Basic Information | |
---|---|
Family ID | F063890 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 39 residues |
Representative Sequence | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAVNGPKA |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.45 % |
% of genes from short scaffolds (< 2000 bps) | 88.37 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.473 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.729 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.682 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.465 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF00224 | PK | 57.36 |
PF02887 | PK_C | 10.08 |
PF03992 | ABM | 2.33 |
PF01694 | Rhomboid | 1.55 |
PF14522 | Cytochrome_C7 | 0.78 |
PF00072 | Response_reg | 0.78 |
PF00805 | Pentapeptide | 0.78 |
PF13620 | CarboxypepD_reg | 0.78 |
PF03631 | Virul_fac_BrkB | 0.78 |
PF13432 | TPR_16 | 0.78 |
PF07238 | PilZ | 0.78 |
PF04389 | Peptidase_M28 | 0.78 |
PF01797 | Y1_Tnp | 0.78 |
PF12695 | Abhydrolase_5 | 0.78 |
PF11645 | PDDEXK_5 | 0.78 |
PF02769 | AIRS_C | 0.78 |
PF00144 | Beta-lactamase | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 67.44 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.78 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.78 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.78 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.47 % |
Unclassified | root | N/A | 8.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10639508 | Not Available | 616 | Open in IMG/M |
3300002917|JGI25616J43925_10376483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300004080|Ga0062385_10134362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1254 | Open in IMG/M |
3300004476|Ga0068966_1374466 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005177|Ga0066690_10590168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 742 | Open in IMG/M |
3300005437|Ga0070710_10808976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 670 | Open in IMG/M |
3300005533|Ga0070734_10064896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2180 | Open in IMG/M |
3300005538|Ga0070731_10642800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 705 | Open in IMG/M |
3300005538|Ga0070731_10834152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 611 | Open in IMG/M |
3300005575|Ga0066702_10951915 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005587|Ga0066654_10668866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 579 | Open in IMG/M |
3300005591|Ga0070761_10547073 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005873|Ga0075287_1007193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1321 | Open in IMG/M |
3300005896|Ga0075282_1061333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300005921|Ga0070766_10294713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1040 | Open in IMG/M |
3300005995|Ga0066790_10206526 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300006102|Ga0075015_101013080 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006176|Ga0070765_100018139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 5179 | Open in IMG/M |
3300006794|Ga0066658_10280427 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006914|Ga0075436_100728080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 736 | Open in IMG/M |
3300007982|Ga0102924_1288724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300009038|Ga0099829_10477438 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300009038|Ga0099829_10615193 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300009524|Ga0116225_1071874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
