Basic Information | |
---|---|
Family ID | F063913 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 46 residues |
Representative Sequence | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 28.68 % |
% of genes near scaffold ends (potentially truncated) | 76.74 % |
% of genes from short scaffolds (< 2000 bps) | 60.47 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.698 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.178 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.690 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (95.349 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.24% β-sheet: 0.00% Coil/Unstructured: 87.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF09594 | GT87 | 10.85 |
PF08837 | DUF1810 | 8.53 |
PF11716 | MDMPI_N | 7.75 |
PF00583 | Acetyltransf_1 | 6.20 |
PF13751 | DDE_Tnp_1_6 | 6.20 |
PF00753 | Lactamase_B | 6.20 |
PF01551 | Peptidase_M23 | 3.88 |
PF00082 | Peptidase_S8 | 3.88 |
PF13532 | 2OG-FeII_Oxy_2 | 2.33 |
PF12706 | Lactamase_B_2 | 2.33 |
PF13673 | Acetyltransf_10 | 2.33 |
PF09286 | Pro-kuma_activ | 2.33 |
PF00456 | Transketolase_N | 1.55 |
PF00534 | Glycos_transf_1 | 1.55 |
PF01061 | ABC2_membrane | 1.55 |
PF00248 | Aldo_ket_red | 1.55 |
PF02096 | 60KD_IMP | 1.55 |
PF13560 | HTH_31 | 1.55 |
PF07690 | MFS_1 | 1.55 |
PF00171 | Aldedh | 1.55 |
PF11258 | DUF3048 | 1.55 |
PF00579 | tRNA-synt_1b | 0.78 |
PF00196 | GerE | 0.78 |
PF13519 | VWA_2 | 0.78 |
PF02734 | Dak2 | 0.78 |
PF14492 | EFG_III | 0.78 |
PF01569 | PAP2 | 0.78 |
PF04286 | DUF445 | 0.78 |
PF12848 | ABC_tran_Xtn | 0.78 |
PF01887 | SAM_HAT_N | 0.78 |
PF00528 | BPD_transp_1 | 0.78 |
PF13361 | UvrD_C | 0.78 |
PF13551 | HTH_29 | 0.78 |
PF02782 | FGGY_C | 0.78 |
PF13649 | Methyltransf_25 | 0.78 |
PF08241 | Methyltransf_11 | 0.78 |
PF13231 | PMT_2 | 0.78 |
PF00009 | GTP_EFTU | 0.78 |
PF00857 | Isochorismatase | 0.78 |
PF00494 | SQS_PSY | 0.78 |
PF03807 | F420_oxidored | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 8.53 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.55 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 1.55 |
COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.55 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 1.55 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.55 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.78 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 0.78 |
COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.78 |
COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.78 |
COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.47 % |
Unclassified | root | N/A | 8.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001976|JGI24752J21851_1025232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 780 | Open in IMG/M |
3300005327|Ga0070658_10334087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1295 | Open in IMG/M |
3300005327|Ga0070658_10468554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300005327|Ga0070658_10783132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300005328|Ga0070676_10025240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3356 | Open in IMG/M |
3300005328|Ga0070676_10377703 | Not Available | 980 | Open in IMG/M |
3300005329|Ga0070683_101955260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300005331|Ga0070670_100017952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6072 | Open in IMG/M |
3300005331|Ga0070670_100112239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2349 | Open in IMG/M |
3300005331|Ga0070670_100148523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2028 | Open in IMG/M |
3300005333|Ga0070677_10844815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300005334|Ga0068869_100026507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4035 | Open in IMG/M |
3300005334|Ga0068869_100098336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2210 | Open in IMG/M |
3300005335|Ga0070666_10053510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2723 | Open in IMG/M |
3300005335|Ga0070666_10265858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1217 | Open in IMG/M |
3300005337|Ga0070682_100008318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5849 | Open in IMG/M |
3300005343|Ga0070687_100368028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vaccinii | 933 | Open in IMG/M |
3300005344|Ga0070661_100347254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1163 | Open in IMG/M |
3300005345|Ga0070692_10355476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 911 | Open in IMG/M |
3300005347|Ga0070668_101085864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 722 | Open in IMG/M |
3300005353|Ga0070669_101442997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
3300005355|Ga0070671_100150747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1963 | Open in IMG/M |
3300005355|Ga0070671_100160970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1897 | Open in IMG/M |
