NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064127

Metagenome / Metatranscriptome Family F064127

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064127
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 46 residues
Representative Sequence MKRRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA
Number of Associated Samples 103
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.86 %
% of genes near scaffold ends (potentially truncated) 22.48 %
% of genes from short scaffolds (< 2000 bps) 79.84 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.419 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.930 % of family members)
Environment Ontology (ENVO) Unclassified
(34.884 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.388 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 43.06%    β-sheet: 0.00%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00664ABC_membrane 51.94
PF02735Ku 3.88
PF03466LysR_substrate 1.55
PF07721TPR_4 0.78
PF08240ADH_N 0.78
PF00501AMP-binding 0.78
PF00005ABC_tran 0.78
PF13463HTH_27 0.78
PF13424TPR_12 0.78
PF00583Acetyltransf_1 0.78
PF10741T2SSM_b 0.78
PF03606DcuC 0.78
PF13508Acetyltransf_7 0.78
PF04417DUF501 0.78
PF07291MauE 0.78
PF13628DUF4142 0.78
PF00528BPD_transp_1 0.78
PF07969Amidohydro_3 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 3.88
COG1507Uncharacterized conserved protein, DUF501 familyFunction unknown [S] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.42 %
UnclassifiedrootN/A25.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459021|G14TP7Y02JELPANot Available514Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104713145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium592Open in IMG/M
3300000956|JGI10216J12902_102009335Not Available556Open in IMG/M
3300001686|C688J18823_10491380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300002568|C688J35102_118902611Not Available611Open in IMG/M
3300002568|C688J35102_120598377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300002568|C688J35102_120948298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2831Open in IMG/M
3300004081|Ga0063454_100138487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1260Open in IMG/M
3300004153|Ga0063455_100803442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300004479|Ga0062595_100776695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300005163|Ga0066823_10076655Not Available650Open in IMG/M
3300005164|Ga0066815_10079514All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005184|Ga0066671_10260225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1073Open in IMG/M
3300005293|Ga0065715_10523028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium762Open in IMG/M
3300005327|Ga0070658_10465721All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300005329|Ga0070683_101080524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300005364|Ga0070673_100811835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300005436|Ga0070713_100682559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium980Open in IMG/M
3300005456|Ga0070678_101101483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300005526|Ga0073909_10128118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1036Open in IMG/M
3300005529|Ga0070741_10000074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria356480Open in IMG/M
3300005529|Ga0070741_10120766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2708Open in IMG/M
3300005529|Ga0070741_10934541All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005530|Ga0070679_101350857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium659Open in IMG/M
3300005532|Ga0070739_10000383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria87796Open in IMG/M
3300005535|Ga0070684_101094935All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005547|Ga0070693_101654846Not Available504Open in IMG/M
