NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063794

Metagenome / Metatranscriptome Family F063794

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063794
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 49 residues
Representative Sequence VGFKLTIDAERAAFVPGLARSDAHNVKGSFKDMVEITKLLQVLTSLEAP
Number of Associated Samples 117
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.33 %
% of genes near scaffold ends (potentially truncated) 96.12 %
% of genes from short scaffolds (< 2000 bps) 95.35 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.023 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.853 % of family members)
Environment Ontology (ENVO) Unclassified
(36.434 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.512 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.26%    β-sheet: 0.00%    Coil/Unstructured: 59.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01266DAO 60.47
PF00266Aminotran_5 5.43
PF01979Amidohydro_1 3.10
PF13620CarboxypepD_reg 2.33
PF13594Obsolete Pfam Family 1.55
PF04951Peptidase_M55 1.55
PF02585PIG-L 0.78
PF02810SEC-C 0.78
PF13586DDE_Tnp_1_2 0.78
PF01011PQQ 0.78
PF13517FG-GAP_3 0.78
PF13439Glyco_transf_4 0.78
PF00356LacI 0.78
PF12833HTH_18 0.78
PF01739CheR 0.78
PF07786HGSNAT_cat 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 1.55
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.78
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.78
COG3503Uncharacterized membrane protein, DUF1624 familyFunction unknown [S] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.02 %
UnclassifiedrootN/A6.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_108177975Not Available605Open in IMG/M
3300004479|Ga0062595_102337810All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300005093|Ga0062594_101951705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300005175|Ga0066673_10406392All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300005178|Ga0066688_10886715All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300005184|Ga0066671_10893293All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300005332|Ga0066388_105860158All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005343|Ga0070687_100847813All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300005344|Ga0070661_101915237All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300005445|Ga0070708_101736658All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005450|Ga0066682_10548760Not Available731Open in IMG/M
3300005454|Ga0066687_10693914All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005457|Ga0070662_101596556All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300005459|Ga0068867_100291536All Organisms → cellular organisms → Bacteria → Acidobacteria1342Open in IMG/M
3300005467|Ga0070706_101241892All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300005471|Ga0070698_100674420All Organisms → cellular organisms → Bacteria → Acidobacteria975Open in IMG/M
3300005543|Ga0070672_100087470All Organisms → cellular organisms → Bacteria → Acidobacteria2507Open in IMG/M
3300005545|Ga0070695_101670724All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300005553|Ga0066695_10419839Not Available827Open in IMG/M
3300005561|Ga0066699_10671343All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300005569|Ga0066705_10123351All Organisms → cellular organisms → Bacteria → Acidobacteria1565Open in IMG/M
3300005578|Ga0068854_101707105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005616|Ga0068852_102609931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300005617|Ga0068859_100340276All Organisms → cellular organisms → Bacteria → Acidobacteria1594Open in IMG/M
3300005713|Ga0066905_102320093All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300005764|Ga0066903_103720708All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300006032|Ga0066696_10711910All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300006046|Ga0066652_100642797All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300006237|Ga0097621_100285411All Organisms → cellular organisms → Bacteria → Acidobacteria1454Open in IMG/M
3300006755|Ga0079222_10527636Not Available875Open in IMG/M
3300006846|Ga0075430_101351564All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006847|Ga0075431_100284613All Organisms → cellular organisms → Bacteria → Acidobacteria1673Open in IMG/M