3300009524|Ga0116225_1513948 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009624|Ga0116105_1074474 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300009759|Ga0116101_1030341 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300010046|Ga0126384_10569559 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300010358|Ga0126370_12435051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300010361|Ga0126378_11327421 | Not Available | 813 | Open in IMG/M |
3300010379|Ga0136449_100238661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 3393 | Open in IMG/M |
3300012208|Ga0137376_11810497 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300012918|Ga0137396_11137458 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012986|Ga0164304_10191809 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300014161|Ga0181529_10021514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5301 | Open in IMG/M |
3300016270|Ga0182036_11629501 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300017940|Ga0187853_10448507 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300017948|Ga0187847_10065679 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
3300017961|Ga0187778_10556306 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300017972|Ga0187781_11118946 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300017988|Ga0181520_10666663 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300018022|Ga0187864_10344410 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018023|Ga0187889_10111485 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300018035|Ga0187875_10236441 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300018038|Ga0187855_10092006 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
3300018042|Ga0187871_10384120 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300018085|Ga0187772_11427425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300018086|Ga0187769_11451396 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018088|Ga0187771_10609297 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300018088|Ga0187771_11806911 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018090|Ga0187770_11280065 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300018468|Ga0066662_10154432 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300018468|Ga0066662_12093002 | Not Available | 593 | Open in IMG/M |
3300020579|Ga0210407_11368955 | Not Available | 526 | Open in IMG/M |
3300020580|Ga0210403_10640999 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300020580|Ga0210403_11231785 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300020580|Ga0210403_11284188 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300020581|Ga0210399_11281355 | Not Available | 578 | Open in IMG/M |
3300020582|Ga0210395_10735973 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300020583|Ga0210401_10324166 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300021180|Ga0210396_10278268 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300021401|Ga0210393_10999713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 677 | Open in IMG/M |
3300021402|Ga0210385_11527315 | Not Available | 510 | Open in IMG/M |