3300005549|Ga0070704_100842872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300005564|Ga0070664_100242021All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300005614|Ga0068856_101106129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300005713|Ga0066905_100939450All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300006163|Ga0070715_10800563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300006358|Ga0068871_100389749All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300006578|Ga0074059_11546546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300006755|Ga0079222_11695473Not Available605Open in IMG/M
3300006852|Ga0075433_10075619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2964Open in IMG/M
3300006881|Ga0068865_101591246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300007076|Ga0075435_100218098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1620Open in IMG/M
3300009098|Ga0105245_10556778All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300009174|Ga0105241_10398750All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300009176|Ga0105242_10376147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300009840|Ga0126313_11798406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300010366|Ga0126379_13144307Not Available553Open in IMG/M
3300010371|Ga0134125_10675668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1139Open in IMG/M
3300010375|Ga0105239_11604947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300010376|Ga0126381_100106957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3586Open in IMG/M
3300010396|Ga0134126_11357145Not Available786Open in IMG/M
3300011998|Ga0120114_1045174All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300012011|Ga0120152_1027511All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300012014|Ga0120159_1055077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300012043|Ga0136631_10201502All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300012200|Ga0137382_10348473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300012202|Ga0137363_11809088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012203|Ga0137399_10232043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300012208|Ga0137376_11273650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium625Open in IMG/M
3300012212|Ga0150985_101000875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300012212|Ga0150985_101670690Not Available540Open in IMG/M
3300012212|Ga0150985_114292009Not Available896Open in IMG/M
3300012469|Ga0150984_100636176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1030Open in IMG/M
3300012469|Ga0150984_100807729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300012469|Ga0150984_114233421Not Available553Open in IMG/M
3300012685|Ga0137397_10629618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300012918|Ga0137396_10508858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300012922|Ga0137394_10804587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium788Open in IMG/M
3300012923|Ga0137359_10058638All Organisms → cellular organisms → Bacteria3353Open in IMG/M
3300012929|Ga0137404_10572683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300012944|Ga0137410_10037352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3419Open in IMG/M
3300012951|Ga0164300_10787918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium587Open in IMG/M
3300012955|Ga0164298_10093928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1572Open in IMG/M
3300012955|Ga0164298_10590364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300012957|Ga0164303_10190131All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300012958|Ga0164299_11419526Not Available537Open in IMG/M
3300012961|Ga0164302_10005922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium4458Open in IMG/M
3300012971|Ga0126369_10566372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1202Open in IMG/M
3300012984|Ga0164309_10476362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300012984|Ga0164309_10485025All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300012985|Ga0164308_10183949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300012985|Ga0164308_12058282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium532Open in IMG/M