3300005365|Ga0070688_100048560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2638 | Open in IMG/M |
3300005406|Ga0070703_10286375 | Not Available | 682 | Open in IMG/M |
3300005434|Ga0070709_10079132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 2140 | Open in IMG/M |
3300005434|Ga0070709_11050764 | Not Available | 650 | Open in IMG/M |
3300005436|Ga0070713_100383177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1310 | Open in IMG/M |
3300005440|Ga0070705_100154456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1526 | Open in IMG/M |
3300005455|Ga0070663_100351548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1193 | Open in IMG/M |
3300005455|Ga0070663_101295777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
3300005456|Ga0070678_100590354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vaccinii | 990 | Open in IMG/M |
3300005458|Ga0070681_10190166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1972 | Open in IMG/M |
3300005530|Ga0070679_100121935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2591 | Open in IMG/M |
3300005544|Ga0070686_100145657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1654 | Open in IMG/M |
3300005549|Ga0070704_100514309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1041 | Open in IMG/M |
3300005549|Ga0070704_101061350 | Not Available | 735 | Open in IMG/M |
3300005578|Ga0068854_100197756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1578 | Open in IMG/M |
3300005614|Ga0068856_100031575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 5183 | Open in IMG/M |
3300005614|Ga0068856_100031612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5180 | Open in IMG/M |
3300005614|Ga0068856_100078728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3268 | Open in IMG/M |
3300005614|Ga0068856_100183936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2103 | Open in IMG/M |
3300005614|Ga0068856_100267167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1726 | Open in IMG/M |
3300005614|Ga0068856_100290315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1652 | Open in IMG/M |
3300005614|Ga0068856_100308415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1600 | Open in IMG/M |
3300005614|Ga0068856_100608713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1113 | Open in IMG/M |
3300005614|Ga0068856_101502269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
3300005615|Ga0070702_100088176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1875 | Open in IMG/M |
3300005616|Ga0068852_100509380 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300005617|Ga0068859_100264943 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300005617|Ga0068859_100318807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1648 | Open in IMG/M |
3300005618|Ga0068864_101021943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 820 | Open in IMG/M |
3300005719|Ga0068861_100515398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1084 | Open in IMG/M |
3300005841|Ga0068863_100018824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6607 | Open in IMG/M |
3300005841|Ga0068863_100176859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2048 | Open in IMG/M |
3300005841|Ga0068863_100303303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1549 | Open in IMG/M |
3300006028|Ga0070717_10490715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
3300006028|Ga0070717_10969008 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300006028|Ga0070717_11390206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 637 | Open in IMG/M |
3300006175|Ga0070712_100823201 | Not Available | 797 | Open in IMG/M |
3300006175|Ga0070712_101586126 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300006196|Ga0075422_10059131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
3300006237|Ga0097621_101838955 | Not Available | 577 | Open in IMG/M |
3300006358|Ga0068871_100890501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 824 | Open in IMG/M |
3300006755|Ga0079222_10556756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300006804|Ga0079221_10000863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 9102 | Open in IMG/M |
3300006804|Ga0079221_10007672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4009 | Open in IMG/M |
3300006847|Ga0075431_101035982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 787 | Open in IMG/M |
3300006852|Ga0075433_10048279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3702 | Open in IMG/M |
3300006854|Ga0075425_100059324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4290 | Open in IMG/M |
3300006854|Ga0075425_100260689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1994 | Open in IMG/M |
3300006871|Ga0075434_100762377 | Not Available | 984 | Open in IMG/M |
3300006903|Ga0075426_10032942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3703 | Open in IMG/M |
3300006903|Ga0075426_10305311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1164 | Open in IMG/M |