3300021404|Ga0210389_10178048 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300021405|Ga0210387_11120662 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300021407|Ga0210383_10226035 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300021433|Ga0210391_10539125 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300021476|Ga0187846_10279309 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300021478|Ga0210402_11651274 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021479|Ga0210410_11301341 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300021479|Ga0210410_11411394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300021560|Ga0126371_13798383 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300021861|Ga0213853_10855090 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300024049|Ga0233359_1028197 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300024288|Ga0179589_10576956 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300025898|Ga0207692_10666647 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300025910|Ga0207684_10086736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2666 | Open in IMG/M |
3300026551|Ga0209648_10244710 | Not Available | 1333 | Open in IMG/M |
3300027158|Ga0208725_1032687 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300027545|Ga0209008_1111123 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300027576|Ga0209003_1012658 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300027609|Ga0209221_1019134 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300027635|Ga0209625_1097037 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300027727|Ga0209328_10064920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
3300027795|Ga0209139_10347054 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300027853|Ga0209274_10008945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4521 | Open in IMG/M |
3300027854|Ga0209517_10003976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19717 | Open in IMG/M |
3300027855|Ga0209693_10357916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300027869|Ga0209579_10035618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2698 | Open in IMG/M |
3300027884|Ga0209275_10799026 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300027889|Ga0209380_10888112 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300027895|Ga0209624_10000970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24004 | Open in IMG/M |
3300027898|Ga0209067_10071603 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300027905|Ga0209415_10328980 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300027905|Ga0209415_10495877 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300027905|Ga0209415_10615148 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300027911|Ga0209698_11280296 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300028800|Ga0265338_10578591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300028906|Ga0308309_10186650 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300029636|Ga0222749_10413748 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300029882|Ga0311368_10277495 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300029951|Ga0311371_10389394 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
3300030580|Ga0311355_10571472 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300030707|Ga0310038_10311114 | Not Available | 707 | Open in IMG/M |
3300030760|Ga0265762_1112842 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300030862|Ga0265753_1137797 | Not Available | 521 | Open in IMG/M |
3300030878|Ga0265770_1093749 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300031090|Ga0265760_10004828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3862 | Open in IMG/M |