3300012986|Ga0164304_10210229All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300012986|Ga0164304_10411982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300012988|Ga0164306_10585571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300012988|Ga0164306_10821344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300012988|Ga0164306_11830612All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012989|Ga0164305_10691144All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300013308|Ga0157375_11688762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300013763|Ga0120179_1120811Not Available576Open in IMG/M
3300013770|Ga0120123_1035567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300014154|Ga0134075_10546632Not Available522Open in IMG/M
3300015209|Ga0167629_1007740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4060Open in IMG/M
3300015241|Ga0137418_10172289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1890Open in IMG/M
3300015371|Ga0132258_13470758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300015374|Ga0132255_100573003All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300019361|Ga0173482_10289506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300021363|Ga0193699_10004525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5058Open in IMG/M
3300021363|Ga0193699_10244451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium747Open in IMG/M
3300021415|Ga0193694_1031019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300025912|Ga0207707_11238035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300025916|Ga0207663_10611214Not Available857Open in IMG/M
3300025926|Ga0207659_11861721Not Available510Open in IMG/M
3300025927|Ga0207687_10888665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300025927|Ga0207687_11317190Not Available621Open in IMG/M
3300025931|Ga0207644_11459298Not Available574Open in IMG/M
3300025939|Ga0207665_11192797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300025944|Ga0207661_10867657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300025960|Ga0207651_10799087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria836Open in IMG/M
3300026078|Ga0207702_11044752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300026078|Ga0207702_11249118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300026088|Ga0207641_11788793Not Available616Open in IMG/M
3300027773|Ga0209810_1000054All Organisms → cellular organisms → Bacteria335871Open in IMG/M
3300027775|Ga0209177_10446416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300028718|Ga0307307_10199415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300028824|Ga0307310_10050037Not Available1743Open in IMG/M
3300028824|Ga0307310_10190247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium965Open in IMG/M
3300028824|Ga0307310_10262476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales832Open in IMG/M
3300028824|Ga0307310_10667652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium532Open in IMG/M
3300033004|Ga0335084_11511686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil6.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.43%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.10%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.33%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.55%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4NP_003471902170459021Switchgrass, Maize And Mischanthus LitterMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA
INPhiseqgaiiFebDRAFT_10471314523300000364SoilMKKRLLFLLFVTGLLVLALGGWTVQGVRWAATGGWARGVPQPA*
JGI10216J12902_10200933513300000956SoilMKRKLFFTLLVTGLLLLALGGWTVDGLRWAFGGGSGRTAPAPA*
C688J18823_1049138023300001686SoilMARRRMTRSLPSMKRRLLFLLLVTGLLLLALGGWTVQGVRWTVSGGWLPLRHGAPQPV*
C688J35102_11890261123300002568SoilMWARRVTPSLLCMKRRFLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGAAPQPA*
