NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063783

Metagenome / Metatranscriptome Family F063783

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063783
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence MTWADFYLICFAVGFLFSLLSFLAGGLRWHLHLPHFS
Number of Associated Samples 115
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 88.37 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.225 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(7.752 % of family members)
Environment Ontology (ENVO) Unclassified
(23.256 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.512 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.62%    β-sheet: 0.00%    Coil/Unstructured: 55.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01381HTH_3 4.65
PF06739SBBP 4.65
PF00528BPD_transp_1 2.33
PF12911OppC_N 1.55
PF02746MR_MLE_N 0.78
PF00873ACR_tran 0.78
PF06475Glycolipid_bind 0.78
PF00534Glycos_transf_1 0.78
PF03781FGE-sulfatase 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.55
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.78
COG3554Uncharacterized conserved proteinFunction unknown [S] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.22 %
UnclassifiedrootN/A0.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004082|Ga0062384_101270146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae538Open in IMG/M
3300004603|Ga0068918_1256261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae624Open in IMG/M
3300004635|Ga0062388_100273904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1390Open in IMG/M
3300005180|Ga0066685_11009198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae549Open in IMG/M
3300005329|Ga0070683_100883633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae857Open in IMG/M
3300005330|Ga0070690_100187500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1432Open in IMG/M
3300005434|Ga0070709_10417433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1005Open in IMG/M
3300005436|Ga0070713_102340884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae517Open in IMG/M
3300005437|Ga0070710_10019499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3505Open in IMG/M
3300005542|Ga0070732_10666527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae633Open in IMG/M
3300005554|Ga0066661_10592135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae659Open in IMG/M
3300005598|Ga0066706_10898364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae690Open in IMG/M
3300005921|Ga0070766_10464479All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300006031|Ga0066651_10726871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae535Open in IMG/M
3300006102|Ga0075015_100024827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui2688Open in IMG/M
3300006237|Ga0097621_101410706All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300006354|Ga0075021_10031250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui3025Open in IMG/M
3300006800|Ga0066660_11229521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae587Open in IMG/M
3300009093|Ga0105240_12541581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300009549|Ga0116137_1052994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1310Open in IMG/M
3300010043|Ga0126380_10695465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300010046|Ga0126384_11110257All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300010048|Ga0126373_10268689All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300010048|Ga0126373_10915206All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300010048|Ga0126373_11116988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300010154|Ga0127503_11320656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300010341|Ga0074045_10512015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae771Open in IMG/M
