NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063548

Metagenome Family F063548

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063548
Family Type Metagenome
Number of Sequences 129
Average Sequence Length 46 residues
Representative Sequence MSRRLRQAAVVFIVVFAAAQLVRPQRTNPATDVSRTIQAHVGTA
Number of Associated Samples 111
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.66 %
% of genes near scaffold ends (potentially truncated) 94.57 %
% of genes from short scaffolds (< 2000 bps) 94.57 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.698 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(6.977 % of family members)
Environment Ontology (ENVO) Unclassified
(31.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.310 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 31.94%    β-sheet: 0.00%    Coil/Unstructured: 68.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF02954HTH_8 2.33
PF12674Zn_ribbon_2 2.33
PF05787DUF839 2.33
PF13380CoA_binding_2 1.55
PF07883Cupin_2 1.55
PF00072Response_reg 0.78
PF13941MutL 0.78
PF02627CMD 0.78
PF00873ACR_tran 0.78
PF01292Ni_hydr_CYTB 0.78
PF01979Amidohydro_1 0.78
PF00903Glyoxalase 0.78
PF00578AhpC-TSA 0.78
PF10070DabA 0.78
PF05694SBP56 0.78
PF01022HTH_5 0.78
PF12704MacB_PCD 0.78
PF08241Methyltransf_11 0.78
PF13442Cytochrome_CBB3 0.78
PF02894GFO_IDH_MocA_C 0.78
PF07396Porin_O_P 0.78
PF00561Abhydrolase_1 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG3211Secreted phosphatase, PhoX familyGeneral function prediction only [R] 2.33
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.78
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.78
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.78
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.78
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.78
COG3038Cytochrome b561Energy production and conversion [C] 0.78
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.78
COG3746Phosphate-selective porinInorganic ion transport and metabolism [P] 0.78
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.70 %
UnclassifiedrootN/A9.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12435034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300000789|JGI1027J11758_12444172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300004281|Ga0066397_10145141All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300004480|Ga0062592_100600011Not Available935Open in IMG/M
3300004480|Ga0062592_102310010All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005294|Ga0065705_10591381Not Available712Open in IMG/M
3300005332|Ga0066388_100293521All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300005332|Ga0066388_102013130Not Available1036Open in IMG/M
3300005332|Ga0066388_104673571All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005335|Ga0070666_11273970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300005343|Ga0070687_100608443All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005345|Ga0070692_10567977All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005354|Ga0070675_100419371All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300005434|Ga0070709_10732767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria771Open in IMG/M