C688J35102_12059837723300002568SoilMTHSLSSMKRRFLFLLIVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
C688J35102_12090182523300002568SoilMCRTGRARSLAHMKNRLLFLLLVTGLIVLALGGWTVRGLRWAVSGGRARSVPQPA*
C688J35102_12094829813300002568SoilMKKRLLILLLFTGLIVLALAGWSVQGVRWTVGGRWLRSGAALPEPA*
Ga0063454_10007240923300004081SoilMCGRADIRSLTSMKKRLLFLLLVTGLLVLALGGWTVQGLRWAATGGWVRGLPQPA*
Ga0063454_10013848723300004081SoilMCRTGRARSLAHMKNRLLFLLLVTGLIVLALGGWTVRGLRWTVSGGRARSVPQPA*
Ga0063455_10080344223300004153SoilMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGRVRGLPQPA*
Ga0062595_10012531033300004479SoilMYQADPRLTLTSMKKRLLFLLLVTGLLVLALGGWTVQGLRWATTGGWARGLPQPA*
Ga0062595_10077669523300004479SoilMKKRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA*
Ga0066823_1007665523300005163SoilMKRRLIFFLLVTGLLLLALGGWTVQGLRFAVSGGRRLPQPA*
Ga0066815_1007951423300005164SoilMTPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA*
Ga0066671_1026022523300005184SoilMKKTLLFVLLVAGLLVLALGGWTVQGLRWATTGGRARGAPQPA*
Ga0065715_1052302813300005293Miscanthus RhizosphereMKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA*
Ga0070658_1046572123300005327Corn RhizosphereMTPSLPCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA*
Ga0070683_10108052423300005329Corn RhizosphereMTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA*
Ga0066388_10705822023300005332Tropical Forest SoilMYHADPDRTLTGMKTRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA*
Ga0070673_10081183513300005364Switchgrass RhizosphereLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA*
Ga0070713_10068255923300005436Corn, Switchgrass And Miscanthus RhizosphereMKRRFLLLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA*
Ga0070711_10025677333300005439Corn, Switchgrass And Miscanthus RhizosphereMKRRLLILLLVTGLILLALGGWSVRGLRWTLSGGARHAPQPA*
Ga0070678_10110148323300005456Miscanthus RhizosphereMKRRLLFILLVTGLLLLALGGWSVRGLRWALSGGGRVPQPA*
Ga0073909_1012811823300005526Surface SoilMAPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA*
Ga0070741_100000743013300005529Surface SoilMCAGTSPPRFGAMKKRLLFLLVVTGLIVLALGGWTVQGLRWAVSGGFARGLPQPA*
Ga0070741_1012076613300005529Surface SoilRLLFLLLVTGLIVLALGGWTIKGLRRAAGAGRGGPLPQPA*
Ga0070741_1093454123300005529Surface SoilMSVSGRRRRFGDMKRHLLFLLRVTGLILLALGGWTVKGLRWAASAGRGGPLPQPA*
Ga0070679_10135085713300005530Corn RhizosphereMKRRFLFLLLITGLLALALGGWTVQGLRWAASGGRSRDVLQPA*
Ga0070739_10000383263300005532Surface SoilMEEGGPRRSLVGMKRRLLFVLLVTGLLVLALAGWTVQGLRWAASGGWTRPLPQPA*
Ga0070684_10109493513300005535Corn RhizosphereMTPSLSCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0070693_10165484623300005547Corn, Switchgrass And Miscanthus RhizosphereMTPSLSRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0070704_10084287223300005549Corn, Switchgrass And Miscanthus RhizosphereMKRRLFFLLLVTGLVVLAVGGWTVQGLRWAVTGGWSRGLPQPA*
Ga0070664_10024202123300005564Corn RhizosphereMTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA*
Ga0068856_10110612913300005614Corn RhizospherePCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0066905_10093945023300005713Tropical Forest SoilMKNRLLFLLLITGLLLLALGGWTVQGLRWAVAGGRARGVPQPA*
Ga0070715_1080056323300006163Corn, Switchgrass And Miscanthus RhizosphereSRAHSLGYMKNRLLFLLLVTGLILLALGGWTVQGLRWTVTGGRARTLPQPA*
Ga0068871_10038974923300006358Miscanthus RhizosphereMTPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA*
Ga0074059_1154654623300006578SoilMKRKLFFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRGLPQPA*
Ga0079222_1169547323300006755Agricultural SoilMTPNLMCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA*
Ga0075433_1007561943300006852Populus RhizosphereMCAVGRTRSLGDMNNRLLFLLLVTGLILLALGGWTVQGLRWAVSGGRTRGLPQPA*
Ga0068865_10159124613300006881Miscanthus RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGSARGTAAQPA*
Ga0075435_10021809813300007076Populus RhizosphereTRSLGDMNNRLLFLLLVTGLILLALGGWTVQGLRWAVSGGRTRGLPQPA*
Ga0105245_1055677823300009098Miscanthus RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA*
