Basic Information | |
---|---|
Family ID | F064127 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 46 residues |
Representative Sequence | MKRRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 25.86 % |
% of genes near scaffold ends (potentially truncated) | 22.48 % |
% of genes from short scaffolds (< 2000 bps) | 79.84 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.419 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.930 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.884 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.388 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF00664 | ABC_membrane | 51.94 |
PF02735 | Ku | 3.88 |
PF03466 | LysR_substrate | 1.55 |
PF07721 | TPR_4 | 0.78 |
PF08240 | ADH_N | 0.78 |
PF00501 | AMP-binding | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF13463 | HTH_27 | 0.78 |
PF13424 | TPR_12 | 0.78 |
PF00583 | Acetyltransf_1 | 0.78 |
PF10741 | T2SSM_b | 0.78 |
PF03606 | DcuC | 0.78 |
PF13508 | Acetyltransf_7 | 0.78 |
PF04417 | DUF501 | 0.78 |
PF07291 | MauE | 0.78 |
PF13628 | DUF4142 | 0.78 |
PF00528 | BPD_transp_1 | 0.78 |
PF07969 | Amidohydro_3 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 3.88 |
COG1507 | Uncharacterized conserved protein, DUF501 family | Function unknown [S] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.42 % |
Unclassified | root | N/A | 25.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459021|G14TP7Y02JELPA | Not Available | 514 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104713145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 592 | Open in IMG/M |
3300000956|JGI10216J12902_102009335 | Not Available | 556 | Open in IMG/M |
3300001686|C688J18823_10491380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
3300002568|C688J35102_118902611 | Not Available | 611 | Open in IMG/M |
3300002568|C688J35102_120598377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300002568|C688J35102_120948298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2831 | Open in IMG/M |
3300004081|Ga0063454_100138487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1260 | Open in IMG/M |
3300004153|Ga0063455_100803442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300004479|Ga0062595_100776695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300005163|Ga0066823_10076655 | Not Available | 650 | Open in IMG/M |
3300005164|Ga0066815_10079514 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005184|Ga0066671_10260225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
3300005293|Ga0065715_10523028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 762 | Open in IMG/M |
3300005327|Ga0070658_10465721 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300005329|Ga0070683_101080524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300005364|Ga0070673_100811835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300005436|Ga0070713_100682559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 980 | Open in IMG/M |
3300005456|Ga0070678_101101483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300005526|Ga0073909_10128118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
3300005529|Ga0070741_10000074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 356480 | Open in IMG/M |
3300005529|Ga0070741_10120766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2708 | Open in IMG/M |
3300005529|Ga0070741_10934541 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300005530|Ga0070679_101350857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 659 | Open in IMG/M |
3300005532|Ga0070739_10000383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 87796 | Open in IMG/M |