3300005446|Ga0066686_10870964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300005456|Ga0070678_101558289All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005459|Ga0068867_100946640All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300005526|Ga0073909_10038906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300005536|Ga0070697_101684801All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005564|Ga0070664_100865141All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300005617|Ga0068859_102943995All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005618|Ga0068864_101142434All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005764|Ga0066903_101213582All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300005764|Ga0066903_104887726All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005764|Ga0066903_107643334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300005764|Ga0066903_108910681All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005836|Ga0074470_10137850All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005844|Ga0068862_101796935All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006791|Ga0066653_10650516All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006797|Ga0066659_10942343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300006845|Ga0075421_101803323All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300006852|Ga0075433_10175178All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300006854|Ga0075425_101789457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300006854|Ga0075425_102750957All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006871|Ga0075434_101774522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300006876|Ga0079217_10187891All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300007004|Ga0079218_12126205All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300009093|Ga0105240_12770370All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009094|Ga0111539_10607068All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300009098|Ga0105245_13168199All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009100|Ga0075418_10179150All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300009100|Ga0075418_10511378All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300009100|Ga0075418_13017312All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009167|Ga0113563_11275464All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium858Open in IMG/M
3300010043|Ga0126380_11107389All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300010047|Ga0126382_11541038All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010358|Ga0126370_10845155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300010360|Ga0126372_11006594Not Available845Open in IMG/M
3300010360|Ga0126372_11226104All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300010366|Ga0126379_12857813All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010375|Ga0105239_11571607Not Available760Open in IMG/M
3300010398|Ga0126383_12918552Not Available558Open in IMG/M
3300010401|Ga0134121_12198197All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300010403|Ga0134123_11992484All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300011444|Ga0137463_1250516All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300012134|Ga0137330_1042947All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012206|Ga0137380_11226616All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012207|Ga0137381_10830256All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300012212|Ga0150985_121617631All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012354|Ga0137366_10026191All Organisms → cellular organisms → Bacteria4535Open in IMG/M