3300006854|Ga0075425_100744540All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300006854|Ga0075425_101427097All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300006854|Ga0075425_102085984All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300006871|Ga0075434_100328855All Organisms → cellular organisms → Bacteria → Acidobacteria1549Open in IMG/M
3300006880|Ga0075429_100218668All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300006903|Ga0075426_10057670All Organisms → cellular organisms → Bacteria2771Open in IMG/M
3300006931|Ga0097620_101153207All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300006953|Ga0074063_13046942All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006969|Ga0075419_11141050All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300007076|Ga0075435_101670112All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300007255|Ga0099791_10100849All Organisms → cellular organisms → Bacteria → Acidobacteria1328Open in IMG/M
3300009012|Ga0066710_102863341All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300009093|Ga0105240_11225381All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300009098|Ga0105245_12028772All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300009147|Ga0114129_10470366All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300009156|Ga0111538_10318877All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300009156|Ga0111538_13264605All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009176|Ga0105242_13041911All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300009177|Ga0105248_11009115All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300009177|Ga0105248_12509957All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300010336|Ga0134071_10784259Not Available509Open in IMG/M
3300010362|Ga0126377_13018375All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300010375|Ga0105239_10378158All Organisms → cellular organisms → Bacteria → Acidobacteria1601Open in IMG/M
3300010375|Ga0105239_11363098All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300010391|Ga0136847_11554583All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300010400|Ga0134122_10059051All Organisms → cellular organisms → Bacteria → Acidobacteria2959Open in IMG/M
3300010400|Ga0134122_12730697Not Available546Open in IMG/M
3300010401|Ga0134121_10167330All Organisms → cellular organisms → Bacteria → Acidobacteria1884Open in IMG/M
3300010401|Ga0134121_13117177All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300010403|Ga0134123_11132992All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300010403|Ga0134123_13070642All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300012096|Ga0137389_10612131All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300012203|Ga0137399_10577209All Organisms → cellular organisms → Bacteria → Acidobacteria945Open in IMG/M
3300012204|Ga0137374_10227050All Organisms → cellular organisms → Bacteria → Acidobacteria1585Open in IMG/M
3300012209|Ga0137379_11078102All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300012685|Ga0137397_11249177All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300012899|Ga0157299_10114262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300012922|Ga0137394_10653848All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300012929|Ga0137404_11272298All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300013307|Ga0157372_11216774All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300014157|Ga0134078_10303809All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300015077|Ga0173483_10756720Not Available555Open in IMG/M
3300015190|Ga0167651_1052205All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300016270|Ga0182036_10207656All Organisms → cellular organisms → Bacteria → Acidobacteria1440Open in IMG/M
3300017657|Ga0134074_1047449All Organisms → cellular organisms → Bacteria → Acidobacteria1451Open in IMG/M
3300018071|Ga0184618_10069729All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300018083|Ga0184628_10307893All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300022756|Ga0222622_10150434All Organisms → cellular organisms → Bacteria → Acidobacteria1500Open in IMG/M