3300005535|Ga0070684_101094935 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005547|Ga0070693_101654846 | Not Available | 504 | Open in IMG/M |
3300005549|Ga0070704_100842872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
3300005564|Ga0070664_100242021 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300005614|Ga0068856_101106129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300005713|Ga0066905_100939450 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300006163|Ga0070715_10800563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300006358|Ga0068871_100389749 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300006578|Ga0074059_11546546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300006755|Ga0079222_11695473 | Not Available | 605 | Open in IMG/M |
3300006852|Ga0075433_10075619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
3300006881|Ga0068865_101591246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300007076|Ga0075435_100218098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1620 | Open in IMG/M |
3300009098|Ga0105245_10556778 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300009174|Ga0105241_10398750 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300009176|Ga0105242_10376147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1319 | Open in IMG/M |
3300009840|Ga0126313_11798406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300010366|Ga0126379_13144307 | Not Available | 553 | Open in IMG/M |
3300010371|Ga0134125_10675668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
3300010375|Ga0105239_11604947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300010376|Ga0126381_100106957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3586 | Open in IMG/M |
3300010396|Ga0134126_11357145 | Not Available | 786 | Open in IMG/M |
3300011998|Ga0120114_1045174 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300012011|Ga0120152_1027511 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
3300012014|Ga0120159_1055077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
3300012043|Ga0136631_10201502 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300012200|Ga0137382_10348473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300012202|Ga0137363_11809088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
3300012203|Ga0137399_10232043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
3300012208|Ga0137376_11273650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 625 | Open in IMG/M |
3300012212|Ga0150985_101000875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300012212|Ga0150985_101670690 | Not Available | 540 | Open in IMG/M |
3300012212|Ga0150985_114292009 | Not Available | 896 | Open in IMG/M |
3300012469|Ga0150984_100636176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
3300012469|Ga0150984_100807729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
3300012469|Ga0150984_114233421 | Not Available | 553 | Open in IMG/M |
3300012685|Ga0137397_10629618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
3300012918|Ga0137396_10508858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
3300012922|Ga0137394_10804587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 788 | Open in IMG/M |
3300012923|Ga0137359_10058638 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
3300012929|Ga0137404_10572683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300012944|Ga0137410_10037352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3419 | Open in IMG/M |