3300031090|Ga0265760_10175194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300031233|Ga0302307_10034650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2752 | Open in IMG/M |
3300031344|Ga0265316_10336025 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300031708|Ga0310686_102560316 | Not Available | 503 | Open in IMG/M |
3300031715|Ga0307476_10385902 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300031716|Ga0310813_10945879 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300031718|Ga0307474_10044299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3282 | Open in IMG/M |
3300031823|Ga0307478_10122538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2039 | Open in IMG/M |
3300031823|Ga0307478_10475635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300031879|Ga0306919_10179907 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
3300031890|Ga0306925_10934914 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300031890|Ga0306925_11113835 | Not Available | 797 | Open in IMG/M |
3300032180|Ga0307471_102306731 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300032783|Ga0335079_11204945 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300032829|Ga0335070_10207015 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
3300032892|Ga0335081_10827348 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300032895|Ga0335074_10116116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 3482 | Open in IMG/M |
3300032896|Ga0335075_10493502 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300033134|Ga0335073_11172043 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300033134|Ga0335073_11780646 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300033158|Ga0335077_10347615 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.73% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.20% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.20% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.10% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.10% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.10% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.55% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.55% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.78% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_106395082 | 3300001593 | Forest Soil | SLVILVGAEFNAMLFPRAFLGKELKEMPAPQTATK* |
JGI25616J43925_103764833 | 3300002917 | Grasslands Soil | LVWMYMVSLVVLVGAEFNAMLFPRAMLGKELTAINGPRAAD* |
Ga0062385_101343621 | 3300004080 | Bog Forest Soil | LLVWMYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTASK* |
Ga0068966_13744661 | 3300004476 | Peatlands Soil | ALLVWMYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTATK* |
Ga0066690_105901681 | 3300005177 | Soil | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAIPATNEA* |
Ga0070710_108089761 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | WMYLISVVILIGAEFNAMLFPRALASAKSALNGRELSIG* |
Ga0070734_100648961 | 3300005533 | Surface Soil | VWMYMISLVILVGAEFNAMLFPRAMLGKELRDMALPRAVRE* |
Ga0070731_106428002 | 3300005538 | Surface Soil | LVWMYMISLVVLVGAEFNALLFPRAMLGKELTAINSTKP* |
Ga0070731_108341523 | 3300005538 | Surface Soil | WMYMVSLVVLIGAEFNAMLFPRAMLGKELTAISGPRT* |
Ga0066702_109519152 | 3300005575 | Soil | WMYLISLVILIGAEFNAMLFPRSTLGSELTAVGTT* |
Ga0066654_106688661 | 3300005587 | Soil | LVWMYLISLVILIGAEFNAMLFPRSTLGSELTAVGTAT* |
Ga0070761_105470732 | 3300005591 | Soil | MVSLVVLVGAEFNAMLFPRAMLGKELTAVNGPRAAK* |
Ga0075287_10071932 | 3300005873 | Rice Paddy Soil | VWMYLISLVILVGAEFNALLFPRAMLGKELTKIAATE* |