3300006903|Ga0075426_10511621 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300006914|Ga0075436_100030088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3736 | Open in IMG/M |
3300007076|Ga0075435_101062137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → unclassified Saccharopolyspora → Saccharopolyspora sp. 6T | 707 | Open in IMG/M |
3300009147|Ga0114129_10210447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2629 | Open in IMG/M |
3300009162|Ga0075423_10042794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4639 | Open in IMG/M |
3300009174|Ga0105241_10114143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Umezawaea → Umezawaea beigongshangensis | 2166 | Open in IMG/M |
3300009545|Ga0105237_10217043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1913 | Open in IMG/M |
3300010375|Ga0105239_10076826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 3673 | Open in IMG/M |
3300010396|Ga0134126_10092642 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 3723 | Open in IMG/M |
3300010400|Ga0134122_10028061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4248 | Open in IMG/M |
3300010400|Ga0134122_12243818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. TF02-6 | 590 | Open in IMG/M |
3300012497|Ga0157319_1016697 | Not Available | 670 | Open in IMG/M |
3300013296|Ga0157374_10096502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2828 | Open in IMG/M |
3300014968|Ga0157379_10040529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4157 | Open in IMG/M |
3300015372|Ga0132256_100644106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
3300020070|Ga0206356_10011503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2014 | Open in IMG/M |
3300020081|Ga0206354_10475812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2032 | Open in IMG/M |
3300020082|Ga0206353_11428358 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300022467|Ga0224712_10018175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2345 | Open in IMG/M |
3300025901|Ga0207688_10044831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2465 | Open in IMG/M |
3300025907|Ga0207645_10135965 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300025909|Ga0207705_10003883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11370 | Open in IMG/M |
3300025909|Ga0207705_10064985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2637 | Open in IMG/M |
3300025911|Ga0207654_10038519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2683 | Open in IMG/M |
3300025917|Ga0207660_10563118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
3300025925|Ga0207650_10001714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15564 | Open in IMG/M |
3300025925|Ga0207650_10020798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4633 | Open in IMG/M |
3300025925|Ga0207650_10071543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2609 | Open in IMG/M |
3300025927|Ga0207687_10627474 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300025927|Ga0207687_10957202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
3300025934|Ga0207686_10417110 | Not Available | 1026 | Open in IMG/M |
3300025941|Ga0207711_10216434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1751 | Open in IMG/M |
3300025942|Ga0207689_10011484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 7591 | Open in IMG/M |
3300025942|Ga0207689_10039869 | All Organisms → cellular organisms → Bacteria | 3888 | Open in IMG/M |
3300025942|Ga0207689_10085251 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
3300025944|Ga0207661_10018771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5143 | Open in IMG/M |
3300025944|Ga0207661_10127423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2175 | Open in IMG/M |
3300025945|Ga0207679_10332342 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300025945|Ga0207679_10576039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1012 | Open in IMG/M |
3300025949|Ga0207667_11511712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 642 | Open in IMG/M |
3300025960|Ga0207651_10701870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → unclassified Saccharopolyspora → Saccharopolyspora sp. 6T | 891 | Open in IMG/M |
3300025960|Ga0207651_11136882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
3300025981|Ga0207640_10359549 | Not Available | 1172 | Open in IMG/M |
3300026023|Ga0207677_10819644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 834 | Open in IMG/M |
3300026041|Ga0207639_10928089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300026075|Ga0207708_10579246 | Not Available | 949 | Open in IMG/M |
3300026078|Ga0207702_10165749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2021 | Open in IMG/M |
3300026088|Ga0207641_10019265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5599 | Open in IMG/M |
3300026118|Ga0207675_100073258 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