3300012951|Ga0164300_10787918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 587 | Open in IMG/M |
3300012955|Ga0164298_10093928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1572 | Open in IMG/M |
3300012955|Ga0164298_10590364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300012957|Ga0164303_10190131 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300012958|Ga0164299_11419526 | Not Available | 537 | Open in IMG/M |
3300012961|Ga0164302_10005922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 4458 | Open in IMG/M |
3300012971|Ga0126369_10566372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1202 | Open in IMG/M |
3300012984|Ga0164309_10476362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
3300012984|Ga0164309_10485025 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300012985|Ga0164308_10183949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
3300012985|Ga0164308_12058282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 532 | Open in IMG/M |
3300012986|Ga0164304_10210229 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300012986|Ga0164304_10411982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
3300012988|Ga0164306_10585571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
3300012988|Ga0164306_10821344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300012988|Ga0164306_11830612 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300012989|Ga0164305_10691144 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300013308|Ga0157375_11688762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300013763|Ga0120179_1120811 | Not Available | 576 | Open in IMG/M |
3300013770|Ga0120123_1035567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300014154|Ga0134075_10546632 | Not Available | 522 | Open in IMG/M |
3300015209|Ga0167629_1007740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4060 | Open in IMG/M |
3300015241|Ga0137418_10172289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1890 | Open in IMG/M |
3300015371|Ga0132258_13470758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
3300015374|Ga0132255_100573003 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300019361|Ga0173482_10289506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300021363|Ga0193699_10004525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5058 | Open in IMG/M |
3300021363|Ga0193699_10244451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 747 | Open in IMG/M |
3300021415|Ga0193694_1031019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300025912|Ga0207707_11238035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300025916|Ga0207663_10611214 | Not Available | 857 | Open in IMG/M |
3300025926|Ga0207659_11861721 | Not Available | 510 | Open in IMG/M |
3300025927|Ga0207687_10888665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300025927|Ga0207687_11317190 | Not Available | 621 | Open in IMG/M |
3300025931|Ga0207644_11459298 | Not Available | 574 | Open in IMG/M |
3300025939|Ga0207665_11192797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
3300025944|Ga0207661_10867657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300025960|Ga0207651_10799087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
3300026078|Ga0207702_11044752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
3300026078|Ga0207702_11249118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300026088|Ga0207641_11788793 | Not Available | 616 | Open in IMG/M |
3300027773|Ga0209810_1000054 | All Organisms → cellular organisms → Bacteria | 335871 | Open in IMG/M |