3300025315|Ga0207697_10072314All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300025910|Ga0207684_11010048All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300025922|Ga0207646_10313965All Organisms → cellular organisms → Bacteria → Acidobacteria1416Open in IMG/M
3300025924|Ga0207694_11609516All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300025927|Ga0207687_10200831All Organisms → cellular organisms → Bacteria → Acidobacteria1558Open in IMG/M
3300025927|Ga0207687_11479055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300025933|Ga0207706_11361861All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300025933|Ga0207706_11667364All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300025940|Ga0207691_10257559All Organisms → cellular organisms → Bacteria → Acidobacteria1504Open in IMG/M
3300025941|Ga0207711_10142337All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis2158Open in IMG/M
3300026023|Ga0207677_12266542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300026089|Ga0207648_10439515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1186Open in IMG/M
3300026118|Ga0207675_102670889All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300026142|Ga0207698_11351275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300026312|Ga0209153_1122657All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300027909|Ga0209382_11803495All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300028047|Ga0209526_10523774All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300028380|Ga0268265_10862704All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300028536|Ga0137415_10040285All Organisms → cellular organisms → Bacteria → Acidobacteria4569Open in IMG/M
3300028784|Ga0307282_10221894All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300028807|Ga0307305_10048197All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1963Open in IMG/M
3300028819|Ga0307296_10488737All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300028828|Ga0307312_10970378All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300028906|Ga0308309_11543390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300031544|Ga0318534_10375596All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300031546|Ga0318538_10656815All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300031562|Ga0310886_10308390All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031640|Ga0318555_10657595All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300031716|Ga0310813_11986638All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300031720|Ga0307469_11713700All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300031858|Ga0310892_10514348All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300031890|Ga0306925_12254301All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300031903|Ga0307407_10188264All Organisms → cellular organisms → Bacteria → Acidobacteria1373Open in IMG/M
3300031949|Ga0214473_11380339Not Available718Open in IMG/M
3300031954|Ga0306926_10075291All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis4095Open in IMG/M
3300032000|Ga0310903_10322896All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300032012|Ga0310902_11133867All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300032013|Ga0310906_10992136All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032163|Ga0315281_12100252All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300032179|Ga0310889_10763399All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300032179|Ga0310889_10784617All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300032180|Ga0307471_100404907Not Available1493Open in IMG/M
3300032211|Ga0310896_10607688All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300032782|Ga0335082_11477559All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300032829|Ga0335070_10698265All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300033004|Ga0335084_10636324All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300033004|Ga0335084_11477376All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300033814|Ga0364930_0190489All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300034819|Ga0373958_0154126All Organisms → cellular organisms → Bacteria577Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.55%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.78%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10817797523300000956SoilLDAERASYVPGLVRLDAHNVKGTFPDMIQVTKLLQVIANLEMP*