3300012359|Ga0137385_10983683All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300012360|Ga0137375_10598389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium RBG_13_65_8919Open in IMG/M
3300012469|Ga0150984_110649013All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300012503|Ga0157313_1040641All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012672|Ga0137317_1031295All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012931|Ga0153915_10195936All Organisms → cellular organisms → Bacteria2214Open in IMG/M
3300012931|Ga0153915_11680662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300012931|Ga0153915_12364749All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium622Open in IMG/M
3300013297|Ga0157378_10048434All Organisms → cellular organisms → Bacteria3779Open in IMG/M
3300014262|Ga0075301_1048282All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300014318|Ga0075351_1149227All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300014326|Ga0157380_10932191All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300014326|Ga0157380_12370860All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300015372|Ga0132256_103004118Not Available567Open in IMG/M
3300015372|Ga0132256_103790967All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300015373|Ga0132257_103871087All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300015374|Ga0132255_103107665All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300016422|Ga0182039_10814369All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300017966|Ga0187776_10358275All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300018084|Ga0184629_10171889All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300018084|Ga0184629_10487704All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300018089|Ga0187774_10863567All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300018469|Ga0190270_11041513All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300018481|Ga0190271_11780443All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300019361|Ga0173482_10184037All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300019362|Ga0173479_10111125All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300021560|Ga0126371_10777786All Organisms → cellular organisms → Bacteria → Proteobacteria1104Open in IMG/M
3300024290|Ga0247667_1113052All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025906|Ga0207699_11049271Not Available603Open in IMG/M
3300025906|Ga0207699_11442977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300025930|Ga0207701_11042852All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300025935|Ga0207709_11445729Not Available570Open in IMG/M
3300025961|Ga0207712_11743559All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300026067|Ga0207678_10494704All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300026095|Ga0207676_11327262All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300026121|Ga0207683_10835219All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300026316|Ga0209155_1090614All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300026843|Ga0208126_1002616All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300026886|Ga0207982_1006326All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300027614|Ga0209970_1048785All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300027765|Ga0209073_10359463All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300027915|Ga0209069_10249342All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300028381|Ga0268264_11812861All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300028803|Ga0307281_10079420All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300031679|Ga0318561_10393062Not Available761Open in IMG/M