3300027775|Ga0209177_10446416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300028718|Ga0307307_10199415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300028824|Ga0307310_10050037 | Not Available | 1743 | Open in IMG/M |
3300028824|Ga0307310_10190247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 965 | Open in IMG/M |
3300028824|Ga0307310_10262476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 832 | Open in IMG/M |
3300028824|Ga0307310_10667652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 532 | Open in IMG/M |
3300033004|Ga0335084_11511686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.08% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 6.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.43% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.10% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.88% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.78% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4NP_00347190 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA |
INPhiseqgaiiFebDRAFT_1047131452 | 3300000364 | Soil | MKKRLLFLLFVTGLLVLALGGWTVQGVRWAATGGWARGVPQPA* |
JGI10216J12902_1020093351 | 3300000956 | Soil | MKRKLFFTLLVTGLLLLALGGWTVDGLRWAFGGGSGRTAPAPA* |
C688J18823_104913802 | 3300001686 | Soil | MARRRMTRSLPSMKRRLLFLLLVTGLLLLALGGWTVQGVRWTVSGGWLPLRHGAPQPV* |
C688J35102_1189026112 | 3300002568 | Soil | MWARRVTPSLLCMKRRFLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGAAPQPA* |
C688J35102_1205983772 | 3300002568 | Soil | MTHSLSSMKRRFLFLLIVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
C688J35102_1209018252 | 3300002568 | Soil | MCRTGRARSLAHMKNRLLFLLLVTGLIVLALGGWTVRGLRWAVSGGRARSVPQPA* |
C688J35102_1209482981 | 3300002568 | Soil | MKKRLLILLLFTGLIVLALAGWSVQGVRWTVGGRWLRSGAALPEPA* |
Ga0063454_1000724092 | 3300004081 | Soil | MCGRADIRSLTSMKKRLLFLLLVTGLLVLALGGWTVQGLRWAATGGWVRGLPQPA* |
Ga0063454_1001384872 | 3300004081 | Soil | MCRTGRARSLAHMKNRLLFLLLVTGLIVLALGGWTVRGLRWTVSGGRARSVPQPA* |
Ga0063455_1008034422 | 3300004153 | Soil | MKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGRVRGLPQPA* |
Ga0062595_1001253103 | 3300004479 | Soil | MYQADPRLTLTSMKKRLLFLLLVTGLLVLALGGWTVQGLRWATTGGWARGLPQPA* |
Ga0062595_1007766952 | 3300004479 | Soil | MKKRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA* |
Ga0066823_100766552 | 3300005163 | Soil | MKRRLIFFLLVTGLLLLALGGWTVQGLRFAVSGGRRLPQPA* |
Ga0066815_100795142 | 3300005164 | Soil | MTPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA* |
Ga0066671_102602252 | 3300005184 | Soil | MKKTLLFVLLVAGLLVLALGGWTVQGLRWATTGGRARGAPQPA* |
Ga0065715_105230281 | 3300005293 | Miscanthus Rhizosphere | MKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA* |
Ga0070658_104657212 | 3300005327 | Corn Rhizosphere | MTPSLPCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA* |
Ga0070683_1010805242 | 3300005329 | Corn Rhizosphere | MTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA* |
Ga0066388_1070582202 | 3300005332 | Tropical Forest Soil | MYHADPDRTLTGMKTRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA* |
Ga0070673_1008118351 | 3300005364 | Switchgrass Rhizosphere | LLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA* |
Ga0070713_1006825592 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRFLLLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA* |
Ga0070711_1002567733 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRLLILLLVTGLILLALGGWSVRGLRWTLSGGARHAPQPA* |
Ga0070678_1011014832 | 3300005456 | Miscanthus Rhizosphere | MKRRLLFILLVTGLLLLALGGWSVRGLRWALSGGGRVPQPA* |
Ga0073909_101281182 | 3300005526 | Surface Soil | MAPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA* |