3300010361|Ga0126378_11219798All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300010362|Ga0126377_12608165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300010373|Ga0134128_11760306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300010376|Ga0126381_104575540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300010397|Ga0134124_13168477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300011064|Ga0138525_1056377All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300012203|Ga0137399_10099210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2250Open in IMG/M
3300012207|Ga0137381_10613925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300012209|Ga0137379_10667919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium945Open in IMG/M
3300012211|Ga0137377_10674706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300012211|Ga0137377_11438745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300012923|Ga0137359_10044042All Organisms → cellular organisms → Bacteria3870Open in IMG/M
3300012929|Ga0137404_12237992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012944|Ga0137410_11749322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300012958|Ga0164299_10826151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300012960|Ga0164301_10994722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300012980|Ga0168315_105606All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300012984|Ga0164309_11301298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300012986|Ga0164304_11082692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300014169|Ga0181531_10509508All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300014199|Ga0181535_10581281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300014201|Ga0181537_11172409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300014498|Ga0182019_10963777All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300014638|Ga0181536_10194044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300014638|Ga0181536_10324956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300014969|Ga0157376_11585046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300015264|Ga0137403_10381608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui1292Open in IMG/M
3300015373|Ga0132257_100031611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5740Open in IMG/M
3300015373|Ga0132257_104477885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300016702|Ga0181511_1004195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300016705|Ga0181507_1248837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300018006|Ga0187804_10382684All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300018022|Ga0187864_10408346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300018022|Ga0187864_10417399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300018022|Ga0187864_10431250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300018026|Ga0187857_10122639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1250Open in IMG/M
3300018030|Ga0187869_10576335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300018037|Ga0187883_10166062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1134Open in IMG/M
3300018037|Ga0187883_10227067Not Available956Open in IMG/M
3300018040|Ga0187862_10064274All Organisms → cellular organisms → Bacteria2624Open in IMG/M
3300018086|Ga0187769_10943554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300018086|Ga0187769_10990383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae636Open in IMG/M
3300018088|Ga0187771_10081328All Organisms → cellular organisms → Bacteria2580Open in IMG/M
3300018431|Ga0066655_10654406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300019890|Ga0193728_1245312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300020070|Ga0206356_11778801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300020580|Ga0210403_11507417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300020581|Ga0210399_10038322All Organisms → cellular organisms → Bacteria3836Open in IMG/M
3300020583|Ga0210401_10482677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1102Open in IMG/M
3300021168|Ga0210406_10923528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300021406|Ga0210386_10780691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300021475|Ga0210392_10213356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1353Open in IMG/M