3300031716|Ga0310813_11627816All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031720|Ga0307469_12085140All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031833|Ga0310917_10257701All Organisms → cellular organisms → Bacteria → Proteobacteria1175Open in IMG/M
3300031852|Ga0307410_11528720All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031890|Ga0306925_10161734All Organisms → cellular organisms → Bacteria → Proteobacteria2411Open in IMG/M
3300031896|Ga0318551_10591750All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300031897|Ga0318520_10691369All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300031908|Ga0310900_11101961All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031910|Ga0306923_10586215All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300031911|Ga0307412_11778208All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031912|Ga0306921_10311916All Organisms → cellular organisms → Bacteria → Proteobacteria1841Open in IMG/M
3300031945|Ga0310913_11319054Not Available500Open in IMG/M
3300031954|Ga0306926_11171699All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300031995|Ga0307409_101199146All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300032094|Ga0318540_10535347All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300032179|Ga0310889_10477002All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300032211|Ga0310896_10345066All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300033433|Ga0326726_12163464All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300033480|Ga0316620_12127166All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium558Open in IMG/M
3300033513|Ga0316628_102794840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300033513|Ga0316628_103629511All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300033551|Ga0247830_10740634All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300034151|Ga0364935_0145944All Organisms → cellular organisms → Bacteria747Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.33%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.55%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.78%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026843Soil and rhizosphere microbial communities from Laval, Canada - mgHAA (SPAdes)EnvironmentalOpen in IMG/M
3300026886Soil and rhizosphere microbial communities from Laval, Canada - mgHAB (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1243503413300000789SoilMSRRMKQAAIVFVAVFAAAQFVRPERATPATDVSRTIQ
JGI1027J11758_1244417213300000789SoilMSRRMKQAAIVFVAVFAAAQFVRPERATPATDVSRTXXAQ
Ga0066397_1014514113300004281Tropical Forest SoilMSRRLKQAAVVFVVVFAVAQLVRPEHANPATDPTRTIRAHMGDASGLPAVLDRACG
Ga0062592_10060001113300004480SoilMKRRLRQGALVLVVAFAAAQLVRPQRANPPIDPARTIRAHVSPSSRLPAVLDR
Ga0062592_10231001023300004480SoilVSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAV
Ga0065705_1059138113300005294Switchgrass RhizosphereMSRRLRQAAVVFIVVFAAAQLVRPQRTNPATDVSRTIQAHVGTA
Ga0066388_10029352143300005332Tropical Forest SoilVGRRLLQVAVVVVVLFAAAQLVRPPHSNPPIDASRTIEAHLGAANGLAAVLNRSC
Ga0066388_10201313013300005332Tropical Forest SoilMSRRLKQAAVVFVAVLAAAQLIRPEHVNPPTDATRTIQAHETTKGLA
Ga0066388_10467357123300005332Tropical Forest SoilMNRRLKQGAFVLVVVFAAAQLVRPERANPPTDVSRTIEAHVGTTSGLGAVLNRACSD
