


| Basic Information | |
|---|---|
| Family ID | F064085 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MADIKIVASGTCAECGHSQKDHEGNTVCDVEGCDCTNIGSY |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.36 % |
| % of genes near scaffold ends (potentially truncated) | 14.73 % |
| % of genes from short scaffolds (< 2000 bps) | 65.89 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.992 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.310 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.721 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.845 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 2.90% Coil/Unstructured: 91.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF10651 | BppU_N | 24.81 |
| PF12705 | PDDEXK_1 | 5.43 |
| PF05063 | MT-A70 | 3.88 |
| PF03237 | Terminase_6N | 3.88 |
| PF00493 | MCM | 3.10 |
| PF08423 | Rad51 | 3.10 |
| PF01918 | Alba | 0.78 |
| PF00754 | F5_F8_type_C | 0.78 |
| PF07728 | AAA_5 | 0.78 |
| PF02796 | HTH_7 | 0.78 |
| PF13456 | RVT_3 | 0.78 |
| PF00370 | FGGY_N | 0.78 |
| PF00630 | Filamin | 0.78 |
| PF12704 | MacB_PCD | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 7.75 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 3.10 |
| COG1241 | DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm family | Replication, recombination and repair [L] | 3.10 |
| COG1581 | DNA/RNA-binding protein AlbA/Ssh10b | Transcription [K] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.99 % |
| All Organisms | root | All Organisms | 31.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.31% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.30% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 8.53% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 6.20% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.65% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.10% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.10% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.88% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.55% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.55% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.55% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.78% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.78% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.78% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300000152 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500m | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300003894 | Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment | Environmental | Open in IMG/M |
| 3300003937 | SPOT_150m_metagenome_year | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006411 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0200m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008738 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300008740 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300020332 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX555956-ERR598975) | Environmental | Open in IMG/M |