Ga0105241_1039875023300009174Corn RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0105242_1037614723300009176Miscanthus RhizosphereMDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA*
Ga0126313_1179840623300009840Serpentine SoilMKRRFFFLLVVTGLLLLALGGWTVQGLRWALSGGWARGSTEPLPA*
Ga0126308_1028130623300010040Serpentine SoilMNRKLLFVLIATGLILLALTAWTVDGLRWAFAGSRRTAPLPA*
Ga0126379_1314430723300010366Tropical Forest SoilMKRRLLFTLIVTGLLLLALGGWTVQGLRWTLGGGSRRLPQPA*
Ga0134125_1067566823300010371Terrestrial SoilMKRRLFLLLLVTGLLVLAVGGWTVQVLRWAVTGGWSRGLPQPA*
Ga0105239_1160494723300010375Corn RhizosphereRILFLLLVTGLLLLALGGWTVQGLRWALSGGSARGTAAQPA*
Ga0126381_10010695723300010376Tropical Forest SoilMKRRLFFMLLVTGLILLALAGWTVQGLRWAVSGGAAGVPQPA*
Ga0134126_1135714523300010396Terrestrial SoilMKRRLFFLLLVTGLLVLAVGGWTVQGLRWAVTGGWSRGLPQPA*
Ga0120114_104517433300011998PermafrostMRRRFIFFLFVTGLLLLALGGWAVQGLRFAVAGGRGRRPG*
Ga0120152_102751133300012011PermafrostMRRRFIFFLFVTGLLLLALGGWAVQGLRFAAAGGRGRRLPQPA*
Ga0120159_105507723300012014PermafrostMKRKLLMLLLITGLIVLALGGWTVKGLRWAVSGGSARGLPQPA*
Ga0136631_1020150233300012043Polar Desert SandMNRYFLLALLAFGLLMLALAGWTVQGLRWTLSGDGVAAAA*
Ga0137382_1034847323300012200Vadose Zone SoilMKRRFLLALLVTGLLVLALGGWTVQVLRWAATGGRSREVPQPA*
Ga0137363_1180908813300012202Vadose Zone SoilLVTGLLLLALGGWTVEGVRWAASGGRARGLPQPA*
Ga0137399_1023204313300012203Vadose Zone SoilMKMRLLFLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA*
Ga0137376_1127365023300012208Vadose Zone SoilMKRRFLLALLFTGLLVLALGGWTVQVLRWAATGGRSREVPQPA*
Ga0150985_10100087523300012212Avena Fatua RhizosphereVTGLLLLALGGWTVEGLRWALSGGWARGTAPQPA*
Ga0150985_10167069023300012212Avena Fatua RhizosphereMKRRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0150985_11429200913300012212Avena Fatua RhizosphereLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRGGLQPA*
Ga0137371_1106833013300012356Vadose Zone SoilMKRRLLFTLIATGLILLALAGWTVDGLRWAFGGSDSPAPAPA*
Ga0150984_10063617613300012469Avena Fatua RhizosphereMKRRLLFLLLVTGLLLLALGGWTVQGVRWTVSGGWLPLRHGAPQPV*
Ga0150984_10080772923300012469Avena Fatua RhizosphereFLLLVTGLLLLALGGWTVEGLRWALSGGWARGTAPQPA*
Ga0150984_11423342113300012469Avena Fatua RhizospherePPTLGDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGRVRGLPQPA*
Ga0137397_1062961813300012685Vadose Zone SoilFLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA*
Ga0137396_1050885823300012918Vadose Zone SoilMCAQAVARSLVRMKKRLLFLLLVTALLVLALGGWTMQGLRWAATSDRTPAVPQPA*
Ga0137394_1042501523300012922Vadose Zone SoilMCAQAVARSLVQMKKRLLFLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA*
Ga0137394_1080458713300012922Vadose Zone SoilMKKRVLLGLLVTGLLVLALGGWIVQGVRWAATGGRVRALPHPA*
Ga0137359_1005863823300012923Vadose Zone SoilMKRRFLFLLLITGLLVLALGGWTVQGLRWAAGGGRSRDVLQPA*
Ga0137404_1057268313300012929Vadose Zone SoilMKRRLLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLQPA*
Ga0137410_1003735223300012944Vadose Zone SoilMKKRVLLGLLVTGLLVLALGGWIVQGVRRAATGGRVRALPHPA*
Ga0164300_1078791823300012951SoilMKRRFLFLLLVTGLLVLALGGWTVQGLRWAANGGRSRDVLQPA*
Ga0164298_1009392823300012955SoilMKRRFLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLQPA*
Ga0164298_1059036423300012955SoilMKRKLLFLLLVTGLLLLAVGGWTVQGLRRATTGGWSRGLPQPA*
Ga0164303_1019013123300012957SoilMAARRMTPSLSGMKKRLLCLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA*
Ga0164299_1141952623300012958SoilKKRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA*
Ga0164301_1014435933300012960SoilMYPTCRPRSVAVMKRRLLLMLLVTGLILLALGGWTVRGLRWTLSAGPRRLPQPA*
Ga0164302_1000592263300012961SoilMYMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA*
Ga0126369_1056637223300012971Tropical Forest SoilMKNRLLFLLLVTGLILLALGGWTVQGLRWAVTGGRARGVPQPA*
Ga0164309_1047636223300012984SoilMKRRLLISLLVTGLILLALGGWSVRGLRWMLSGGARHVPQPA*
Ga0164309_1048502523300012984SoilMKRRVLFLLLVTGLLLLALGGWTIQGLRFAVSGGRRLPQPA*
Ga0164308_1018394933300012985SoilMKRKFFFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRGLPQPA*
Ga0164308_1205828223300012985SoilMKRRFLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLHPA*