3300021559|Ga0210409_10745833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium851Open in IMG/M
3300021860|Ga0213851_1235603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300022524|Ga0224534_1067816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300022726|Ga0242654_10306454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300022756|Ga0222622_11415621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300023090|Ga0224558_1247246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia513Open in IMG/M
3300025414|Ga0208935_1053630All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300025453|Ga0208455_1095631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300025527|Ga0208714_1008220All Organisms → cellular organisms → Bacteria2763Open in IMG/M
3300025898|Ga0207692_10180008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1231Open in IMG/M
3300025903|Ga0207680_10016987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3835Open in IMG/M
3300025912|Ga0207707_10974320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300025928|Ga0207700_10646856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium942Open in IMG/M
3300025938|Ga0207704_11409062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300026095|Ga0207676_10133091All Organisms → cellular organisms → Bacteria → Acidobacteria2117Open in IMG/M
3300026291|Ga0209890_10192398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300026322|Ga0209687_1222420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300027521|Ga0209524_1074677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300027548|Ga0209523_1005371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2176Open in IMG/M
3300027562|Ga0209735_1104017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027568|Ga0208042_1190076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300027696|Ga0208696_1010158All Organisms → cellular organisms → Bacteria3884Open in IMG/M
3300027829|Ga0209773_10135844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1022Open in IMG/M
3300027842|Ga0209580_10158623All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300027842|Ga0209580_10672016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300027875|Ga0209283_10249118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1178Open in IMG/M
3300027889|Ga0209380_10330176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300027894|Ga0209068_10983078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300027905|Ga0209415_10131783All Organisms → cellular organisms → Bacteria2591Open in IMG/M
3300027910|Ga0209583_10088024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1174Open in IMG/M
3300027911|Ga0209698_10258691All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300027911|Ga0209698_11298657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300028380|Ga0268265_11916950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300028765|Ga0302198_10308269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300029907|Ga0311329_10872953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300030503|Ga0311370_11080675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300031231|Ga0170824_108378786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1014Open in IMG/M
3300031708|Ga0310686_114975904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300031720|Ga0307469_11791791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031740|Ga0307468_100932493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300031795|Ga0318557_10332920All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300031823|Ga0307478_10478961All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300032001|Ga0306922_12192378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300032180|Ga0307471_102106725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300032180|Ga0307471_102600767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300032180|Ga0307471_104018152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300032205|Ga0307472_100148369All Organisms → cellular organisms → Bacteria → Acidobacteria1708Open in IMG/M