| 3300020383 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971) | Environmental | Open in IMG/M |
| 3300020398 | Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072) | Environmental | Open in IMG/M |
| 3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026080 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300027685 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027700 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPaug09P16500mDRAFT_10165084 | 3300000142 | Marine | MGEIKIVASGICEKCGHKQSSHEGNSVCDETGCDCTQIGSY* |
| SI47jul10_100mDRAFT_10133593 | 3300000148 | Marine | MTDLKVVASGVCEECEHSQKDHEGNTTCNVDGCDCKNIGSY* |
| LPjun08P12500mDRAFT_10446392 | 3300000152 | Marine | MADLKVVASGTCEECGHSQKDHEGNTICDVDGCDCTNIGSY* |
| GBIDBA_1000541116 | 3300001683 | Hydrothermal Vent Plume | MGKITIVSSGACEQCGHPQSTHEGNNVCDIEGCDCTSIGSY* |
| GBIDBA_100099713 | 3300001683 | Hydrothermal Vent Plume | MADLKVVASGVCEVCEHSQKDHEGNTTCDVEGCDCTNIGSY* |
| KVRMV2_1011942093 | 3300002231 | Marine Sediment | MADLKVVASGICEECGHSQKDHEGNTVCDVEDCDCTNIGSY* |
| KVRMV2_1016164591 | 3300002231 | Marine Sediment | TDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY* |
| KVRMV2_1016897161 | 3300002231 | Marine Sediment | IVASGTCEECGHNQESHEGNNICDIEGCDCTNIGSY* |
| KVWGV2_1000002398 | 3300002242 | Marine Sediment | LTDIKIVASGTCEECGHNQESHEGNNICDIEGCDCTNIGSY* |
| JGI25129J35166_10349001 | 3300002484 | Marine | MADIKIVASGTCAECGHSQKDHEGNTVCDAEGCDCTNIGSY* |
| JGI26238J51125_100002442 | 3300003478 | Marine | MGKITIVSSGACEQCGHPQNAHEGNNVCDVEGCDCKSIGSY* |
| PicMicro_1001333917 | 3300003702 | Marine, Hydrothermal Vent Plume | MTHINIVASGVCEKCGHKQSSHEGNNICDEDGCDCTQIGSY* |
| Ga0063241_10101512 | 3300003894 | Marine | MTDIKIVASGTCSECEHPQKDHEGNTVCDVEGCECTNIGSY* |
| Ga0063241_10164581 | 3300003894 | Marine | MVDIKIVASGVCEECEHPQSAHEGNTTCDVDGCDCKNIGSY* |
| Ga0063391_100596987 | 3300003937 | Marine | MGKITIVSSGACEQCGHPQTAHEGNNVCDVEGCDCKSIGSY* |
| Ga0066851_100671052 | 3300005427 | Marine | MADLKVVASGVCEVCEHSQKDHEGNTTCDVDGCDCTNIGSY* |
| Ga0066375_100383704 | 3300006019 | Marine | VYYGVNMGDIKIVASGVCEKCGHKQSSHEGNNICDEEGCDCTQIGSY* |
| Ga0066836_1000563317 | 3300006166 | Marine | MGDIKIVASGVCEACGHPQKDHEGNNVCDHEGCECTQIGSY* |
| Ga0066836_100337405 | 3300006166 | Marine | LVDIKIVASGTCEECGHNQASHEGNNTCDIEGCDCTNIGSY* |
| Ga0066836_100833863 | 3300006166 | Marine | MVDIKIVASGSCAECGHSQKDHEGNTICDAEGCDCTNIGSY* |
| Ga0066836_105363523 | 3300006166 | Marine | MADIKIVASGTCAECNHSQKDHEGNTVCDIEGCDCTNIGSY* |
| Ga0066836_108790762 | 3300006166 | Marine | MSDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0068469_10501771 | 3300006306 | Marine | MADIKVVASGTCEECGHSQKDHEGNTICDVSGCDCTN |
| Ga0068470_10950684 | 3300006308 | Marine | MADIKVVASGTCEECGHSQKDHEGNTICDVSGCDCTNIGSY* |
| Ga0068471_10042821 | 3300006310 | Marine | MGEIKIVASGICEKCGHKQSSHEGNNICDEAGCDCTQIGSY* |
| Ga0068471_16106433 | 3300006310 | Marine | MADLKVVASGTCEECGHNQQAHEGNTVCDVEGCDCTNIGSY* |
| Ga0068487_10263544 | 3300006315 | Marine | MADIKIVASGTCAECGHSQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0068475_10456553 | 3300006318 | Marine | MVDIKIVASGTCAECGHSQKDHEGNTICDVEGCDCTNIGSY* |