Ga0075282_10613332 | 3300005896 | Rice Paddy Soil | LLVWMYMISLVILVGAEFNAMLFPRAWLGKELTAAGGPKEIGN* |
Ga0070766_102947132 | 3300005921 | Soil | ALLVWMYMISLIILVCAEFNAMIFPRATLGKELRGMAAPRNTAPVAGP* |
Ga0066790_102065263 | 3300005995 | Soil | WMYMISLVILVGAEFNAMLFPRAFLGKELRTMPTPQTAAK* |
Ga0075015_1010130801 | 3300006102 | Watersheds | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAVNGPKA* |
Ga0070765_1000181391 | 3300006176 | Soil | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAINKA* |
Ga0066658_102804272 | 3300006794 | Soil | VCMYMISLVILVGAEFNALLFPRAMLGKELTKIPATE* |
Ga0075436_1007280801 | 3300006914 | Populus Rhizosphere | LVWMYMISLVVLVGAEMNAMLFPRAMLGKQLADIPARRVSE* |
Ga0102924_12887241 | 3300007982 | Iron-Sulfur Acid Spring | MYLISLVILVRAEFNAMLFPRAFLGKELKEMPAPQTATK* |
Ga0099829_104774382 | 3300009038 | Vadose Zone Soil | WMYMISLVILVGAEFNAMLFPRAMLGKELTAINGPKAAD* |
Ga0099829_106151931 | 3300009038 | Vadose Zone Soil | IALLVWMYMISLVILVGAEFNAMLFPRTRLGRELTETASSKVTGR* |
Ga0116225_10718743 | 3300009524 | Peatlands Soil | MYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTATK* |
Ga0116225_15139482 | 3300009524 | Peatlands Soil | LVWMYMVSLVVLVGAEFNAMLFPRAMLGKELTAISGPKAAD* |
Ga0116105_10744742 | 3300009624 | Peatland | LISLVVLVGAEFNALLFPRAMLGKELTAINDSKP* |
Ga0116101_10303411 | 3300009759 | Peatland | AWMYLISLVILVGAEFNALLFPRAMLGKELTAVNSAKA* |
Ga0126384_105695593 | 3300010046 | Tropical Forest Soil | LVWMYMISLIILVGAEFNAMLFPRAMLGRELVAMSNAPVKNS* |
Ga0126370_124350511 | 3300010358 | Tropical Forest Soil | MYLISLVVLVGAEFNALLFPRAMLGKELTAINSSKS* |
Ga0126378_113274211 | 3300010361 | Tropical Forest Soil | LVWMYLISLMVLVGAEFNALLFPRAMLGKELTAINSKP* |
Ga0136449_1002386611 | 3300010379 | Peatlands Soil | LLVWMYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTTTK* |
Ga0137376_118104972 | 3300012208 | Vadose Zone Soil | WMYMISLVILIGAEFNAMLFPRSTLGSELTAVGTAI* |
Ga0137396_111374582 | 3300012918 | Vadose Zone Soil | SLVILVGAEFNAMLFPRAMLGKELTAISSPKAAD* |
Ga0164304_101918091 | 3300012986 | Soil | LISVVILIGAEFNAMLFPRALASDKSALNGRELSIG* |
Ga0181529_100215149 | 3300014161 | Bog | AWMYLISLAILVGAELNALLFPRARLGKELIAVNGSKP* |
Ga0182036_116295011 | 3300016270 | Soil | MISLVVLVGAELNAMLFPRAWLGKQLAGIPASRPVPAEKI |
Ga0187853_104485072 | 3300017940 | Peatland | VWMYMISLVILIGAEFNAMLFPRATLGKELTAINHPRS |
Ga0187847_100656791 | 3300017948 | Peatland | LAWMYLISLVVLVGAEFNALLFPRAMLGKELTAVNSAKA |
Ga0187778_105563062 | 3300017961 | Tropical Peatland | MYMISLVILVGAEVNALLFPRAMLGKELKQMPAPKSGTYVS |
Ga0187781_111189461 | 3300017972 | Tropical Peatland | MYLISLVVLIGAEFNALLFPRAMLGKELTAINSPKP |
Ga0181520_106666632 | 3300017988 | Bog | ALLIWMYLISLVVLVGAEFNAMLFPRAFLGKELKAMPARQTASK |
Ga0187864_103444101 | 3300018022 | Peatland | IALLVWMYMISLVILIGAEFNAMLFPRATLGKELTAINHPRS |
Ga0187889_101114851 | 3300018023 | Peatland | WMYMISLVILIGAEFNAMLFPRATLGKELTAINHPRS |
Ga0187875_102364411 | 3300018035 | Peatland | LLAWMYLISLVVLVGAEFNALLFPRAMLGKELTAVNSAKA |
Ga0187855_100920062 | 3300018038 | Peatland | AWMYLISLVVLVGAEFNALLFPRAMLGKELTAVNSAKA |
Ga0187871_103841202 | 3300018042 | Peatland | GAAMALLSWMYMSSLVVLVGAEFNALLFPRAMLGKELTAVNATKA |
Ga0187772_114274251 | 3300018085 | Tropical Peatland | YMVSLVVLVGAEFNAMIFPRAMLGKELIAINGPKAMATPRS |
Ga0187769_114513961 | 3300018086 | Tropical Peatland | LLVWMYLISLVVLIGSEFNALLFPRAMLGKELKAVNNHKAG |
Ga0187771_106092972 | 3300018088 | Tropical Peatland | LISLAVLVGAEFNALLFPRAMLGKELKAVNCVKPTAL |
Ga0187771_118069112 | 3300018088 | Tropical Peatland | LVWMYLISLVVLVGAEFNALLFPRAMLGKELTAIHAPKALVD |