Ga0070666_1127397023300005335Switchgrass RhizosphereMSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRTIQAQIGTANGLAAVLD
Ga0070687_10060844323300005343Switchgrass RhizosphereVSRRLKQAAIALVAVFAAAQLVRPERANPPTGAHRTIQAHMPTGSGLVA
Ga0070692_1056797713300005345Corn, Switchgrass And Miscanthus RhizosphereVSRRPKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVG
Ga0070675_10041937113300005354Miscanthus RhizosphereVSRQLKRAAVVFIVVFAAAQLVRPERANPATDERRTIQAHVGTANGLVAVLDRACR
Ga0070709_1073276723300005434Corn, Switchgrass And Miscanthus RhizosphereMGRRLKNAAIILIILFAAAQLVRPSHANPPTDASRAIQAHVSTHGLATILD
Ga0066686_1087096413300005446SoilMRRLKQAAVVFVVVFAAAQFVRPERANPATDPNRTIRAHMGTA
Ga0070678_10155828923300005456Miscanthus RhizosphereMRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVG
Ga0068867_10094664023300005459Miscanthus RhizosphereLKQAAVVFIIVFAAAQFVRPERANPATDVHRTIQAHVETASAR*
Ga0073909_1003890633300005526Surface SoilVRRRLKQAAVIFVVVFAAAQLVRPGRANPATDPSRTIQAHVGTASGLVAVLD
Ga0070697_10168480113300005536Corn, Switchgrass And Miscanthus RhizosphereMSRRLQLAAIVVAAVFAAAQLIRPDRANPPTDAGRTIQAHPGTASGLVAVLDRACR
Ga0070664_10086514123300005564Corn RhizosphereMSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRTIQA
Ga0068859_10294399513300005617Switchgrass RhizosphereMPKRLKQGAVVFIVVGAAAQLVRPDRANPATDDSRTIHAYLGAAAGLTAVLDRSCRD
Ga0068864_10114243413300005618Switchgrass RhizosphereMSRGVKQAAVVFVIVLAAAQLVRPEHANPATDATRTIQAHAGTTSELVAVLDRS
Ga0066903_10121358213300005764Tropical Forest SoilMNRRTKQVAVVFVVLLAAAQLIRPDSTNPATDASHTIEAVVGTHDGLVAVLDRSC
Ga0066903_10488772623300005764Tropical Forest SoilMRTRLKQAAIVFVVVFAAAQLVRPGRTNPTIDPSRTIQAHEGTTSELVAVLDR
Ga0066903_10764333413300005764Tropical Forest SoilMSKRLKQAAVIFIVVLAAAQLVRPERANPPTDASRTIQAHVGTASGLAAVL
Ga0066903_10891068113300005764Tropical Forest SoilVRTRVKRAAVVLTVVIVAAQLVRPGRANPATDASRTFAAHAG
Ga0074470_1013785013300005836Sediment (Intertidal)MKKRLKQATVAFLAVFALAQLVRPERANPPIDAGRTIRAH
Ga0068862_10179693513300005844Switchgrass RhizosphereMRRRLTQAVVIFGVVFAAAQLVRPDRTNPPIDPSRTIQAH
Ga0066653_1065051613300006791SoilVSRRLKQAVVVLVVVFAAAQLVRPGRGNPPTNPSRTIQAHVPTTSGLAAV
Ga0066659_1094234313300006797SoilMNRRLKQAVLVFIVVFAAAQLIRPERANPATDVSRTIEAHV
Ga0075421_10180332313300006845Populus RhizosphereVSRRLKQSVVVFVVVFAAAQLVRPERANPATDATRAIQAHAGTTSELVA
Ga0075433_1017517833300006852Populus RhizosphereVSRRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQARVGTASGES*
Ga0075425_10178945713300006854Populus RhizosphereVSRAPRRIAVSRRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQARVGTASGES*
Ga0075425_10275095713300006854Populus RhizosphereMTRAKQAAVVLILVLAAAQLVRPERANPPIDPSRTIQAQLGTASE
Ga0075434_10177452213300006871Populus RhizosphereVNRRVKQAVIVIVVVVAAAQLVRPERANPPTDADRTIQ
Ga0079217_1018789123300006876Agricultural SoilVSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHV
Ga0079218_1212620513300007004Agricultural SoilVSGRLKQAAVVFIIVLAAAQFVRPERANPATDARRTIQAHVGTASGLVAV
Ga0105240_1277037013300009093Corn RhizosphereVSRRLKQAAIVILAVFAAAQLVRPARTNPATDSSRT
Ga0111539_1060706833300009094Populus RhizosphereVSTRLKQAAVVFIVVFAAAQLVRPERANPATDATRTIQAHTGTT
Ga0105245_1316819923300009098Miscanthus RhizosphereMNRRLKQAAVVFVFVFAAAQFVRPERANPATDVGRTIQAHGGTTSGLVAV
Ga0075418_1017915043300009100Populus RhizosphereMSRRLTLVAVTVVLAFAVAQLVRPARANPPTDPSRTIQAHLGTAPE
Ga0075418_1051137813300009100Populus RhizosphereMTRRLRQAAILFVVVFAAAQLIRPERANPPTDPSHTFQAQAGTA
Ga0075418_1301731223300009100Populus RhizosphereMIRRLKQAAVVLVIVLAAAQLVRPDRENPATNATRTIRAHAGTT
Ga0113563_1127546433300009167Freshwater WetlandsMSRRMKQAGVVFVVVFAAAQLVRPDRRNPATDATRTI*