3300032205|Ga0307472_102329375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300033475|Ga0310811_10523971All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300034124|Ga0370483_0137530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.55%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.78%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.78%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.78%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.78%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004603Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011064Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012980Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062384_10127014613300004082Bog Forest SoilMTWSDFYLTCFAVGFLLSAISFLVGGLHGHFHLPHFPDFGGHVDA
Ga0068918_125626123300004603Peatlands SoilMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHFPGGG
Ga0062388_10027390413300004635Bog Forest SoilMTVNMATMTTANMTWADFYLICFAVGFLLSAISFIAGGLRWHLHL
Ga0066685_1100919823300005180SoilMTWADFYLVCFVLGFVFSLLSFVLGGLHWHLPFHAHLPHVGGGSVHV
Ga0070683_10088363333300005329Corn RhizosphereMTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGAHGH
Ga0070690_10018750013300005330Switchgrass RhizosphereMTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGAHG
Ga0070709_1041743323300005434Corn, Switchgrass And Miscanthus RhizosphereMTWADFYLVCFVVGLFLSVVMFLAGGLHLPHFHIQLPGLNG
Ga0070713_10234088413300005436Corn, Switchgrass And Miscanthus RhizosphereMNWADFYLICFAVGFSFSLLSFLAGGLRWHPHLPHFSHPHVH
Ga0070710_1001949953300005437Corn, Switchgrass And Miscanthus RhizosphereMNWADFYLICFAIGFSFSLVSFLAGGLRWHLHMPHFPHAPAVHHASAPSN
Ga0070732_1066652723300005542Surface SoilMTWANFYLICFAVGLAFSLLSFFAGGARWHLHLPHLPHAVHGP
Ga0066661_1059213523300005554SoilMTLADFYLVCFVVGFFLSLLMFLAGGLHLHIPHFHGHALPVHIHA
Ga0066706_1089836423300005598SoilMTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHA
Ga0070766_1046447933300005921SoilMTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFSHVHTAPPHAS
Ga0066651_1072687113300006031SoilMTWADFYLVCFVVGFFLSLLMFLAGGMHLQIPHFHGHALPVH
Ga0075015_10002482753300006102WatershedsMTWADFYLVCFVIGFCFSLLSFLTGGLRWHLHMPHLPHGAAGGHI
Ga0097621_10141070613300006237Miscanthus RhizosphereMTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHF
Ga0075021_1003125013300006354WatershedsMTWADFYLICFAVGFSFSLLSFLAGGLRWHLHVPRFSHVHVPP
Ga0066660_1122952123300006800SoilMTWADFYLVCFVVGFFLSVLMFLAGGVHLHIPHFHG
Ga0105240_1254158123300009093Corn RhizosphereMMTWANFYLLCFALGFAFSLISFIGGGMRWHLHLPHL
Ga0116137_105299413300009549PeatlandMTSNVTWSDFYLACFAVGFLLSAVSFIAGGLRWHAHLPHLPHGGG
Ga0126380_1069546523300010043Tropical Forest SoilMTWADFYLVCFVVGFFLSVLLFLAGGVHFHIPHFHIHVHG
Ga0126384_1111025713300010046Tropical Forest SoilMTWADFYLICFAVGFLFSFLSFFLGGIHWHLPFDV
Ga0126373_1026868933300010048Tropical Forest SoilMTWADFYLVCFVVGFFLSVLMFLSGGLRLHVPHVHVHLPGFH
Ga0126373_1091520633300010048Tropical Forest SoilMTWADFYLVCFVVGFFLSVIIFVTGGLRLHFPHLPHFH
Ga0126373_1111698823300010048Tropical Forest SoilMTWADFYLICFAVGFAFSLMSFLGGGTRWRLHLPHS
Ga0127503_1132065613300010154SoilMTWADFYLICFAVGFLFSLLSFLAGGLRWHLHLPHFS
Ga0074045_1051201523300010341Bog Forest SoilMTSWADFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDGGHFG
Ga0126378_1121979823300010361Tropical Forest SoilMTWADFYLVCFVVGFFLSLLMFLGGGARLHLPHFHLHLPGLSGHGTAPHAV
Ga0126377_1260816513300010362Tropical Forest SoilMTWADFYLICFAVGFTFSVLSFFFGGHRWHLPFHFH
Ga0134128_1176030623300010373Terrestrial SoilMTWADFYLICFVVGFFLSLVMFLAGGAQLPHVHIHLPGMHG
Ga0126381_10457554013300010376Tropical Forest SoilMTWSDFYLICFAAGFLFSLLSFIFGGLHFHGHSLHVHDLHF
Ga0134124_1316847713300010397Terrestrial SoilMTWADFYLVCFVVGLFLSVLMFLAGGTHLHIPHFHGHALPAHIHG
Ga0138525_105637713300011064Peatlands SoilMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHFPGGGGHVGA
Ga0137399_1009921053300012203Vadose Zone SoilMNWADFYLICFAVGFSFSLLSFLAGGLRWQLHLPHFSHVHV
Ga0137381_1061392533300012207Vadose Zone SoilMTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHALPVHIHA
Ga0137379_1066791923300012209Vadose Zone SoilMTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHGHALPV
Ga0137377_1067470623300012211Vadose Zone SoilMTWADFYLVCFVVGFFLSVLMFLAGGTHLHIPHFHGHALPVHIHGA
Ga0137377_1143874513300012211Vadose Zone SoilMTLADFYLVCFVVGFFLSLLMFLAGGMHLHIPHFHG
Ga0137359_1004404213300012923Vadose Zone SoilMTVNMTWSDFYLTCFAIGFLLSAISFMAGGMRWQLHLPHFPHAA
Ga0137404_1223799223300012929Vadose Zone SoilMTWADFYLVCFALGFAFSLLSFLLGGLRWHLPLHTHLHP
Ga0137410_1174932213300012944Vadose Zone SoilMTWADFYLVCFALGFAFSLLSFLLGGLRWHLPLHTHLHPG
Ga0164299_1082615123300012958SoilMTWADFYLVCFVVGFFLSVVIFVTGGLRLHFPHAHFHWPG
Ga0164301_1099472213300012960SoilVTWADFYLVCFIAGFFLSVLMFLAGGVHFHLPHFHINLPGLHGQ
Ga0168315_10560633300012980Weathered Mine TailingsMTWADFYLVCFVIGFCFSLLSFLTGGLRWHLHMPHLPHGTA
Ga0164309_1130129813300012984SoilMTWADFYLVCFAVGFLLSLLSFLAGGLHWHPHVPHFSHGHLAMPHP
Ga0164304_1108269223300012986SoilMTWADFYLVCFVVGLFLSVLMFLAGGTHLHIPHFHGHALPAHIH
Ga0181531_1050950823300014169BogMTWADFYLTCFAVGFLLSAVSFIAGGMRWHLHLPHF
Ga0181535_1058128123300014199BogMTWADFYLTCFAVGFLLSAVSFIAGGMRWHVHLPHVPHGGGHIGGG
Ga0181537_1117240913300014201BogMTWADFYLICFVVGFLLSAVSFLLGGLHGHLHLPHSLNAGGHAPL
Ga0182019_1096377723300014498FenMTWENFYLLCFSVGFFLSLISFLAGGLHAVHLPHFPHVHI
Ga0181536_1019404433300014638BogMTGNMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHFPHSGA
Ga0181536_1032495623300014638BogMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHF
Ga0157376_1158504623300014969Miscanthus RhizosphereMTWADFYLVCFVVGFFLSVVIFVTGGLRLHFPHAHFHW
Ga0137403_1038160833300015264Vadose Zone SoilMTGADFYLICFAVGFSFSLLSFLAGGLRWHLHLPHFSHGHVIPHPP
Ga0132257_10003161113300015373Arabidopsis RhizosphereMTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFP
Ga0132257_10447788523300015373Arabidopsis RhizosphereMTWADFYLVCFAAGFLFSVLSFVLGGFHWHLPFHIHL
Ga0181511_100419513300016702PeatlandMTWADFYLTCFAVGFLLSAISFVVGGLHGHLHLPHFP
Ga0181507_124883713300016705PeatlandMTWADFYLTCFAVGFLLSAVSFIAGGMRWHVHLPHVPHGGGH
Ga0187804_1038268423300018006Freshwater SedimentMTWADFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDG
Ga0187864_1040834613300018022PeatlandMTGNMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLHLPHFPHS
Ga0187864_1041739923300018022PeatlandMTGSMTWNMTWADFYLICFAVGFLLSAISFIAGGLRWHLH
Ga0187864_1043125023300018022PeatlandMIATTTWNMTWADFYLACFAVGFLLSAISFIAGGLRWHLHLPHF
Ga0187857_1012263913300018026PeatlandMTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHLPHAG
Ga0187869_1057633513300018030PeatlandMTWADFYLICFAIGFLLSAISFIAGGLHWHVHLPHFP
Ga0187883_1016606233300018037PeatlandMTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHL
Ga0187883_1022706723300018037PeatlandMTWADFYLICFAIGFLLSAISFIAGGLHWHVHLPHFPGVH
Ga0187862_1006427433300018040PeatlandMTVNMTWADFYLICFAVGFLLSAISFIGGGLRWHLHLPHFPHSG
Ga0187769_1094355423300018086Tropical PeatlandMTWSDFYLTCFAVGFLLSAISFIAGGLRWHLHLPH
Ga0187769_1099038313300018086Tropical PeatlandMTWADFYLTCFAVGFLLSAVSFIAGGLHWHLHLPHFPHGGGQVTAGHV
Ga0187771_1008132813300018088Tropical PeatlandMTWATFYLTCFALGFLFSLVSFLLGGLRLHLPHLG
Ga0066655_1065440613300018431Grasslands SoilMTLADFYLVCFVVGFLSLLMFLAGGMHLHIPHFHG
Ga0193728_124531213300019890SoilMNWADFYLICFAVGFSFSLLSFLAGGLRWHPHLPHFSHVHVA
Ga0206356_1177880123300020070Corn, Switchgrass And Miscanthus RhizosphereMTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHF
Ga0210403_1150741713300020580SoilVTWADFYLVCFVVGFAFSVLAVFSGGMRWHIPHLPHGHGP
Ga0210399_1003832233300020581SoilMTWSDFYLICFAVGFLLSAVSFVVGGLHGHLHLPHFPDAGGHVD
Ga0210401_1048267713300020583SoilMTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFS
Ga0210406_1092352813300021168SoilMTWADFYLTCFAVGFLLSAISFIAGGMRWQLHLPHF
Ga0210386_1078069123300021406SoilMTWADFYLICFAVGFAFSLISFVSGGTRWRLHLPHL
Ga0210392_1021335613300021475SoilMTWATFYLVCFAVGLAFSLLSFFTAGVRWHLHLPHLP
Ga0210409_1074583323300021559SoilMTWADFYLTCFAVGFAFSLISFVGGGSRWHFHLHLPHGAG
Ga0213851_123560313300021860WatershedsMTWADFYLICFVVGFLLSAVSFLLGGLHGHLHLPHFP
Ga0224534_106781623300022524SoilMTGTMTGNMTGNIAWADFYLTCFAVGFLLSAISFLAGGLRWHLH
Ga0242654_1030645413300022726SoilVTWANFYLVCFAVGFAFSVISFLGGGTRWRFHLPHLPHGA