Ga0187770_112800652 | 3300018090 | Tropical Peatland | VWMYMISLVILVGAEFNAMLFPRATLGKELREMAAPKALGR |
Ga0066662_101544321 | 3300018468 | Grasslands Soil | WMYMISLVILVGAEFNALLFPRAMLGKELTKIPASE |
Ga0066662_120930021 | 3300018468 | Grasslands Soil | GGVALAVWMYMVCLVILVGAEFSAMLFPRAMLGKELTAINGPKAAD |
Ga0210407_113689551 | 3300020579 | Soil | GVAVALLVWMYMVSLVILVAAEYNAMLFPRRMLGKELNGMAKPNAEAR |
Ga0210403_106409992 | 3300020580 | Soil | LLVWMYMISLVILVGAEFNAMLFPRLLLGKELKEMPAPKAVTR |
Ga0210403_112317851 | 3300020580 | Soil | MYLISLVVLVGAEFNALLFPRAMLGKELTAVNDPKP |
Ga0210403_112841881 | 3300020580 | Soil | LVILIGAEFNAMLFPRAFLGKELKQAPTPKPAIVAD |
Ga0210399_112813551 | 3300020581 | Soil | VWMYLISLVILIGAEFNAMLFQRALVGKELKAMPAPQTATK |
Ga0210395_107359733 | 3300020582 | Soil | LLVWMYLISLVVLVGAEFNALLFPRAMLGKELTALNGPKAAN |
Ga0210401_103241661 | 3300020583 | Soil | MYLISLVVLIGAEFNALLFPRAMLGKELTALNGPKM |
Ga0210396_102782681 | 3300021180 | Soil | YMSSLVILVGAEFNALLFPRAMLGKELTAINTAKPENT |
Ga0210393_109997131 | 3300021401 | Soil | AIALLVWMYMVSLVVLVGAEFNAMLFPRTMLGKELTAVSGPRAAN |
Ga0210385_115273151 | 3300021402 | Soil | MSLISLVVLVGAEFNALLFPRAMLGKELTQVSARKA |
Ga0210389_101780482 | 3300021404 | Soil | MYLISLVVLVGAEFNALLFPRAMLGKELTAINSSKA |
Ga0210387_111206621 | 3300021405 | Soil | IALLVWMYMVALVILVGAEFNAMLFPRAMLGKELTAVSGPRAAD |
Ga0210383_102260351 | 3300021407 | Soil | ALLVWMYLISLVILVGAEFNAMLFPRAFLGKELKAMPTPQPATK |
Ga0210391_105391251 | 3300021433 | Soil | WMYLISLVVLVGAEFNAMLFPRAFLGKELKAMPAPQTASK |
Ga0187846_102793092 | 3300021476 | Biofilm | LVWMYLISLVVLVGAEFNALLFPRAMLGKELTAINTSKS |
Ga0210402_116512742 | 3300021478 | Soil | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAINSSKA |
Ga0210410_113013411 | 3300021479 | Soil | YMVSLVILVGAEFNAMLFPRAMLGKELTAIQGQRAN |
Ga0210410_114113941 | 3300021479 | Soil | MYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTATK |
Ga0126371_137983832 | 3300021560 | Tropical Forest Soil | WMYMVSLVVLVGAEFNAMLFPRAMLGKELQAIGEAAIRRA |
Ga0213853_108550901 | 3300021861 | Watersheds | LVWMYLISLVVLVGAEFNAMLFPRAMLGKELTQVTSREP |
Ga0233359_10281971 | 3300024049 | Soil | LVVLVGAEFNAMLFPRAMLGKELIAISSVGKEGKAL |
Ga0179589_105769561 | 3300024288 | Vadose Zone Soil | YFISLVVLVGAEFNELLFPRAMLGKELTAIPAKIIT |
Ga0207692_106666472 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | WMYLISVVILIGAEFNAMLFPRALASAKSALNGRELSIG |
Ga0207684_100867361 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YLISLVVLVGAEFNALLFPRTMLGKELTAINGPKAAS |
Ga0209648_102447102 | 3300026551 | Grasslands Soil | LLVWMYMVSLVVLVGAEFNAMLFPRAMLGKELTAVSQR |
Ga0208725_10326872 | 3300027158 | Forest Soil | WMYMVSLVVLVGAEFNAMLFPRTMLGKELTAVSGPRAAN |
Ga0209008_11111231 | 3300027545 | Forest Soil | VWMYLISLVVLVGAEFNALLFPRAMLGKELTAINKA |
Ga0209003_10126581 | 3300027576 | Forest Soil | LLVWMYMVSLIVLIGAEFNAMLFPRAFLGKELSDLGTNANVLAG |
Ga0209221_10191341 | 3300027609 | Forest Soil | GWMYMVALVVLVGAEFNAMLFPRAMLGKELTAINGPRAAE |
Ga0209625_10970371 | 3300027635 | Forest Soil | WMYMVSLVVLVGAEFNAMLFPRAMLGKELIAISSTGKEGRVL |
Ga0209328_100649201 | 3300027727 | Forest Soil | YLISLVVLVGAEFNALLFPRAMLGKELTAINSVKPL |
Ga0209139_103470541 | 3300027795 | Bog Forest Soil | YMISLVVLVGAEFNALLFPRAMLGKELTAISGPKL |
Ga0209274_100089456 | 3300027853 | Soil | LVWMYMVSLVVLVGAEFNAMLFPRAMLGKELTAVSGPRVTK |
Ga0209517_100039761 | 3300027854 | Peatlands Soil | WMYLISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTATK |
Ga0209693_103579162 | 3300027855 | Soil | ISLVILVGAEFNAMLFPRAFLGKELKAMPAPQTTSK |
Ga0209579_100356184 | 3300027869 | Surface Soil | LVWMYLISLVVLVGAEFNALLFPRAMLGKELTAISSPKL |