3300026142|Ga0207698_10077583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2664 | Open in IMG/M |
3300027873|Ga0209814_10104163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1205 | Open in IMG/M |
3300027880|Ga0209481_10101662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1389 | Open in IMG/M |
3300027907|Ga0207428_10006873 | All Organisms → cellular organisms → Bacteria | 10426 | Open in IMG/M |
3300027907|Ga0207428_10961122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 602 | Open in IMG/M |
3300028379|Ga0268266_10845680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 12.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 11.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.10% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24752J21851_10252323 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | GKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070658_103340872 | 3300005327 | Corn Rhizosphere | VDAGGVQAASGKAEGSADTGVVSVDPENAAGRRLGVVRAASESGDMA* |
Ga0070658_104685541 | 3300005327 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070658_107831323 | 3300005327 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGGTP* |
Ga0070676_100252404 | 3300005328 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0070676_103777032 | 3300005328 | Miscanthus Rhizosphere | LRLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070683_1019552601 | 3300005329 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVDRSIPDNAASRRLGVAGAARQLGDTP* |
Ga0070670_1000179522 | 3300005331 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVDRSIPENAAGRRLGVVRAASESGDMA* |
Ga0070670_1001122391 | 3300005331 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070670_1001485233 | 3300005331 | Switchgrass Rhizosphere | LRLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070677_108448151 | 3300005333 | Miscanthus Rhizosphere | AGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0068869_1000265075 | 3300005334 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQ |
Ga0068869_1000983361 | 3300005334 | Miscanthus Rhizosphere | AVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070666_100535103 | 3300005335 | Switchgrass Rhizosphere | VDAAGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070666_102658583 | 3300005335 | Switchgrass Rhizosphere | VQAASGKAEGSADTGVVSVDPENAAGRRLGVVRAASESGDMA* |
Ga0070682_1000083184 | 3300005337 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070687_1003680282 | 3300005343 | Switchgrass Rhizosphere | QLAVDADGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070661_1003472541 | 3300005344 | Corn Rhizosphere | LRLGRVSQLAVDAGGVQAASGKAEESADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0070692_103554761 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070668_1010858642 | 3300005347 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0070669_1014429971 | 3300005353 | Switchgrass Rhizosphere | PLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070671_1001507471 | 3300005355 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVVSADPDNAAGRPLGAAGAARQWGDTP* |
Ga0070671_1001609702 | 3300005355 | Switchgrass Rhizosphere | SQLAVDAGGVQAASGKAEGSADTGVVSVDPDNAASRRLGVAGAARQLGDTR* |
Ga0070688_1000485603 | 3300005365 | Switchgrass Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAVRQWGDTP* |
Ga0070703_102863751 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQ |
Ga0070709_100791321 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSVDPDNAAGRRLGVAGAARQLGTRP |
Ga0070709_110507641 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVQAASGKAEGSADTGVDRSIPENAAGRRLGVVRAASESGDMA* |
Ga0070713_1003831773 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRVSQLAVDAGGVQAASGKAEGSADTGVVSVDPDNAAGRRLGVAGAARQLGDTP* |
Ga0070705_1001544563 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0070663_1003515483 | 3300005455 | Corn Rhizosphere | QAASGKAEGSADTGVVSVDPENAAGRRLGVVRAASESGDMA* |
Ga0070663_1012957772 | 3300005455 | Corn Rhizosphere | VDADGVQAASGKAEGSADTGVVRSTPDNAAGRRLDAVRAASELGDMP* |
Ga0070678_1005903541 | 3300005456 | Miscanthus Rhizosphere | LGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070681_101901663 | 3300005458 | Corn Rhizosphere | LRLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0070679_1001219353 | 3300005530 | Corn Rhizosphere | ASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0070686_1001456573 | 3300005544 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVVSVDPENAAGRRLGVVRAASQSGDMA* |
Ga0070704_1005143092 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VDADGVQAASGKAEGSADTGVVSVDPENAAGRRLGVVRAASESGDMA* |
Ga0070704_1010613502 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGLPAASSKAEGSADTGVVSADPDNAAGRRLGAAGAARQ |
Ga0068854_1001977563 | 3300005578 | Corn Rhizosphere | GKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0068856_1000315756 | 3300005614 | Corn Rhizosphere | LAVDAGGVPAASGKAEGSADTGVVSVDPDTAAGRRPGDAGAARQWGDMP* |
Ga0068856_1000316121 | 3300005614 | Corn Rhizosphere | SGKAEGSADTGVDRSIPDNAASRRLGVAGAARQLGDTP* |