Ga0222622_1141562113300022756Groundwater SedimentMTWADFYLVCFALGFVFSLLSFLLGGMEWHLPFHAHLPHFG
Ga0224558_124724623300023090SoilVTWSDFYLTCFAVGFLLSAVLFIAGGMHWHLHLHLPDLPHLGGDVGGHVLTGDA
Ga0208935_105363023300025414PeatlandMTWSDFYLACFAIGFLLSAVSFIAGGMHWHLPHFPDG
Ga0208455_109563123300025453PeatlandMTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHLHLPHLPHAGGH
Ga0208714_100822013300025527Arctic Peat SoilMTWNMTWSDFYLTCFAVGFLLSAISFIAGGMRWQLHLPH
Ga0207692_1018000833300025898Corn, Switchgrass And Miscanthus RhizosphereMNWADFYLICFAIGFSFSLVSFLAGGLRWHLHMPHFPHAPAVHHASAPSNV
Ga0207680_1001698763300025903Switchgrass RhizosphereMTWADFYLICFAGGFFFSLLSFLAGGMRWHLHLPHFSH
Ga0207707_1097432023300025912Corn RhizosphereMTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLPHIHIHFPGSHGH
Ga0207700_1064685633300025928Corn, Switchgrass And Miscanthus RhizosphereMTWANFYLVCFAVGFAFSVLAFLGGGTRWHLHVPHFHG
Ga0207704_1140906223300025938Miscanthus RhizosphereMTWADFYLICFAGGFFFSLLSFLAGGMRWHLHLPHFS
Ga0207676_1013309133300026095Switchgrass RhizosphereMTWAHFYLVCFAVGFFLSVLMFLAGGLNLHLRHIHIHFPGAQGHVS
Ga0209890_1019239813300026291SoilMTWADFYLICFVLGIAFSLVSLLGGGSRWHLHLPHFAHAH
Ga0209687_122242023300026322SoilMTWADFYLVCFVVGFAFSLLSFLSGGLRWHLHIPRIFHGGH
Ga0209524_107467723300027521Forest SoilMTWADFYLVCFAVGFFFSLLSFLAGGLRWHLHLPHFSHVHT
Ga0209523_100537143300027548Forest SoilVTWANFYLVCFAVGFAFSAISFLGGGSRWRFHLPHL
Ga0209735_110401713300027562Forest SoilMTWSDFYLTCFAVGFLLSAISFIAGGMRWQLHLPHFPH
Ga0208042_119007613300027568Peatlands SoilVTWSDFYLTCFAVGFLLSAVLFIAGGLHWHLHLPDLPHLGGDVG
Ga0208696_101015813300027696Peatlands SoilVTWSDFYLTCFAVGFLLSAVLFIAGGLHWHLHLPDLPHLGGD
Ga0209773_1013584433300027829Bog Forest SoilMTWHMTWADFYLTCFAVGFLLSAISFIAGGLRWHLH
Ga0209580_1015862333300027842Surface SoilMTWADFYLICFAVGFAFSLISFLGGGTRWRLHLPH
Ga0209580_1067201613300027842Surface SoilVTWANFYLVCFAVGFAFSVISFLGGGTRWRFHLPHLP
Ga0209283_1024911833300027875Vadose Zone SoilMNWADFYLICFAVGFSFSLLSFLAGGLRWQLHLPH
Ga0209380_1033017623300027889SoilMTATMTANMTVMTNANMSWSDFYLICFAVGFLLSAISFIAGGLRWHLHLPH
Ga0209068_1098307823300027894WatershedsMTWADFYLVCFAVGFLFSLLAFLAGGLRWHAHLPHFSHVH
Ga0209415_1013178313300027905Peatlands SoilMIGNMIATTTWNMTWADFYLTCFAVGFLLSAISFIAGGLRWHVHLPHFP
Ga0209583_1008802423300027910WatershedsMTWADFYLICFAVGFSFSLLSFLAGGLRWHLHVPRFSHVHVP
Ga0209698_1025869113300027911WatershedsMTWSDFYLICFAVGFLLSAISFIAGGLRWHVHLPHF
Ga0209698_1129865723300027911WatershedsMTWADFYLTCFAVGFLLSAVSFLVGGLHWHLHMHLPDLPHFGGDV
Ga0268265_1191695013300028380Switchgrass RhizosphereMTWADFYLVCFAAGFLFSVLSFVLGGFHWHLPFHIHLPASADPH
Ga0302198_1030826923300028765BogMTWADFYLTCFAVGFLLSAVSFIAGGMRWHIHLPHFPHAG
Ga0311329_1087295323300029907BogMTWADFYLTCFAVGFLLSAVSFIAGGMRWHLHLPHLPHAGGHGFGSHT
Ga0311370_1108067523300030503PalsaMTWADFYLICFAVGFLLSAISAILGGLHWHVHLPHLP
Ga0170824_10837878613300031231Forest SoilMTWADFYLICFGVGFLLSAVSFIAGGFRWHLHLPH
Ga0310686_11497590413300031708SoilMTWNMTWADFYLTCFAVGFLLSAISFIVGGIHGRLHLPHFPDFGGHDFG
Ga0307469_1179179113300031720Hardwood Forest SoilMTWADFYLVCFVVGFFLSALMFLGGGLHLHIPHFHLHAPTHVHFAGHTP
Ga0307468_10093249313300031740Hardwood Forest SoilMTWADFYLICFAVGFLFSLLSFLAGGLRWHVHLPH
Ga0318557_1033292013300031795SoilVTWADFYLVCFVVGFAFSVLAVFSGGMRWHIPHLPHGHGPVG
Ga0307478_1047896113300031823Hardwood Forest SoilMTWADFYLVCFVVGFFLSVLMFLGGGLHLHIPHFHF
Ga0306922_1219237823300032001SoilMSWSDFYLICFAIGFLLSLLSFIMGGLHLPGHWQH
Ga0307471_10210672523300032180Hardwood Forest SoilMTWANFYLICFAVGLAFSLISFFAGGVRWHPHLPHLPHAMHGP
Ga0307471_10260076723300032180Hardwood Forest SoilMTWANFYLICFALGLAFSLLSFFAGGVRWHLHLPHLPHAMH
Ga0307471_10401815223300032180Hardwood Forest SoilMTWADFYLICFGVGFLLSAVSFIAGGFRWHLHLPHFPH
Ga0307472_10014836913300032205Hardwood Forest SoilMTWTDFYLVCFALGFAFSLLSFLLGGLHWHMPFHAHLPHVGGPSLH
Ga0307472_10232937513300032205Hardwood Forest SoilMTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFPGAHG
Ga0310811_1052397113300033475SoilMTWADFYLVCFAAGFLFSVLSFVLGAHWHLPFHLHFPG
Ga0370483_0137530_2_1213300034124Untreated Peat SoilMTWSDFYLICFAVGFLLSAISFVTGGLRWHLHLPHFPHGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.