Ga0209275_107990262 | 3300027884 | Soil | LLVWMYMISLVVLVGAEFNALLFPRAMLGKELTAINSVKA |
Ga0209380_108881121 | 3300027889 | Soil | VWMYMVALVILVGAEFNAMLFPRAMLGKELTAVSGPRAAD |
Ga0209624_1000097023 | 3300027895 | Forest Soil | VWMYMISLVVLVGAEFNALLFPRAMLGKELTAIHGPKVAHP |
Ga0209067_100716031 | 3300027898 | Watersheds | MYFISLVILVGAEFNAMLFPRAMLGKELTAISGPKAAE |
Ga0209415_103289802 | 3300027905 | Peatlands Soil | MYLISLVVLVGAEFNALLFPRAMLGKELTAVNDPRP |
Ga0209415_104958773 | 3300027905 | Peatlands Soil | WMYLISLVVLVGAEFNALLFPRAMLGKELKELTAINASKTTE |
Ga0209415_106151481 | 3300027905 | Peatlands Soil | MYLISLVVLVGAEFNALLFPRAMLGKELTAINDPSGRAAL |
Ga0209698_112802962 | 3300027911 | Watersheds | ALVILIGAEFNAMLFPRAFLGKELKEAPSPKPAIVAD |
Ga0265338_105785911 | 3300028800 | Rhizosphere | MYLISLVVLVGAEFNALLFPRAMLGKELTAVNGPKL |
Ga0308309_101866501 | 3300028906 | Soil | MYLVSLVVLVGAEFNALLFPRAMLGKELVAINTRKA |
Ga0222749_104137482 | 3300029636 | Soil | LVWMYMVSLVILVGAEFNAMLFPRAMLGKELIAINSPKV |
Ga0311368_102774951 | 3300029882 | Palsa | LVILVGAEFNAMLFPRAMLGKELTAINGPRSRFKGGLG |
Ga0311371_103893942 | 3300029951 | Palsa | WMYMISLVVLVGAEFNALLFPRAMLGKELTAINGPKL |
Ga0311355_105714721 | 3300030580 | Palsa | LVWMYLISLTVLVGAELNALLFPRAMLGKELTAINCNKAGR |
Ga0310038_103111142 | 3300030707 | Peatlands Soil | ISLVVLVGAEFNALLFPRAMLGKELKELTAINASKTTE |
Ga0265762_11128422 | 3300030760 | Soil | LIWMYLISLVVLVGAEFNAMLFPRAFLGKELKAMPAPQTTTK |
Ga0265753_11377971 | 3300030862 | Soil | ALLVWMYLISLVVLVGAEFSALLFPRAMLGKELTAVSGSGIRPPSA |
Ga0265770_10937491 | 3300030878 | Soil | LLVWMYMVSLVILVGAEFNAMLFPRAMLGKELTAVNGPRAAN |
Ga0265760_100048281 | 3300031090 | Soil | MYLISLVVLVGAEFNAMLFPRAMLGKELTAVNGPKAAD |
Ga0265760_101751941 | 3300031090 | Soil | LISLVILIGAEFNAMLFPRAFLGKELKEMPAPQTATK |
Ga0302307_100346501 | 3300031233 | Palsa | LIALVVLVGAEFNAMLFPRAMLGKELNAVNGPKAAD |
Ga0265316_103360251 | 3300031344 | Rhizosphere | VWMYLISLMVLVGAEFNALLFPRAMLGKELTAINNIKP |
Ga0310686_1025603161 | 3300031708 | Soil | LVILVGAEFNAMLFPRAMLGKELTAINHVKVEARQAN |
Ga0307476_103859021 | 3300031715 | Hardwood Forest Soil | WMYLISLVVLVGAEFNALLFPRSMLGKELTAINSLKQ |
Ga0310813_109458792 | 3300031716 | Soil | MYMISLIILVGAEFNAMLFPRSQLGRELVAVGEPKTITSD |
Ga0307474_100442991 | 3300031718 | Hardwood Forest Soil | VWMYLISLVVLVGAEFNALLFPRSMLGKELTAINSLKQ |
Ga0307478_101225383 | 3300031823 | Hardwood Forest Soil | FISLVVLVGAEFNAMIFPRTMLGKELTAISGSKVVE |
Ga0307478_104756352 | 3300031823 | Hardwood Forest Soil | YIISLVILIGAEFNAMLFPRAFLGKELKEMPAPQIAAK |
Ga0306919_101799071 | 3300031879 | Soil | YIVSLVILIGAEFNAMLFPRAFLGKELKEAPTPKPAIVAD |
Ga0306925_109349141 | 3300031890 | Soil | LVILIGAEFNAMLFPRAFLGKELKEAPTPKPAIVAD |
Ga0306925_111138351 | 3300031890 | Soil | WMYLISLVVLVGAEFNALLFPRAMLGKELTAINSKP |
Ga0307471_1023067311 | 3300032180 | Hardwood Forest Soil | YMISLVILVGAEFNAMLFPRATLGRELKERASPRAEAQ |
Ga0335079_112049451 | 3300032783 | Soil | ILVCAEFNAMLFPRATLGKELKQRPAPKISPLARS |
Ga0335070_102070153 | 3300032829 | Soil | LLVWMYMISLIVLVGAEFNAMLYPRSQLGRELVAVREPKTAVNG |
Ga0335081_108273482 | 3300032892 | Soil | LLVWMYLISLVVLVGAEFNALLFPRAMLGKELTAINSTRNGSA |
Ga0335074_101161167 | 3300032895 | Soil | VWMYMISLVVLVGAEFNAMIFPRAMLGKELIAASAPRALTR |
Ga0335075_104935021 | 3300032896 | Soil | LVWMYMISLVVLVGAEFNALLFPRAFLGKELTAISANHS |
Ga0335073_111720433 | 3300033134 | Soil | LISLMVLVGAEFNALLFPRAMLGKELTAVNSAKVQN |
Ga0335073_117806461 | 3300033134 | Soil | LLVWMYMISLVVLVGAEFNALLFPRAFLGKELTAISANHS |
Ga0335077_103476151 | 3300033158 | Soil | MVSLIVLVGAEFNAMLFPRAFLGKELSDVGSSANVLAG |
⦗Top⦘ |