| Ga0068475_11340031 | 3300006318 | Marine | KIVASGVCEACGHPQSDHEGNNVCDHEGCECTQIGSY* |
| Ga0068475_11974984 | 3300006318 | Marine | MTDIKIVASGVCEACCHPQSDHEGNIVCDHEGCECT |
| Ga0068477_14032052 | 3300006326 | Marine | KVVASGTCEECGHKQKDNEGNTICDVEGCDCTNIGSY* |
| Ga0068480_10031873 | 3300006335 | Marine | MADLKVVASGTCEECGHSQKDHEGNTICDVSGCDCTNIGSY* |
| Ga0068502_17012683 | 3300006336 | Marine | MGEIKIVASGICEKCGHSQSSHEGNNVCDEEGCDCTQIGSY* |
| Ga0068503_100273656 | 3300006340 | Marine | MGEIKIVASGICEKCGHKQSSHEGNNICDEEGCDCTQIGSY* |
| Ga0099956_10421696 | 3300006411 | Marine | MTDIKIVASGVCEACGHPQSDHEGNNVCDHEGCECTQIGSY* |
| Ga0075461_100619511 | 3300006637 | Aqueous | MADLKFVASGVCAECGHGQQYHEGNNVCDVEGCDCTNIGSY* |
| Ga0098035_12244822 | 3300006738 | Marine | MTDLKVVASGVCEECEHSQKDHEGNTTCDVDGCDCTNIGSY* |
| Ga0098035_12530692 | 3300006738 | Marine | MADIKVVASGTCEECGHNQKAHEGNTICDVEGCDCTNIGSY* |
| Ga0098040_10324473 | 3300006751 | Marine | MADIKVVASGICEECGHNQKAHEGNTICDVEGCDCTNIGSY* |
| Ga0098048_10384083 | 3300006752 | Marine | MADIKIVASGTCAECGHSQKDHEGNTICDVEGCDCTNIGSY* |
| Ga0098044_12528731 | 3300006754 | Marine | ASGICEECGHNQKAHEGNTICDVEGCDCTNIGSY* |
| Ga0098044_13222582 | 3300006754 | Marine | MADIKIVASGTCAECNHSQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0098054_100276712 | 3300006789 | Marine | MADIKIVASGVCKTCGHNQQSHEGNTICDVDGCECKAIGSY* |
| Ga0098054_10404282 | 3300006789 | Marine | MGSIKIVASGVCEACGHSQKDHEGNNVCDHEGCECTQIGSY* |
| Ga0098054_10841893 | 3300006789 | Marine | MADLKVVASGTCEECGHSQKDHEGNTICDVEDCDCTNIGSY* |
| Ga0098054_11479761 | 3300006789 | Marine | DIKIVASGTCIDCGHNQQSHEGNNVCDVDECDCTNLGSY* |
| Ga0098055_10384195 | 3300006793 | Marine | VDIKIVASGSCAECGHSQKDHEGNTICDAEGCDCTNIGSY* |
| Ga0098055_13350552 | 3300006793 | Marine | MGKITIVSSGACEQCGHPQTSHEGNNVCDVEGCDCKSIGSY* |
| Ga0070749_100264494 | 3300006802 | Aqueous | MTDLKFVASGVCAECGHGQQYHEGNNVCDVEGCDCTNIGSY* |
| Ga0066376_101180393 | 3300006900 | Marine | MADLKVVASGVCEECEHNQQAHEGNTVCDVDGCNCTNIGSY* |
| Ga0098060_10039122 | 3300006921 | Marine | LTDIKIVASGTCIDCGHNQQSHEGNNVCDVDECDCTNLGSY* |
| Ga0098060_10119613 | 3300006921 | Marine | LADIKIVASGTCEECGHNQASHEGNNICDVEDAIVQT* |
| Ga0098053_10703642 | 3300006923 | Marine | MADLKVIASGTCEECGHSQKDHEGNTICDVEGCDCTNIGSY* |
| Ga0098041_10620453 | 3300006928 | Marine | MVDIKIVASGTCAECNHSQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0098036_10401671 | 3300006929 | Marine | LADIKIVASGTCEECGHNQASHEGNNICDVEGCDCTNIGSY* |
| Ga0105011_10021299 | 3300007508 | Marine | VYLAINMGEIKIVASGICEKCGHRQSSHEGNNVCDEEGCDCTQIGSY* |
| Ga0099851_12215483 | 3300007538 | Aqueous | MADLKFVASGVCAECGHGQQYHEGNNVCDVEGCDCT |
| Ga0110931_11758233 | 3300007963 | Marine | MADLKIVASGTCEVCGHSQKDHEGNTICDVEGCDCTNIGSY* |
| Ga0098052_10418491 | 3300008050 | Marine | RMSDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0098052_10511453 | 3300008050 | Marine | MADIKIVASGTCEECGHAQKYHEGNTVCDAEGCDCTNIGSY* |
| Ga0098052_10831773 | 3300008050 | Marine | MSDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNM* |
| Ga0115660_10253067 | 3300008738 | Marine | MGEIKIVASGICEKCGHRQSSHEGNNVCDEEGCDCTQIGSY* |