Ga0068856_1000787281 | 3300005614 | Corn Rhizosphere | RVSQLAVDAGGVQAASGKAEGSADTGVDRSIPDNAAGRRLGVAGAARQLGDTP* |
Ga0068856_1001839361 | 3300005614 | Corn Rhizosphere | SGKAEGSADTGVDRSIPDNAAGRRLGVAGAARQLGDTP* |
Ga0068856_1002671673 | 3300005614 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTRVVSVDSDNAAGRRLGVAGAARQLGDTP* |
Ga0068856_1002903153 | 3300005614 | Corn Rhizosphere | SGKAEGSADTGVVSVDSDNAAGRRLGVAGAARQLGDTP* |
Ga0068856_1003084153 | 3300005614 | Corn Rhizosphere | LAVDAGGVQAASGEAEGSADTGVDRSIPDNAASRRLGVAGAARQLGDTP* |
Ga0068856_1006087131 | 3300005614 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGDVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0068856_1015022691 | 3300005614 | Corn Rhizosphere | GKAEGSADTGVDRSIPDNAASRRLGVAGAARQLGDTP* |
Ga0070702_1000881763 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGVQAASGKAEGSADTGVVSADPDNAAGRPLGAAGAARQWGDTP* |
Ga0068852_1005093802 | 3300005616 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRPLGAAGAARQWGDTP* |
Ga0068859_1002649431 | 3300005617 | Switchgrass Rhizosphere | AEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0068859_1003188071 | 3300005617 | Switchgrass Rhizosphere | KAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0068864_1010219431 | 3300005618 | Switchgrass Rhizosphere | AVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0068861_1005153983 | 3300005719 | Switchgrass Rhizosphere | LGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0068863_1000188241 | 3300005841 | Switchgrass Rhizosphere | ASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0068863_1001768593 | 3300005841 | Switchgrass Rhizosphere | GVQAASGKAEGSADTGVVSVDPDNAAGRRVGVAGAARQLGDTP* |
Ga0068863_1003033032 | 3300005841 | Switchgrass Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSVDSDNAAGRRLGVAGAARQLGDTP* |
Ga0070717_104907152 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVDRSIPDNAAGRRLGVAGAARQLGDTP* |
Ga0070717_109690082 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSVDPDNAASRRLGVAGAARQLGDTP* |
Ga0070717_113902061 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VQAASGKAEGSADTGVDRSIPDNAAGRRLGAVRAASGFGDMP* |
Ga0070712_1008232012 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSVDPDNAAGRRLGVAGAARQLGDTP* |
Ga0070712_1015861261 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGRVSQLAVDAGGVQAASGKAEGSADTGVDRSIPDNAASRRLGVAGAARQLGDTP* |
Ga0075422_100591313 | 3300006196 | Populus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0097621_1018389551 | 3300006237 | Miscanthus Rhizosphere | GVQAASGKAEGSADTGVVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0068871_1008905011 | 3300006358 | Miscanthus Rhizosphere | QAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0079222_105567562 | 3300006755 | Agricultural Soil | AASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0079221_100008638 | 3300006804 | Agricultural Soil | LAVDAGGVQTASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0079221_100076725 | 3300006804 | Agricultural Soil | VSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0075431_1010359821 | 3300006847 | Populus Rhizosphere | AEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0075433_100482795 | 3300006852 | Populus Rhizosphere | QAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0075425_1000593241 | 3300006854 | Populus Rhizosphere | PLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0075425_1002606893 | 3300006854 | Populus Rhizosphere | VSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0075434_1007623771 | 3300006871 | Populus Rhizosphere | GGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0075426_100329426 | 3300006903 | Populus Rhizosphere | GGVQAASGKAEGSADTGVVSADPDNAAGVVWGAAGAARQLGDTP* |
Ga0075426_103053111 | 3300006903 | Populus Rhizosphere | EGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0075426_105116211 | 3300006903 | Populus Rhizosphere | GVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0075436_1000300881 | 3300006914 | Populus Rhizosphere | ASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0075435_1010621372 | 3300007076 | Populus Rhizosphere | EGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0114129_102104474 | 3300009147 | Populus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAA |
Ga0075423_100427941 | 3300009162 | Populus Rhizosphere | QQFVPRGLFSGLLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0105241_101141431 | 3300009174 | Corn Rhizosphere | AGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP* |
Ga0105237_102170431 | 3300009545 | Corn Rhizosphere | PLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGGTP* |
Ga0105239_100768264 | 3300010375 | Corn Rhizosphere | LAVDAGGVQAASGKAAGPADTGVVSADPDNAAGRRLDAAGAA |
Ga0134126_100926425 | 3300010396 | Terrestrial Soil | LAVDAGGVQTASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQW |
Ga0134122_100280611 | 3300010400 | Terrestrial Soil | GGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0134122_122438181 | 3300010400 | Terrestrial Soil | PLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRPLGAAGAARQWGDTP* |
Ga0157319_10166972 | 3300012497 | Arabidopsis Rhizosphere | LAVDAGGVQAASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQLGDTP* |
Ga0157374_100965024 | 3300013296 | Miscanthus Rhizosphere | GGVQAASGKAEGSADTGVVSADPGNAAGRRLGAAGAARQLGDTP* |
Ga0157379_100405291 | 3300014968 | Switchgrass Rhizosphere | LAVDAGGVQTASGKAEGPADTGVVSADPDNAAGRRLDAAGAARQLGDTP* |
Ga0132256_1006441062 | 3300015372 | Arabidopsis Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGLRLDAAGAARQLGGTP* |
Ga0206356_100115031 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | SQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0206354_104758121 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0206353_114283581 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVLAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQ |
Ga0224712_100181753 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVWAASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207688_100448313 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | SPSAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207645_101359652 | 3300025907 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207705_100038831 | 3300025909 | Corn Rhizosphere | SGKAEGSADTGVVSVDPDNAAGRPLGAAGAARQWGDTP |
Ga0207705_100649851 | 3300025909 | Corn Rhizosphere | ASGKAEESADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207654_100385195 | 3300025911 | Corn Rhizosphere | GKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207660_105631183 | 3300025917 | Corn Rhizosphere | SGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207650_100017141 | 3300025925 | Switchgrass Rhizosphere | SPLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207650_100207986 | 3300025925 | Switchgrass Rhizosphere | GVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207650_100715431 | 3300025925 | Switchgrass Rhizosphere | AASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207687_106274741 | 3300025927 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGD |
Ga0207687_109572022 | 3300025927 | Miscanthus Rhizosphere | LAVDADGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQL |
Ga0207686_104171101 | 3300025934 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGLRLGAAGAARQLGDTPKLLDRD |
Ga0207711_102164341 | 3300025941 | Switchgrass Rhizosphere | SQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207689_100114841 | 3300025942 | Miscanthus Rhizosphere | GFSGAGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207689_100398691 | 3300025942 | Miscanthus Rhizosphere | QAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207689_100852514 | 3300025942 | Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGA |
Ga0207661_100187716 | 3300025944 | Corn Rhizosphere | GRGLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207661_101274235 | 3300025944 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAA |
Ga0207679_103323421 | 3300025945 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRPLGAAGA |
Ga0207679_105760392 | 3300025945 | Corn Rhizosphere | AVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207667_115117121 | 3300025949 | Corn Rhizosphere | VDADGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207651_107018701 | 3300025960 | Switchgrass Rhizosphere | LGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207651_111368821 | 3300025960 | Switchgrass Rhizosphere | LAVDAGGVQAASGKAVGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207640_103595491 | 3300025981 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDT |
Ga0207677_108196441 | 3300026023 | Miscanthus Rhizosphere | AGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207639_109280891 | 3300026041 | Corn Rhizosphere | PLGRVSQLAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207708_105792461 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTPKLL |
Ga0207702_101657491 | 3300026078 | Corn Rhizosphere | AVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
Ga0207641_100192657 | 3300026088 | Switchgrass Rhizosphere | GRVSQVAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207675_1000732584 | 3300026118 | Switchgrass Rhizosphere | GLVSPLAVDAGGVQTASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0207698_100775834 | 3300026142 | Corn Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGA |
Ga0209814_101041631 | 3300027873 | Populus Rhizosphere | LGRVSPLAVDAGGVQAASGKAEESADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0209481_101016622 | 3300027880 | Populus Rhizosphere | LAVDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207428_100068731 | 3300027907 | Populus Rhizosphere | AASGKAEGSADTGVVSADPDNAAGRRLGAAGAARQLGDTP |
Ga0207428_109611222 | 3300027907 | Populus Rhizosphere | WAASGKAEGPADTGVVSADPDNAAGRRLGAAGAARQWGDTP |
Ga0268266_108456802 | 3300028379 | Switchgrass Rhizosphere | VDAGGVQAASGKAEGSADTGVVSADPDNAAGRRLDAAGAARQLGDTP |
⦗Top⦘ |