861333300005186SoilMHENSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0070689_10111489323300005340Switchgrass RhizosphereKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0070692_1111104813300005345Corn, Switchgrass And Miscanthus RhizosphereMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI*
Ga0070705_10064164623300005440Corn, Switchgrass And Miscanthus RhizosphereLNHKISADYSELMRKVSEGFRGLQESTTEYYKQKAREELDKMENNIQSGNNLSAINEKLLADTYISLATTL*
Ga0070700_10021226013300005441Corn, Switchgrass And Miscanthus RhizosphereNSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0070662_10118436113300005457Corn RhizosphereMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0070681_1172488413300005458Corn RhizosphereNSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI*
Ga0066698_10023464103300005558SoilFRDMHENSVQYYKQKANEELDKMEENIRSGNKLSAINEKLLADTYLCLATTI*
Ga0068859_10296994523300005617Switchgrass RhizosphereMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0075428_10033611013300006844Populus RhizosphereSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0075428_10041711113300006844Populus RhizosphereENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYISFATTI*
Ga0075428_10065118913300006844Populus RhizosphereENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0075430_10163130513300006846Populus RhizosphereSADYNELMKKLSESFRDMHENSVQYYKQKANEELDKMEKNLQSGNKLSAINEKLLADTYLSFATTI*
Ga0075434_10093909113300006871Populus RhizosphereMSESFRDMHENSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLS
Ga0075429_10047664513300006880Populus RhizosphereNSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYISFATTI*
Ga0075429_10160468623300006880Populus RhizosphereSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0075419_1003407183300006969Populus RhizosphereLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0075419_1037237243300006969Populus RhizosphereHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYISFATTI*
Ga0075419_1089699823300006969Populus RhizosphereSVQYYKQKANDELDKMEKNIQSGNKLSAINEKLLADTYLSLATTI*
Ga0105098_1010386413300009081Freshwater SedimentMKKLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0075418_1289673413300009100Populus RhizosphereKANDELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0114129_1093223933300009147Populus RhizosphereQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYISFATTI*
Ga0114129_1120901523300009147Populus RhizosphereELMKKLSESFRDMHENSVQYYKQKANEELDKMEKNLQSGNKLSAINEKLLADTYLSFATTI*
Ga0114129_1197022813300009147Populus RhizosphereNSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLATTI*
Ga0114129_1333179113300009147Populus RhizosphereKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI*
Ga0111538_1148146913300009156Populus RhizosphereMSESFRDMHENSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTY
Ga0111538_1165806513300009156Populus RhizosphereKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLATTI*
Ga0111538_1351885923300009156Populus RhizosphereYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0105075_102764413300009799Groundwater SandKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0105056_103336623300009801Groundwater SandQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSWATTI*
Ga0105065_102693213300009803Groundwater SandKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0105057_110433613300009813Groundwater SandKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0105076_103215713300009816Groundwater SandHELSADYNELMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSWATTI*
Ga0105062_101574613300009817Groundwater SandHELSADYNELMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0105072_102157213300009818Groundwater SandVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI*
Ga0105085_110467213300009820Groundwater SandMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSWATTI*
Ga0105058_104548113300009837Groundwater SandNYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLS*
Ga0105074_104525813300010029Groundwater SandMHENSVQNYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLS*
Ga0157352_109207313300012519Unplanted SoilQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0157286_1007557323300012908SoilELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0157306_1033532623300012912SoilYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0157371_1113116723300013102Corn RhizosphereKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0173483_1071052423300015077SoilENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI*
Ga0132256_10340600113300015372Arabidopsis RhizosphereNEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0132256_10381182813300015372Arabidopsis RhizosphereVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0132257_10234516313300015373Arabidopsis RhizosphereEDSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0132257_10254219613300015373Arabidopsis RhizosphereEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0132255_10465763213300015374Arabidopsis RhizosphereSVKYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*
Ga0184610_102864913300017997Groundwater SedimentVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSLATTI
Ga0184605_1018955713300018027Groundwater SedimentRDMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0184608_1026623923300018028Groundwater SedimentKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184608_1033353013300018028Groundwater SedimentSFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0184634_1047587713300018031Groundwater SedimentQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184634_1051810013300018031Groundwater SedimentADYNELMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSWATTI
Ga0184620_1001504843300018051Groundwater SedimentMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184638_101621913300018052Groundwater SedimentSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFTTTI
Ga0184638_101768213300018052Groundwater SedimentSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184638_133518723300018052Groundwater SedimentSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSWATTI
Ga0184626_1022993723300018053Groundwater SedimentESYRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184621_1003939633300018054Groundwater SedimentQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0184621_1017506723300018054Groundwater SedimentQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0184619_1003021863300018061Groundwater SedimentELMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0184640_1043852713300018074Groundwater SedimentCNSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLS
Ga0184632_1004202033300018075Groundwater SedimentKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFTTTI
Ga0184632_1004533243300018075Groundwater SedimentANEELDKMEKNIQSGNKLSAINEKLLADTYLSFTTTI
Ga0184632_1010837723300018075Groundwater SedimentKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0184609_1058101113300018076Groundwater SedimentKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0184639_1054665523300018082Groundwater SedimentSFRDMHENSGQYYKQKANEELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0190273_1202206913300018920SoilEPNHKISADYSDLMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0193704_104348033300019867SoilNHKISADYSELMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0193704_105259523300019867SoilSSDYNELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0193705_101221633300019869SoilMHENSVQYYKQKANVELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0210378_1021368423300021073Groundwater SedimentVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLS
Ga0210381_1001816913300021078Groundwater SedimentSMQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0210381_1005761413300021078Groundwater SedimentNHKISADYSELMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKILIDTYLSLATHL
Ga0193719_1021206433300021344SoilWMKKVDERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0222621_109871313300021510Groundwater SedimentMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0224452_100950513300022534Groundwater SedimentNSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFTTTI
Ga0224452_113491123300022534Groundwater SedimentNKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0222623_1025777913300022694Groundwater SedimentESFRNMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0247795_104849123300022899SoilQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0247752_103422223300023071SoilHKLSADYNELMKKLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0247796_108901013300023261SoilHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0247763_123008113300023274Plant LitterLSSDYNELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0210114_101110343300025795Natural And Restored WetlandsSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0207647_1007806013300025904Corn RhizosphereMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0207707_1017734653300025912Corn RhizosphereKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0207659_1147969613300025926Miscanthus RhizosphereESFRDMHEESVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0207689_1070935213300025942Miscanthus RhizosphereLHHELSSDYNELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0207712_1036088333300025961Switchgrass RhizosphereYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0207658_1127294813300025986Switchgrass RhizosphereKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0207676_1013890923300026095Switchgrass RhizosphereVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0207674_1026740213300026116Corn RhizosphereESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0207675_10038256913300026118Switchgrass RhizosphereYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0207698_1160259223300026142Corn RhizosphereLSADYNELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0209470_103156323300026324SoilMHENSVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0209967_103166213300027364Arabidopsis Thaliana RhizosphereKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0209899_102891713300027490Groundwater SandHELSADYNELMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0209968_101113713300027526Arabidopsis Thaliana RhizosphereLMKKLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0209970_100241563300027614Arabidopsis Thaliana RhizosphereQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0209971_105134133300027682Arabidopsis Thaliana RhizosphereNEELDKMEKNIQSGNKLSAINEKLLADTYLSFATTI
Ga0209819_1001526043300027722Freshwater SedimentQKANEELDKMEKNIQSGNKLGAINEKLLADTYLSFATTI
Ga0268264_1103018113300028381Switchgrass RhizosphereMHEESVQYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0307313_1022124823300028715SoilNANEELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0307305_1016102013300028807SoilNEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0307302_1021036413300028814SoilMKKVSKSFRDMHENSVQYYKQKANEELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0307312_1009865433300028828SoilKENEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0307312_1075819213300028828SoilYSELMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKLLIDTYLSMATTL
Ga0307289_1014393513300028875SoilSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0307308_1042506023300028884SoilMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0307304_1040644113300028885SoilQKANVELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0308178_102422713300030990SoilDYNELMKKVSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINEKLLADTYLSFAITI
Ga0308190_104052033300030993SoilENSMQYYKQKANVELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0310888_1008501123300031538SoilDMHENSVQYYKQKANDELDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0310904_1000872513300031854SoilENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0310904_1096466713300031854SoilNLSESFRDMHENSVQYYKQKANEELDKMEKNIQAGNKLSAINQKLLADTYISFATTL
Ga0310891_1028525513300031913SoilYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0310884_1016310033300031944SoilRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0310903_1028398813300032000SoilLELSSDYNELMKNLSESFRDMHENSVQYYKQKANEELDKMEKNIQSGNKLSAINQKLLADTYLSFATTI
Ga0310812_1004987413300032421SoilKMSESFRDMHEDSVKYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI
Ga0214471_1119621613300033417SoilYKQKANEELDKMEKNIESGNKLGAINEKLLADTYLSFATTI
Ga0370548_026851_700_8793300034644SoilMKKVSKSFRDMHENSVQYYKQKANVELDKMEENIRSGNKLSAINEKLLADTYLSLATTI
Ga0370548_089246_19_1953300034644SoilMKKVGERFHGMPESTAEYYKQKEEEIDKMEKNIQSGNKLSVINEKILIDKYLSLTPTL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.