Ga0062595_10233781023300004479SoilPVALEVGFKLTIDAERAAFVPGVTRSDAHNVKGTFRDMIEITKLLQVLTSLELP*
Ga0062594_10195170513300005093SoilEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ*
Ga0066673_1040639213300005175SoilDAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP*
Ga0066688_1088671513300005178SoilIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMIEITKLLQVLTSLELP*
Ga0066671_1089329313300005184SoilQPYRVTTPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDLIEITKLLQVLTSLELP*
Ga0066388_10586015823300005332Tropical Forest SoilPYRVTAPIDLEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFRDMVEITKLLQVLTSLETP
Ga0070687_10084781323300005343Switchgrass RhizosphereLEVGFKLTIDAERAAFVPGLTRSDAHNVKGTFKDMVQVSKLLQVVTSFAAP*
Ga0070661_10191523723300005344Corn RhizosphereIALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP*
Ga0070708_10173665813300005445Corn, Switchgrass And Miscanthus RhizosphereAPIALEVGFKLTIDAELAAYIPGLSRADAHNVKGTFKDMTEITKLLQVLTSLELP*
Ga0066682_1054876013300005450SoilDLEVGFKLTLDAERASYVPGLVRSDAHSVKGTFPDMIQITKLLQVIANLERP*
Ga0066687_1069391423300005454SoilPYRVTAPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMIEITKLLQVLTSLELP
Ga0070662_10159655613300005457Corn RhizosphereRVRMPIDLEVGFKLTLDAERAAYVPGLTRSDAHSVKGTFHDMTEITRLLQVVGGLELP*
Ga0068867_10029153623300005459Miscanthus RhizosphereLEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP*
Ga0070706_10124189223300005467Corn, Switchgrass And Miscanthus RhizosphereRTPIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFPDLTQITKLLQVVASLELQ*
Ga0070698_10067442023300005471Corn, Switchgrass And Miscanthus RhizosphereFKLTIDAERAAFVPGLSRPDAHSVKGSFRDMVEITKLLQVLTSLEAP*
Ga0070672_10008747013300005543Miscanthus RhizosphereALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ*
Ga0070695_10167072423300005545Corn, Switchgrass And Miscanthus RhizosphereDAERASYVPGLVRSDAHNVKGTFPDMIQITKLLQVIANLERP*
Ga0066695_1041983923300005553SoilAAFVPGLVRSDAHDVRGTFADMVQITKLLQVVANLERP*
Ga0066699_1067134323300005561SoilALDVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP*
Ga0066705_1012335113300005569SoilVGFKLTIDAERAAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP*
Ga0068854_10170710523300005578Corn RhizospherePIALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ*
Ga0068852_10260993123300005616Corn RhizosphereLEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ*
Ga0068859_10034027633300005617Switchgrass RhizosphereGFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITRLLQVLTSLELP*
Ga0066905_10232009313300005713Tropical Forest SoilINLEVGFKLTIEAELASFVPGMTRADAHNVRGTFRDMPEVTKLLQVLTSIQ*
Ga0066903_10372070813300005764Tropical Forest SoilTIDAERAAFVPGLTRSDAHNVKGTFRDMIEVTKLLQVLTSFELP*
Ga0066696_1071191013300006032SoilKLTIDAERAAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP*
Ga0066652_10064279723300006046SoilVGFKLTLDAERAAYVPGLSRSDAHSVKGTFHDMTEITRLLQVISGLELP*
Ga0097621_10028541113300006237Miscanthus RhizosphereLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP*
Ga0079222_1052763623300006755Agricultural SoilKLTIDAERAAFTPGLTRSDAHDVKGTFPDMPTITRLLQVIANLELP*
Ga0075430_10135156413300006846Populus RhizosphereLDVGFKLTLDAERAAFVPGLTRSDAHNVKGSFKDMVEITKLLQVLTSLEAP*
Ga0075431_10028461333300006847Populus RhizosphereTPIALEVGFKLTIDAERASFIPGLTRSGAHTVKGSFPDMIQIVRLMQVLSSFEAPN*
Ga0075425_10074454023300006854Populus RhizosphereAFVPGLARSDAHNVKGTFHDMIEVTRLLQVLTSLELP*
Ga0075425_10142709713300006854Populus RhizospherePVNLEVGFKLTIDAERAAFVPGLTRSDAHNVKGTFKDMVEVSKLLQVLTSFAAP*
Ga0075425_10208598413300006854Populus RhizosphereVALEVGFKLTIDAERAAFVPGVTRSDAHNVKGTFRDMIEITRLLQVLTSLELP*
Ga0075434_10032885533300006871Populus RhizosphereVTTPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDMVEVTRLLQVLTSLELP*
Ga0075429_10021866823300006880Populus RhizosphereYRMTAPIALDVGFKFTIDAERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP*
Ga0075426_1005767013300006903Populus RhizosphereLEVGFKLTIDAERAAFIPGLTRSDAHNVKGTFPDMIQITKLLQVLTSLQTP*
Ga0097620_10115320713300006931Switchgrass RhizosphereALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP*
Ga0074063_1304694213300006953SoilFTLDAERAAFVPGLARSDAHNVRGSFRDMVEITKLLQVLTSLEAP*