| Ga0115663_10265343 | 3300008740 | Marine | MTDITIVASGTCAECGHSQKDHEGNTVCDVEGCECTNIGSY* |
| Ga0117902_100901722 | 3300009104 | Marine | MADIKIVATGLCKNCGHPQKTHEGNTICDVEGCDCTAIGSY* |
| Ga0117902_10140387 | 3300009104 | Marine | MADLKVIASGTCEECGHSQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0117902_15960443 | 3300009104 | Marine | MTDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0114932_100060503 | 3300009481 | Deep Subsurface | MVDIKIVASGSCAECGHSQKDHEGNTICDVEGCDCTNIGSY* |
| Ga0105173_10071602 | 3300009622 | Marine Oceanic | MADLKVVASGVCEECEHSQQAHEGNTICDVDGCNCTNIGSY* |
| Ga0114933_100647021 | 3300009703 | Deep Subsurface | MTDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGS |
| Ga0098049_10241333 | 3300010149 | Marine | MVDIKIVASGTCAECGHSQKDHEGNTVCDVEGCDCTNIGSY* |
| Ga0098059_100036726 | 3300010153 | Marine | MTDLKVVASGVCEECEHSQKDHEGNTTCDVDGCDCKNIGSY* |
| Ga0098059_100523910 | 3300010153 | Marine | MGKITIVSSGACEQCGHPQTAHEGNNVCDVEGCDCTSIGSY* |
| Ga0181367_10623392 | 3300017703 | Marine | MTDLKVVASGVCEECEHSQKDHEGNTTCDVDGCDCTNIGSY |
| Ga0211502_10741941 | 3300020332 | Marine | XGVILMADIKIVASGTCAECGHSQKDHEGNTVCDVEGCECTNIGSY |
| Ga0211646_103638642 | 3300020383 | Marine | MGEIKIVASGICEKCGHKQSSHEGNSICDEEGCDCTQIGSY |
| Ga0211637_102601392 | 3300020398 | Marine | MTDLKVVASGTCEECGHNQQSHEGNTVCDVEGCDCTNIGSY |
| Ga0211575_100791363 | 3300020407 | Marine | MADLKVVASGTCEECGHSQKDHEGNTICDVDGCDCTNIGSY |
| Ga0211691_100636382 | 3300020447 | Marine | MGEIKIVASGICEKCGHKQSSHEGNSVCDEAGCDCTQIGSY |
| Ga0211691_102230062 | 3300020447 | Marine | MTDLKVVASGVCEECEHSQKDHEGNTTCDVDGCDCKNIGSY |
| Ga0211486_103062472 | 3300020460 | Marine | MTDITIVASGTCAECGHSQKDHEGNTVCDVEGCECTNIGSY |
| Ga0211714_100627593 | 3300020466 | Marine | MVDIKIVASGSCAECGHSQKDHEGNTICDVEGCDCTNIGSY |
| Ga0211714_103030154 | 3300020466 | Marine | MTDIKIVASGVCEACGHPQSDHEGNNVCDHEGCECTQIGSY |
| Ga0211715_1000060936 | 3300020476 | Marine | MADLKVVASGICEECGHSQKDHEGNTVCDVEDCDCTNIGSY |
| Ga0211715_101620743 | 3300020476 | Marine | MGDIKIVASGVCEACGHPQKDHEGNNVCDHEGCECTQIGSY |
| Ga0211503_100225872 | 3300020478 | Marine | MADIKIVASGTCAECGHSQKDHEGNTICDVEGCDCTNIGSY |
| Ga0206684_12646571 | 3300021068 | Seawater | MADIKIVASGTCAECNHSQKDHEGNTVCDVEGCDCTNIGSY |
| Ga0206683_103336472 | 3300021087 | Seawater | MADIKIVASGSCAECGHSQKDHEGNTICDAEGCDCTNIGSY |
| Ga0206680_101253312 | 3300021352 | Seawater | MGKITIVSSGACEQCGHPQNAHEGNNVCDVEGCDCKSIGSY |
| Ga0206685_101873193 | 3300021442 | Seawater | MADIKVVASGTCEECGHNQKAHEGNTICDVEGCDCTNIGSY |
| Ga0226832_101792901 | 3300021791 | Hydrothermal Vent Fluids | MADLKVVASGTCEECGHSQKDHEGNTVCDVDGCDCTNIGSY |
| Ga0212029_10004645 | 3300022063 | Aqueous | MADLKFVASGVCAECGHGQQYHEGNNVCDVEGCDCTNIGSY |
| (restricted) Ga0233433_100728372 | 3300022931 | Seawater | MADLKVVASGVCEECNHAQSAHEGNTTCDIDGCNCTNIGSY |
| Ga0209992_100016743 | 3300024344 | Deep Subsurface | MVDIKIVASGTCAECGHSQKDHEGNTICDVEGCDCTNIGSY |
| Ga0209992_100133152 | 3300024344 | Deep Subsurface | MTDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY |
| Ga0208012_10123652 | 3300025066 | Marine | MVDIKIVASGSCAECGHSQKDHEGNTICDAEGCDCTNIGSY |