Ga0126380_1110738913300010043Tropical Forest SoilMSRRLKQAAVVFVVVFAAAQLVRPEHANPATDPTRTIRAHMGEASGLPAVLDRACREC
Ga0126382_1154103813300010047Tropical Forest SoilMARRLKQAAVLFVVVFATAQLVRPERANPSTDESRTIQAHVKNAGGMV
Ga0126370_1084515513300010358Tropical Forest SoilMGRRLKQAAIVFVVLFAAAQLVRPSRANPPTDPGRTIQAHETTRGL
Ga0126372_1100659413300010360Tropical Forest SoilMSRRLKRVAVVFVVVLAAAQLVRPERTNPATDAGR
Ga0126372_1122610413300010360Tropical Forest SoilMRRRLTQAVVVFLVLFAAAQLVRPGRTNPPTDPSRTIR
Ga0126379_1285781323300010366Tropical Forest SoilMTKRLAYAAIIVVVVLAGAQLIRPNRANPPTDPSRTIQAHLGA
Ga0105239_1157160723300010375Corn RhizosphereMSRRLKQVAGVFFIVFAAAQFVRPERANPPTDVSRAIQAQVGTGSALVAVLDRACSD*
Ga0126383_1291855223300010398Tropical Forest SoilMSRRLKQGAIVLVVVLAVAQLIRPSRANPPIDPARTIQAHET
Ga0134121_1219819713300010401Terrestrial SoilMPKRLKKGAVVFVVVVAAAQLVRPDRANPATDASRSI
Ga0134123_1199248413300010403Terrestrial SoilMRRRLVQASVLFVVVFAAAQLVRPERTNPVTDPTRTIRAHVAETSQLPV
Ga0137463_125051613300011444SoilMSRRLKQIAIVFIVVFAAAQLIRPERTNPPTDPSRTIEAQMKTASGLVAVL
Ga0137330_104294723300012134SoilVSRRLKQAAVVFIIVLAAAQFVRPGRANPASDARRTIQAQVGTASGLVAVLDRAC
Ga0137380_1122661623300012206Vadose Zone SoilMPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQ
Ga0137381_1083025613300012207Vadose Zone SoilMPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQAHAG
Ga0150985_12161763123300012212Avena Fatua RhizosphereVSKRLKQAAIVIVVLFAAAQLLRPDQTNPPTDPGRTIQAQVGTA
Ga0137366_1002619153300012354Vadose Zone SoilMSRRLKLAAVVFVVFAAAQLVRPERANPATNASHTIQAEAGTAIGLVAV
Ga0137385_1098368313300012359Vadose Zone SoilMPISRRLKQAAVVFVVVFAAAQLVRPERANPATDVSRTIQAHAGTATELVAVLDRACRD
Ga0137375_1059838933300012360Vadose Zone SoilMSRRLKLAAIVFVVFAAAQLVRPERANPATDASRTIQAH
Ga0150984_11064901313300012469Avena Fatua RhizosphereLTQAAILIAVVVVAAQLVRPERATPVTDANRTIQAQMPTGSELVAVLDRSC
Ga0157313_104064123300012503Arabidopsis RhizosphereMRRRLVQATVLFVVVFAAAQLVRPERTNPATDPTRTIRAHVAEASQLPAVL
Ga0137317_103129523300012672SoilVSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQA
Ga0153915_1019593613300012931Freshwater WetlandsMSRRLKRAAVVLLVVFAAAQLVRPNRANPPTDVSRTMQAQV
Ga0153915_1168066213300012931Freshwater WetlandsMSRRLKQVAIVFVVVVVAAQLVRPGRANPATDASRTIQAHMGTASGLVAVLDR
Ga0153915_1236474913300012931Freshwater WetlandsMSRRLKQAAVVLVVVFAAAQLVRPNRANPPTDVSRT
Ga0157378_1004843463300013297Miscanthus RhizosphereMRRRLKQAAVVFVVIFAAAQLVRPERTDPAPDASHTIQAH
Ga0075301_104828213300014262Natural And Restored WetlandsMTRRLKWVAVVFVVVFAAAQLVRPDRSNPATDANRTIQ
Ga0075351_114922713300014318Natural And Restored WetlandsMSRRVKQAAVVFVVVFAAAQLIRPERAKPPTDVSRTIQAHVGAASG
Ga0157380_1093219123300014326Switchgrass RhizosphereVSRRLKSAAVVFVAVFAAAQLVRPERANPATDVSRTIQAQVGTANG
Ga0157380_1237086023300014326Switchgrass RhizosphereMAVSRRLKQATIVIIVVFAAAQLVRPERTNPTTDVGRALQAQMPTGSGLVAVLDR
Ga0132256_10300411823300015372Arabidopsis RhizosphereMSRRLMQAAVVFLIAFAGAQLVRPGPANLPVDDSRTIAAHVGTASGLAGGGPRREQRK
Ga0132256_10379096723300015372Arabidopsis RhizosphereMRRRHQAVVVFVAVFAAAQLIRPGRTNPPTDGSRTIEAHVGTTSGLA
Ga0132257_10387108723300015373Arabidopsis RhizosphereMRTRLKQAAVVFVIVVAAAQLIRPGRANPAIDVNRTIQAHAGTASGLV
Ga0132255_10310766533300015374Arabidopsis RhizosphereMRRLKQALLVFVILFAAAQLVRPERANPAIETSRTIAAHLGAANGLT
Ga0182039_1081436933300016422SoilMSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTAS
Ga0187776_1035827523300017966Tropical PeatlandMSKRVKQIVIGVVAVFAAAQLIRPARTNPPVDSSRTIQAHVATASGLGAVLDRAC
Ga0184629_1017188923300018084Groundwater SedimentVVFVVIVAAAQLFRPERANPAIDASRTIQAHPGTASGLVA
Ga0184629_1048770413300018084Groundwater SedimentMSRRVKQAAAVFGSVSAAAQFVRPERANPATDATRTIQAHVGTTRELVAVLDRSCRD