Ga0070741_10000074301 | 3300005529 | Surface Soil | MCAGTSPPRFGAMKKRLLFLLVVTGLIVLALGGWTVQGLRWAVSGGFARGLPQPA* |
Ga0070741_101207661 | 3300005529 | Surface Soil | RLLFLLLVTGLIVLALGGWTIKGLRRAAGAGRGGPLPQPA* |
Ga0070741_109345412 | 3300005529 | Surface Soil | MSVSGRRRRFGDMKRHLLFLLRVTGLILLALGGWTVKGLRWAASAGRGGPLPQPA* |
Ga0070679_1013508571 | 3300005530 | Corn Rhizosphere | MKRRFLFLLLITGLLALALGGWTVQGLRWAASGGRSRDVLQPA* |
Ga0070739_1000038326 | 3300005532 | Surface Soil | MEEGGPRRSLVGMKRRLLFVLLVTGLLVLALAGWTVQGLRWAASGGWTRPLPQPA* |
Ga0070684_1010949351 | 3300005535 | Corn Rhizosphere | MTPSLSCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0070693_1016548462 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPSLSRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0070704_1008428722 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRLFFLLLVTGLVVLAVGGWTVQGLRWAVTGGWSRGLPQPA* |
Ga0070664_1002420212 | 3300005564 | Corn Rhizosphere | MTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA* |
Ga0068856_1011061291 | 3300005614 | Corn Rhizosphere | PCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0066905_1009394502 | 3300005713 | Tropical Forest Soil | MKNRLLFLLLITGLLLLALGGWTVQGLRWAVAGGRARGVPQPA* |
Ga0070715_108005632 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SRAHSLGYMKNRLLFLLLVTGLILLALGGWTVQGLRWTVTGGRARTLPQPA* |
Ga0068871_1003897492 | 3300006358 | Miscanthus Rhizosphere | MTPSLPRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA* |
Ga0074059_115465462 | 3300006578 | Soil | MKRKLFFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRGLPQPA* |
Ga0079222_116954732 | 3300006755 | Agricultural Soil | MTPNLMCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA* |
Ga0075433_100756194 | 3300006852 | Populus Rhizosphere | MCAVGRTRSLGDMNNRLLFLLLVTGLILLALGGWTVQGLRWAVSGGRTRGLPQPA* |
Ga0068865_1015912461 | 3300006881 | Miscanthus Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGSARGTAAQPA* |
Ga0075435_1002180981 | 3300007076 | Populus Rhizosphere | TRSLGDMNNRLLFLLLVTGLILLALGGWTVQGLRWAVSGGRTRGLPQPA* |
Ga0105245_105567782 | 3300009098 | Miscanthus Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA* |
Ga0105241_103987502 | 3300009174 | Corn Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0105242_103761472 | 3300009176 | Miscanthus Rhizosphere | MDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA* |
Ga0126313_117984062 | 3300009840 | Serpentine Soil | MKRRFFFLLVVTGLLLLALGGWTVQGLRWALSGGWARGSTEPLPA* |
Ga0126308_102813062 | 3300010040 | Serpentine Soil | MNRKLLFVLIATGLILLALTAWTVDGLRWAFAGSRRTAPLPA* |
Ga0126379_131443072 | 3300010366 | Tropical Forest Soil | MKRRLLFTLIVTGLLLLALGGWTVQGLRWTLGGGSRRLPQPA* |
Ga0134125_106756682 | 3300010371 | Terrestrial Soil | MKRRLFLLLLVTGLLVLAVGGWTVQVLRWAVTGGWSRGLPQPA* |
Ga0105239_116049472 | 3300010375 | Corn Rhizosphere | RILFLLLVTGLLLLALGGWTVQGLRWALSGGSARGTAAQPA* |
Ga0126381_1001069572 | 3300010376 | Tropical Forest Soil | MKRRLFFMLLVTGLILLALAGWTVQGLRWAVSGGAAGVPQPA* |
Ga0134126_113571452 | 3300010396 | Terrestrial Soil | MKRRLFFLLLVTGLLVLAVGGWTVQGLRWAVTGGWSRGLPQPA* |
Ga0120114_10451743 | 3300011998 | Permafrost | MRRRFIFFLFVTGLLLLALGGWAVQGLRFAVAGGRGRRPG* |
Ga0120152_10275113 | 3300012011 | Permafrost | MRRRFIFFLFVTGLLLLALGGWAVQGLRFAAAGGRGRRLPQPA* |
Ga0120159_10550772 | 3300012014 | Permafrost | MKRKLLMLLLITGLIVLALGGWTVKGLRWAVSGGSARGLPQPA* |
Ga0136631_102015023 | 3300012043 | Polar Desert Sand | MNRYFLLALLAFGLLMLALAGWTVQGLRWTLSGDGVAAAA* |
Ga0137382_103484732 | 3300012200 | Vadose Zone Soil | MKRRFLLALLVTGLLVLALGGWTVQVLRWAATGGRSREVPQPA* |
Ga0137363_118090881 | 3300012202 | Vadose Zone Soil | LVTGLLLLALGGWTVEGVRWAASGGRARGLPQPA* |