Ga0075419_1114105013300006969Populus RhizosphereAERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP*
Ga0075435_10167011213300007076Populus RhizosphereRIRSPIDLEVGFKLTLDAERASYVPGLVRSDAHSVKGTFPDMIQITKLLQVIANLERP*
Ga0099791_1010084923300007255Vadose Zone SoilVPGLARSDAHNVKGTFKDMTEITKLLQVLTSLDVP*
Ga0066710_10286334123300009012Grasslands SoilAAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP
Ga0105240_1122538123300009093Corn RhizosphereLTIDAERAAFVPGLARLDAHSVKGTFTDMVQVTRLLQVLTSLELP*
Ga0105245_1202877223300009098Miscanthus RhizosphereALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITRLLQVLTSLELP*
Ga0114129_1047036623300009147Populus RhizosphereVGFKLTIDAERAAFVPGLARSDAHNVKGSFKDMVEITKLLQVLTSLEAP*
Ga0111538_1031887713300009156Populus RhizospherePGLTHSDAHNVTGSFKDMIEITKLLQVLTSLEAP*
Ga0111538_1326460523300009156Populus RhizosphereDAERAAFVPGLSRADAHNVRGSFKDMVEITKLLQVLTSLDVP*
Ga0105242_1304191123300009176Miscanthus RhizospherePGLARSDAHNVKGTFKDMTEITKLLQVLTSLDLP*
Ga0105248_1100911523300009177Switchgrass RhizosphereEVGFKLTIDAERAAFVPGLSRSDAHSVKGAFKDMIEITKLLQVVSSLEAP*
Ga0105248_1250995723300009177Switchgrass RhizosphereTIDAERAAFVPGLTRADAHNVRGSFRDMVEITKLLQVLTSLEAP*
Ga0134071_1078425923300010336Grasslands SoilTIDAERASFIPGLSRPDAHTVKGSFHDMVEITKLLQVLTSLEAP*
Ga0126377_1301837513300010362Tropical Forest SoilEVGFKLTIDAERAAFVPGLSRSDAHDVKGSFRDMVEITKLLQVLTSLETP*
Ga0105239_1037815833300010375Corn RhizosphereGFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP*
Ga0105239_1136309823300010375Corn RhizosphereERAAFVPGLARSDAHSVKGTFHDMVEVTRLLQVLTSLELP*
Ga0136847_1155458323300010391Freshwater SedimentDAERAAFVPGLTRSDAHVVKGSFKDMVEITKLLQVLTSLEAP*
Ga0134122_1005905123300010400Terrestrial SoilVPGVTRSDAHNVKGTFRDMIEITKLLQVLTSLELP*
Ga0134122_1273069723300010400Terrestrial SoilGFKLTVDAERASFVPGLSRPDAHSVKGSFKDMVEITKLLQVLTSLEAP*
Ga0134121_1016733013300010401Terrestrial SoilGAVLPGLARSDAHSVKGTFRGMVEGTELLQILTSLELP*
Ga0134121_1311717713300010401Terrestrial SoilERAAFVPGLARSDAHNVKGTFKDMTEITKLLQVLTSLDLP*
Ga0134123_1113299213300010403Terrestrial SoilGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP*
Ga0134123_1307064213300010403Terrestrial SoilKLTIDAERAAFVPGLSRSDAHNVKGTFTDMVEITKLLQVVSSLEAP*
Ga0137389_1061213113300012096Vadose Zone SoilGFKLTIYAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP*
Ga0137399_1057720923300012203Vadose Zone SoilAPIDLEVGFKLTIDAERASFIPGLSRPDAHTVKGSFRDMVEITKLLQVLTSLDTP*
Ga0137374_1022705033300012204Vadose Zone SoilYRVTTPIDLEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFRDMIEITKLLQVLTSLEMP*
Ga0137379_1107810213300012209Vadose Zone SoilAYRITAPIALEVGFKLTIDAERAAYVPGLERADAHNVKGSFRDLVEISKLLQLLIAD*
Ga0137397_1124917723300012685Vadose Zone SoilTIDAERASFVPGLSRPDAHSVKGSFKDMVEITKLLQVLTSLEAP*
Ga0157299_1011426223300012899SoilLIGLSWRARRAERAAFVPGLSRADAHNVRGSFKDMVEITKLLQVLTSLDVP*
Ga0137394_1065384833300012922Vadose Zone SoilAERASFVPGLSRPDAHSVKGSFHDMVEITKLLQVLTSLDTP*
Ga0137404_1127229823300012929Vadose Zone SoilALEVGFKLTLDAERAAFVPGLTRSDAHNVKGTFHDMTDITKLLQVLTSLELP*
Ga0157372_1121677423300013307Corn RhizosphereLTIDAERAAFVPGLSRLDAHDVKGTFGDMLQVTKLLQVLTSLELP*
Ga0134078_1030380923300014157Grasslands SoilELEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP*
Ga0173483_1075672023300015077SoilFVPGLVRSDAHNVKGSFKDMIGITKLLQVLTSLEAP*
Ga0167651_105220523300015190Glacier Forefield SoilKLTIDAERAAFVPGLTRSDAHNVKGTFADMVQITRLLQVLTSLELP*
Ga0182036_1020765623300016270SoilFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP
Ga0134074_104744913300017657Grasslands SoilIELEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP
Ga0184618_1006972913300018071Groundwater SedimentVGFKLTLDAERAAFVPGLARSDAHSVTGTFPDMIQITKLLQVVTSLQTP
Ga0184628_1030789313300018083Groundwater SedimentAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP
Ga0222622_1015043413300022756Groundwater SedimentQPYRISGAIGLEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMIEISKLLQVLSSLEA
Ga0207697_1007231423300025315Corn, Switchgrass And Miscanthus RhizosphereEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ
Ga0207684_1101004823300025910Corn, Switchgrass And Miscanthus RhizosphereIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFPDLTQITKLLQVVASLELQ
Ga0207646_1031396513300025922Corn, Switchgrass And Miscanthus RhizosphereERAAFIPGLARSDAHNVKGTFRDMTEVTKLLQVLTSLELP
Ga0207694_1160951613300025924Corn RhizosphereFVPGLARSDAHNVKGTFHDMVEVTRLLQVLTSLELP