Ga0164304_1021022923300012986SoilMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA*
Ga0164304_1041198223300012986SoilMKRKLLFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRSLPQPA*
Ga0164306_1058557113300012988SoilMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA*
Ga0164306_1082134423300012988SoilMKRRLIFFLLVTGLLLLALGGWTIQGLRFAVSGRRRLPQPA*
Ga0164306_1183061223300012988SoilMKKRLLFLLLVTGLLLLALGGWTVQGLRWALAGGWARGGTA
Ga0164305_1069114423300012989SoilMKKRLLFLLLVTGLLLLALGGWTVQGLHWALSGGWARSCAAQPA*
Ga0164305_1197196023300012989SoilMRADTRTRSLVHMKNRILFVLLVTGLIVLALGGWTVQGLRWAATGGRARGLPQPA*
Ga0157375_1168876223300013308Miscanthus RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA*
Ga0120179_112081113300013763PermafrostMRRRFIFFLFVTGLLLLALGGWAVQGLRFAAAGGRGRS
Ga0120123_103556723300013770PermafrostMRRRFIFFLFVTGLLLLALGGWAVQGLRFALAGGRGRRLPQPA*
Ga0134075_1054663223300014154Grasslands SoilMKRKLFLILIVTGLLLLLALGGWTVDGLRWAFSGGSARTSPAPA*
Ga0167629_100774043300015209Glacier Forefield SoilMKRKLLFLLLVTGLILLALGGWSARGLRWVTAGGWARGLPQPA*
Ga0137418_1017228923300015241Vadose Zone SoilMKKRLLLGLLVTGLLVLALGGWIVQGVRWAATGGRVRALPHPA*
Ga0132258_1347075823300015371Arabidopsis RhizosphereMKRRLFFLLVVTGLLVLAIGGWTVQGLRWAVTGGWSRGLPQPA*
Ga0132255_10057300323300015374Arabidopsis RhizosphereMKRRLFFILLVTGLILLALGGWTIKGLRWAAAGGRTTGVPQPA*
Ga0173482_1028950613300019361SoilLSCMKKRLLSLLLVTGLRRLALGGWTVQGLRWALTRGWARAGTAPQPA
Ga0193699_1000452553300021363SoilMKRRFLLALLVTGLLVLALGGWTVQVLRWAATGGRSREVPQPA
Ga0193699_1024445123300021363SoilMQQRLLFVLLVTGLLVLALGGWTVQGLRWLATAGRARGITQTA
Ga0193694_103101923300021415SoilGMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGAAAQPA
Ga0207707_1123803513300025912Corn RhizosphereAMKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA
Ga0207663_1061121423300025916Corn, Switchgrass And Miscanthus RhizosphereMKRRLIFFLFVTGLLLLALGGWTIRGLRFAVSGRRRLPQPA
Ga0207659_1186172123300025926Miscanthus RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA
Ga0207687_1088866523300025927Miscanthus RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALTGGWARGGTAPQPA
Ga0207687_1131719013300025927Miscanthus RhizosphereMKRRLLFILLVTGLLLLALGGWSVRGLRWALSGGGRVPQPA
Ga0207644_1038628623300025931Switchgrass RhizosphereMCGRADAHRLMDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA
Ga0207644_1145929823300025931Switchgrass RhizosphereMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA
Ga0207686_1003300933300025934Miscanthus RhizosphereMCGRADPHRLMDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA
Ga0207665_1119279723300025939Corn, Switchgrass And Miscanthus RhizosphereLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA
Ga0207661_1086765723300025944Corn RhizosphereMTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA
Ga0207651_1079908713300025960Switchgrass RhizospherePRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA
Ga0207702_1104475213300026078Corn RhizosphereRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA
Ga0207702_1124911823300026078Corn RhizosphereMKRRFLFLLLITGLLALALGGWTVQGLRWAASGGRSRDVLQPA
Ga0207641_1178879323300026088Switchgrass RhizosphereMTPSLPCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA
Ga0209810_10000542063300027773Surface SoilMEEGGPRRSLVGMKRRLLFVLLVTGLLVLALAGWTVQGLRWAASGGWTRPLPQPA
Ga0209177_1044641613300027775Agricultural SoilMKRRLFFLLVVTGLLVLAIGGWTVQGLRWAVTGGWSRGLPQPA
Ga0307307_1019941523300028718SoilRLLFLLLVTGLLLLALGGWTVHGLRWALSGGWARGAAAQPA
Ga0307310_1005003723300028824SoilVFLLVTGLLLLALGGWAVQGVRFAVSGGRRLPQAA
Ga0307310_1019024723300028824SoilMKRRFLFLLLVTGLLMLALGGWTVQGLRWAASGGRSRDV
Ga0307310_1026247623300028824SoilMKRRLLFFLLVTGLLVLALGGWTVQGLRFAAGGGRARRLPQPA
Ga0307310_1066765223300028824SoilMKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQTA
Ga0335084_1151168613300033004SoilFILLVTGLILLALGGWTIQGLRWAVAGGRSDTVPQPA
Ga0372946_0666136_170_3373300034384SoilMCGHDDARSLADVKKRLLVVLLVTGLLVLALGAWTVQGLRWAASGGWVRGVAQPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.