Ga0137399_102320431 | 3300012203 | Vadose Zone Soil | MKMRLLFLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA* |
Ga0137376_112736502 | 3300012208 | Vadose Zone Soil | MKRRFLLALLFTGLLVLALGGWTVQVLRWAATGGRSREVPQPA* |
Ga0150985_1010008752 | 3300012212 | Avena Fatua Rhizosphere | VTGLLLLALGGWTVEGLRWALSGGWARGTAPQPA* |
Ga0150985_1016706902 | 3300012212 | Avena Fatua Rhizosphere | MKRRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0150985_1142920091 | 3300012212 | Avena Fatua Rhizosphere | LFLLLVTGLLVLALGGWTVQGLRWAASGGRSRGGLQPA* |
Ga0137371_110683301 | 3300012356 | Vadose Zone Soil | MKRRLLFTLIATGLILLALAGWTVDGLRWAFGGSDSPAPAPA* |
Ga0150984_1006361761 | 3300012469 | Avena Fatua Rhizosphere | MKRRLLFLLLVTGLLLLALGGWTVQGVRWTVSGGWLPLRHGAPQPV* |
Ga0150984_1008077292 | 3300012469 | Avena Fatua Rhizosphere | FLLLVTGLLLLALGGWTVEGLRWALSGGWARGTAPQPA* |
Ga0150984_1142334211 | 3300012469 | Avena Fatua Rhizosphere | PPTLGDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGRVRGLPQPA* |
Ga0137397_106296181 | 3300012685 | Vadose Zone Soil | FLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA* |
Ga0137396_105088582 | 3300012918 | Vadose Zone Soil | MCAQAVARSLVRMKKRLLFLLLVTALLVLALGGWTMQGLRWAATSDRTPAVPQPA* |
Ga0137394_104250152 | 3300012922 | Vadose Zone Soil | MCAQAVARSLVQMKKRLLFLLLVTALLVLALGGWAVQGLRWAATSDRTRAVPQPA* |
Ga0137394_108045871 | 3300012922 | Vadose Zone Soil | MKKRVLLGLLVTGLLVLALGGWIVQGVRWAATGGRVRALPHPA* |
Ga0137359_100586382 | 3300012923 | Vadose Zone Soil | MKRRFLFLLLITGLLVLALGGWTVQGLRWAAGGGRSRDVLQPA* |
Ga0137404_105726831 | 3300012929 | Vadose Zone Soil | MKRRLLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLQPA* |
Ga0137410_100373522 | 3300012944 | Vadose Zone Soil | MKKRVLLGLLVTGLLVLALGGWIVQGVRRAATGGRVRALPHPA* |
Ga0164300_107879182 | 3300012951 | Soil | MKRRFLFLLLVTGLLVLALGGWTVQGLRWAANGGRSRDVLQPA* |
Ga0164298_100939282 | 3300012955 | Soil | MKRRFLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLQPA* |
Ga0164298_105903642 | 3300012955 | Soil | MKRKLLFLLLVTGLLLLAVGGWTVQGLRRATTGGWSRGLPQPA* |
Ga0164303_101901312 | 3300012957 | Soil | MAARRMTPSLSGMKKRLLCLLLVTGLLLLALGGWTVQGLRWALSGGWARGGAAQPA* |
Ga0164299_114195262 | 3300012958 | Soil | KKRLLFLLFVTGLLVLALGGWTVQGVRWAVTGGWARGLPQPA* |
Ga0164301_101443593 | 3300012960 | Soil | MYPTCRPRSVAVMKRRLLLMLLVTGLILLALGGWTVRGLRWTLSAGPRRLPQPA* |
Ga0164302_100059226 | 3300012961 | Soil | MYMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA* |
Ga0126369_105663722 | 3300012971 | Tropical Forest Soil | MKNRLLFLLLVTGLILLALGGWTVQGLRWAVTGGRARGVPQPA* |
Ga0164309_104763622 | 3300012984 | Soil | MKRRLLISLLVTGLILLALGGWSVRGLRWMLSGGARHVPQPA* |
Ga0164309_104850252 | 3300012984 | Soil | MKRRVLFLLLVTGLLLLALGGWTIQGLRFAVSGGRRLPQPA* |
Ga0164308_101839493 | 3300012985 | Soil | MKRKFFFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRGLPQPA* |
Ga0164308_120582822 | 3300012985 | Soil | MKRRFLFLLLVTGLLVLALGGWTVQGLRWAASGGRSRDVLHPA* |
Ga0164304_102102292 | 3300012986 | Soil | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARSGAAQPA* |
Ga0164304_104119822 | 3300012986 | Soil | MKRKLLFLLLVTGLLLLAVGGWTVQGLRWATTGGWSRSLPQPA* |
Ga0164306_105855711 | 3300012988 | Soil | MKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA* |
Ga0164306_108213442 | 3300012988 | Soil | MKRRLIFFLLVTGLLLLALGGWTIQGLRFAVSGRRRLPQPA* |
Ga0164306_118306122 | 3300012988 | Soil | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALAGGWARGGTA |
Ga0164305_106911442 | 3300012989 | Soil | MKKRLLFLLLVTGLLLLALGGWTVQGLHWALSGGWARSCAAQPA* |
Ga0164305_119719602 | 3300012989 | Soil | MRADTRTRSLVHMKNRILFVLLVTGLIVLALGGWTVQGLRWAATGGRARGLPQPA* |