| Ga0208011_10894252 | 3300025096 | Marine | LKVVASGVCEVCEHSQKDHEGNTTCDVDGCDCTNIGSY |
| Ga0208013_10036803 | 3300025103 | Marine | MSDIKIVASGTCSECEHPQKDHEGNTVCDVEGCDCTNIGSY |
| Ga0208013_10193533 | 3300025103 | Marine | MADIKIVASGVCKTCGHNQQSHEGNTICDVDGCECKAIGSY |
| Ga0208013_10945032 | 3300025103 | Marine | MADLKVVASGTCEECGHSQKDHEGNTICDVEDCDCTNIGSY |
| Ga0208013_11078032 | 3300025103 | Marine | MGSIKIVASGVCEACGHSQKDHEGNNVCDHEGCECTQIGSY |
| Ga0208793_10296541 | 3300025108 | Marine | DIKIVASGSCAECGHSQKDHEGNTICDAEGCDCTNIGSY |
| Ga0209349_100115010 | 3300025112 | Marine | MADIKIVASGTCAECGHSQKDHEGNTVCDAEGCDCTNIGSY |
| Ga0208919_11818251 | 3300025128 | Marine | MADLKIVASGTCEVCGHSQKDHEGNTICDVEGCDCTNIGSY |
| Ga0208299_10064501 | 3300025133 | Marine | MADIKIVASGVCKTCGHNQQSHEGNTICDVDGCEC |
| Ga0208299_10072657 | 3300025133 | Marine | MADIKIVASGTCEECGHAQKYHEGNTVCDAEGCDCTNIGSY |
| Ga0208299_10087489 | 3300025133 | Marine | MGSIKIVASGVCEACGHPQKDHEGNNVCDHEGCECTQIGSY |
| Ga0208299_12368312 | 3300025133 | Marine | MADLKVIASGTCEECGHSQKDHEGNTICDVEGCDCTNIGSY |
| Ga0208315_11024391 | 3300025286 | Deep Ocean | MADLKVVASGTCEECGHNQQAHEGNTVCDVEGCDCTN |
| Ga0208644_10311832 | 3300025889 | Aqueous | MTDLKFVASGVCAECGHGQQYHEGNNVCDVEGCDCTNIGSY |
| Ga0207963_10620083 | 3300026080 | Marine | VYYGVNMGDIKIVASGVCEKCGHKQSSHEGNNICDEEGCDCTQIGSY |
| Ga0208879_11623352 | 3300026253 | Marine | VYLGNNMTHINIVASGVCEKCGHKQSSHEGNNVCDEDGCDCTQIGSY |
| Ga0208879_12137401 | 3300026253 | Marine | MADLKVVASGVCEECEHNQQAHEGNTVCDVDGCNCTNIGSY |
| Ga0209554_10286213 | 3300027685 | Marine | MADLKVVASGVCEECEHSQKDHEGNTICDVDGCNCTNIGSY |
| Ga0209445_11540582 | 3300027700 | Marine | MGDIKIVASGVCEKCGHKQSSHEGNNICDEEGCDCTQIGSY |
| Ga0257108_11003522 | 3300028190 | Marine | MGEIKIVASGICEKCGHKQSSHEGNNICDEDGCDCTQIGSY |
| Ga0257107_11677072 | 3300028192 | Marine | MGEIKIVASGICEKCGHKQSSHEGNSICDEAGCDCTQIGSY |
| Ga0257109_12227801 | 3300028487 | Marine | VYYGVNMGDIKIVASGVCEKCGHKQSSHEGNNICDEDGCDCTQ |
| Ga0257109_12396072 | 3300028487 | Marine | MGEIKIVASGVCEKCGHKQSSHEGNNVCDEEGCDCTQIGSY |
| Ga0257113_11209072 | 3300028488 | Marine | MTDLKVVASGTCEECGHNQQAHEGNTICDVEGCDCTNIGSY |
| Ga0310120_103378892 | 3300031803 | Marine | MTDIKVVASGTCEECGHSQKDHEGNTICDVAGCDCTNIGSY |
| Ga0315318_101306942 | 3300031886 | Seawater | MGEIKIVASGICEKCGHSQSSHEGNNVCDEEGCDCTQIGSY |
| Ga0310344_100021898 | 3300032006 | Seawater | MADIKIVASGTCAECGHSQKDHEGNTVCDVEGCDCTNIGSY |
| Ga0310344_100729915 | 3300032006 | Seawater | MADITIVASGTCAECGHSQKDHEGNTVCDVEGCDCTNIGSY |
| Ga0315316_110238621 | 3300032011 | Seawater | MGKITIVSSGACEQCGHPQTAHEGNNVCDVEGCDCKSIGSY |
| Ga0315329_105331912 | 3300032048 | Seawater | MGEIKIVASGICEKCGHRQSSHEGNNVCDEEGCDCTQIGSY |
| Ga0310345_100238808 | 3300032278 | Seawater | MGEIKIVASGICEKCGHKQSSHEGNNICDEAGCDCTQIGSY |
| Ga0310345_109572603 | 3300032278 | Seawater | MGEIKIVASGICEKCGHKQSSHEGNNICDEEGCDCTQIGSY |
| Ga0310345_112923762 | 3300032278 | Seawater | MADIKVVASGTCEECGHSQKDHEGNTICDVSGCDCTNIGSY |
| Ga0315334_103756361 | 3300032360 | Seawater | MGEIKIVASGICEKCGHKQSSHEGNNVCDEAGCDCTQIGSY |
| ⦗Top⦘ |