Ga0207687_1020083123300025927Miscanthus RhizosphereIDLEVGFKLTLDAERAAFVPGLARSDAHSVKGTFHDMAEITRLLQVIGGLELP
Ga0207687_1147905523300025927Miscanthus RhizosphereVTAPVALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ
Ga0207706_1136186113300025933Corn RhizosphereRVRMPIDLEVGFKLTLDAERAAYVPGLTRSDAHSVKGTFHDMTEITRLLQVVGGLELP
Ga0207706_1166736423300025933Corn RhizosphereVPGLTRSDAHNVRGSFKDMVEITKLLQVLTSLEAP
Ga0207691_1025755933300025940Miscanthus RhizosphereGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP
Ga0207711_1014233733300025941Switchgrass RhizosphereAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP
Ga0207677_1226654213300026023Miscanthus RhizosphereRVTAPVALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ
Ga0207648_1043951533300026089Miscanthus RhizosphereVPGLSRSGAHGVKGTFRDMTEITKLLQVLTSLELP
Ga0207675_10267088933300026118Switchgrass RhizosphereYRVRTPIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFKELTEIMKLLQVVSSLEAP
Ga0207698_1135127523300026142Corn RhizosphereVALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ
Ga0209153_112265723300026312SoilVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDLIEITKLLQVLTSLELP
Ga0209382_1180349523300027909Populus RhizosphereRAAFVPGLTRSDAHNVKGSFKDMVEITKLLQVLTSLEAP
Ga0209526_1052377433300028047Forest SoilAAERAAFVPGLARSDAHNVKGTFTDMTQITKLLQVVASLELP
Ga0268265_1086270423300028380Switchgrass RhizosphereLTGPVGLEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDVIEISKLLQVVSSLEAP
Ga0137415_1004028533300028536Vadose Zone SoilAPIDLEVGFKLTIDAERASFIPGLSRPDAHTVKGSFRDMVEITKLLQVLTSLDTP
Ga0307282_1022189423300028784SoilTIDAERAAFVPGLVRSDAHNVKGSFKDMVEITKLLQVLTSLEAP
Ga0307305_1004819713300028807SoilLEVGFKLTLDAERAAFVPGLARSDAHSVTGTFPDMIQITKLLQVVTSLQTP
Ga0307296_1048873713300028819SoilERAAFVPGLSRSDAHNVKGTFKDMIEITKLLQVVSSLEAP
Ga0307312_1097037823300028828SoilAFVPGLVRSDAHNVKGSFKDMVEITKLLQVLTSLEAP
Ga0308309_1154339013300028906SoilRLYRIAAPVQLDLGFKLTIDAERAAYVPGLTRVDAHNVRGTFPDVISIGKLIEVLVSLEA
Ga0318534_1037559613300031544SoilRLTPPIALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP
Ga0318538_1065681523300031546SoilGFKLTIDAERASFVPGLSRSDAHSVKGTFADMVQITKLLQVIANLEAP
Ga0310886_1030839013300031562SoilIALDVGFKLTIDAERAAYVPGLTRGDAHHVQGSFKTMVEITKLLQVLTSLEAP
Ga0318555_1065759523300031640SoilIDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP
Ga0310813_1198663813300031716SoilGFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITKLLQVLTSFELP
Ga0307469_1171370023300031720Hardwood Forest SoilQPYRVQTPVALDVGFKLTIDAERAAFIPGLARSDAHNVKGTFKDMPEITKLLQVLTSLEL
Ga0310892_1051434813300031858SoilPIALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP
Ga0306925_1225430123300031890SoilPIALEVGFKLTLDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP
Ga0307407_1018826423300031903RhizosphereLEVGFKLTLDAERASYIPGLKRVDAHAVAGTFPDMTACSRLLQVLSSLAPI
Ga0214473_1138033913300031949SoilLDAERAAFVPGLSRVDAHTVKGTFADMVPITKLLQVVTSLEQP
Ga0306926_1007529113300031954SoilKRAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP
Ga0310903_1032289623300032000SoilFKLTIEAEIAAYLPGMSRSDAHNVKGTFHDMPEVTKLLQVLTSIQ
Ga0310902_1113386723300032012SoilERAAFVPGLTRVDAHNVKGTFRDMPEVTRLLQVLTSFAAP
Ga0310906_1099213613300032013SoilALDVGFKFTIDAERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP
Ga0315281_1210025223300032163SedimentVLEVGFKLTLDAERAAFVPGLTRADAHNVKGTFRDMTDITKLLQVLTSLELP
Ga0310889_1076339913300032179SoilIDAERAAFVPGLSRSDAHNVKGTFKDMVEISKLLQVVSSLEAP
Ga0310889_1078461723300032179SoilIALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP
Ga0307471_10040490713300032180Hardwood Forest SoilVGFKLTLDAERAAFVPGLVRSDAHSVKGTFPDMIQITKLLQVIASLERP
Ga0310896_1060768813300032211SoilTIDAERAAFVPGLARSDAHNVKGSFKDMVEITRLLQVLTSLEAP
Ga0335082_1147755923300032782SoilDLEVGFKLTLDAERASFVPGLTRADAHNVKGTFPDMTTITRLLQVVANLEMP
Ga0335070_1069826513300032829SoilPYTVRTPIDLEVGFKLTIDAERASFTPGLTRSDAHNVKGQFTDMVQITKLLQVIGNLEMP
Ga0335084_1063632413300033004SoilPYRIATPVQLDLGFKLTIDAERAAYVPGLTRTDAHNVRGTFPDLISIQKLILVLASLEAP
Ga0335084_1147737623300033004SoilYRLTTPIALEVGFKLTIDAERAAFVPGLSRVDAHMVKGTFRDMPEITKLLQVLTSFAAP
Ga0364930_0190489_8_1573300033814SedimentVGFKLTIDAERAAYIPGLTRVDAHTVRGTFPDLVTIVKLLHVLTSLEQP
Ga0373958_0154126_411_5753300034819Rhizosphere SoilPIALDVGFKLTIDAERAAFVPGLTRADAHNVKGSFKDMVEITKLLQVLTSLEAP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.