Ga0157375_116887622 | 3300013308 | Miscanthus Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA* |
Ga0120179_11208111 | 3300013763 | Permafrost | MRRRFIFFLFVTGLLLLALGGWAVQGLRFAAAGGRGRS |
Ga0120123_10355672 | 3300013770 | Permafrost | MRRRFIFFLFVTGLLLLALGGWAVQGLRFALAGGRGRRLPQPA* |
Ga0134075_105466322 | 3300014154 | Grasslands Soil | MKRKLFLILIVTGLLLLLALGGWTVDGLRWAFSGGSARTSPAPA* |
Ga0167629_10077404 | 3300015209 | Glacier Forefield Soil | MKRKLLFLLLVTGLILLALGGWSARGLRWVTAGGWARGLPQPA* |
Ga0137418_101722892 | 3300015241 | Vadose Zone Soil | MKKRLLLGLLVTGLLVLALGGWIVQGVRWAATGGRVRALPHPA* |
Ga0132258_134707582 | 3300015371 | Arabidopsis Rhizosphere | MKRRLFFLLVVTGLLVLAIGGWTVQGLRWAVTGGWSRGLPQPA* |
Ga0132255_1005730032 | 3300015374 | Arabidopsis Rhizosphere | MKRRLFFILLVTGLILLALGGWTIKGLRWAAAGGRTTGVPQPA* |
Ga0173482_102895061 | 3300019361 | Soil | LSCMKKRLLSLLLVTGLRRLALGGWTVQGLRWALTRGWARAGTAPQPA |
Ga0193699_100045255 | 3300021363 | Soil | MKRRFLLALLVTGLLVLALGGWTVQVLRWAATGGRSREVPQPA |
Ga0193699_102444512 | 3300021363 | Soil | MQQRLLFVLLVTGLLVLALGGWTVQGLRWLATAGRARGITQTA |
Ga0193694_10310192 | 3300021415 | Soil | GMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGAAAQPA |
Ga0207707_112380351 | 3300025912 | Corn Rhizosphere | AMKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA |
Ga0207663_106112142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRLIFFLFVTGLLLLALGGWTIRGLRFAVSGRRRLPQPA |
Ga0207659_118617212 | 3300025926 | Miscanthus Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARGGVAQPA |
Ga0207687_108886652 | 3300025927 | Miscanthus Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALTGGWARGGTAPQPA |
Ga0207687_113171901 | 3300025927 | Miscanthus Rhizosphere | MKRRLLFILLVTGLLLLALGGWSVRGLRWALSGGGRVPQPA |
Ga0207644_103862862 | 3300025931 | Switchgrass Rhizosphere | MCGRADAHRLMDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA |
Ga0207644_114592982 | 3300025931 | Switchgrass Rhizosphere | MKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA |
Ga0207686_100330093 | 3300025934 | Miscanthus Rhizosphere | MCGRADPHRLMDMKKRLLFLLLVTGLIVLALGGWTVQGLRWAATGGWLRGLPQPA |
Ga0207665_111927972 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQPA |
Ga0207661_108676572 | 3300025944 | Corn Rhizosphere | MTPNLTRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGGWARAGAAQPA |
Ga0207651_107990871 | 3300025960 | Switchgrass Rhizosphere | PRMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA |
Ga0207702_110447521 | 3300026078 | Corn Rhizosphere | RMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA |
Ga0207702_112491182 | 3300026078 | Corn Rhizosphere | MKRRFLFLLLITGLLALALGGWTVQGLRWAASGGRSRDVLQPA |
Ga0207641_117887932 | 3300026088 | Switchgrass Rhizosphere | MTPSLPCMKKRLLFLLLVTGLLLLALGGWTVQGLRWALSGAWARSGAAQPA |
Ga0209810_1000054206 | 3300027773 | Surface Soil | MEEGGPRRSLVGMKRRLLFVLLVTGLLVLALAGWTVQGLRWAASGGWTRPLPQPA |
Ga0209177_104464161 | 3300027775 | Agricultural Soil | MKRRLFFLLVVTGLLVLAIGGWTVQGLRWAVTGGWSRGLPQPA |
Ga0307307_101994152 | 3300028718 | Soil | RLLFLLLVTGLLLLALGGWTVHGLRWALSGGWARGAAAQPA |
Ga0307310_100500372 | 3300028824 | Soil | VFLLVTGLLLLALGGWAVQGVRFAVSGGRRLPQAA |
Ga0307310_101902472 | 3300028824 | Soil | MKRRFLFLLLVTGLLMLALGGWTVQGLRWAASGGRSRDV |
Ga0307310_102624762 | 3300028824 | Soil | MKRRLLFFLLVTGLLVLALGGWTVQGLRFAAGGGRARRLPQPA |
Ga0307310_106676522 | 3300028824 | Soil | MKRRFLFLLLITGLLVLALGGWTVQGLRWAASGGRSRDVLQTA |
Ga0335084_115116861 | 3300033004 | Soil | FILLVTGLILLALGGWTIQGLRWAVAGGRSDTVPQPA |
Ga0372946_0666136_170_337 | 3300034384 | Soil | MCGHDDARSLADVKKRLLVVLLVTGLLVLALGAWTVQGLRWAASGGWVRGVAQPA |
⦗Top⦘ |