Ga0187774_1086356713300018089Tropical PeatlandMSRRLTQATVVFVVIFAGAQLVRPDRANPPTDPSRTIQAHTGAS
Ga0190270_1104151333300018469SoilVSRRLKQAAVIFIIVLAAAQLVRPERANPATDARRTIQAHVGTARGLVAVL
Ga0190271_1178044323300018481SoilMRRRLKQVGVVFVVAFAAAQLVRPERANPPTDPSRTIQAHIGSASG
Ga0173482_1018403713300019361SoilMKRLKRAALVFIVVFAAAQLVRPERANPPIDPALTIQTYVGTESGL
Ga0173479_1011112513300019362SoilMGRRLKQAAVVFVVIVAAAQLIRPERANPPTDVSRTIQAQVGTASGLVAVLDRSCRD
Ga0126371_1077778623300021560Tropical Forest SoilMSRRLKWAAVVIVAVLAAAQLIRPERTNPPTDEGRTIQAH
Ga0247667_111305223300024290SoilMKRRVKQAAVVFVVVLAAAQLVRPERANPPIDTSRTIQAHMGTSS
Ga0207699_1104927123300025906Corn, Switchgrass And Miscanthus RhizosphereMSRRMKHVAIVFAAVFSAAQFVRPERGTPQTDVSRTIQAQVGT
Ga0207699_1144297713300025906Corn, Switchgrass And Miscanthus RhizosphereMSRRMKQAATVFVAVFAAAQFVRPERAPPTTDVSRT
Ga0207701_1104285213300025930Corn, Switchgrass And Miscanthus RhizosphereMRRRLVQATVLFVVVFAAAQLVRPERTNPATDPTRTI
Ga0207709_1144572923300025935Miscanthus RhizosphereMSKRIKQAAMVFVAVFAAAQFVRPERTQPPTDVSRAIQAQIGTASGLAAVLDRACSD
Ga0207712_1174355913300025961Switchgrass RhizosphereVSRRLKQAAIALVAVFAAAQLVRPERANPPTGAHRTIQAHMPTGSGL
Ga0207678_1049470413300026067Corn RhizosphereVSRRSKQAAVVFVIVFAAAQLVRPERANPAIDARRTIQAHVGTASGLVADLDRACSD
Ga0207676_1132726213300026095Switchgrass RhizosphereMSRGVKQAAVVFVIVLAAAQLVRPEHANPATDATRTIQAHAGTTSELVAVLD
Ga0207683_1083521933300026121Miscanthus RhizosphereMRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVGTANGLVAI
Ga0209155_109061423300026316SoilMRRLKQAAVVFVVVFAAAQFVRPERANPATDPNRTIRAHMGTASTLTAV
Ga0208126_100261623300026843SoilMSRRLKQAAVVFIVVLVAAQFVRPDRTNPATDASRSIDAQAGTGSEFVA
Ga0207982_100632633300026886SoilMAKRLKLAAVVFIVLLVAAQFVRPDRTNPATDASRSIEAQVGTGS
Ga0209970_104878533300027614Arabidopsis Thaliana RhizosphereVSRRLTQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAVLDRACS
Ga0209073_1035946323300027765Agricultural SoilMSRRLKQAAVVLVVVFAAAQLIRPERANPATDVHHTIQSQ
Ga0209069_1024934233300027915WatershedsMSRRVKQAAVVFVIVFAAAQLVRPERANPTTDATRTIQAHVGTTGELAAV
Ga0268264_1181286113300028381Switchgrass RhizosphereMRRRLKQAAVVFVVIFAAAQLVRPERTNPATDASHTIQAHVGTANGLVA
Ga0307281_1007942043300028803SoilMGRRFWLVAGVFVVAFAAAQLIRPDGANPATDASRTIRAHM
Ga0318561_1039306223300031679SoilMSRRLEQAAVVFVVALAAAQLIRPGRANPPTDATRTIHAHETTR
Ga0310813_1162781623300031716SoilVRRRFQQAVVAFVVLIAAAQLVRPAHTNPTTDPSRAIQAAPGTN
Ga0307469_1208514023300031720Hardwood Forest SoilMSRRLKQAAVVFVIVFAAAQLVRPERANPTIDPSRTIRAHVAESSQLPAV
Ga0310917_1025770123300031833SoilMSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASAL
Ga0307410_1152872013300031852RhizosphereVIRRLKQAAIVIVAVFAAAQLVRPDRTNPATDVSRPIQA
Ga0306925_1016173413300031890SoilMGRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTAS
Ga0318551_1059175013300031896SoilMSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASALAAVLDRS
Ga0318520_1069136933300031897SoilMHKRLTQAAVVFIVVLAAAQFVRPVRANPAIDVSRTIQAQASELGAVLD
Ga0310900_1110196123300031908SoilMGRRLKQAAVVFVVIVAAAQLIRPERANPPTDVSRTIQAQVGGRADCPPS
Ga0306923_1058621513300031910SoilMRTRLKQAAVLVVVAVAAAQLVRPSRANPPIDASRTIGAHVEPSSGLAPILD
Ga0307412_1177820823300031911RhizosphereMRRLKYVAVAFVILLATAQFVRPERANPVTNPDRTIKAHVG
Ga0306921_1031191613300031912SoilMSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGR
Ga0310913_1131905423300031945SoilMRKRLKQAAVALLGVFAAAQFVRPARANPPTDVTRTIQSR
Ga0306926_1117169913300031954SoilMSGVSGGWRRLKQAAVVVVVVFAAAQLVRPERTNPPVDPGRTIQAHAGTPSGLP
Ga0307409_10119914623300031995RhizosphereVSRRLKQAALVIVSVFAAAQLVRPERTNPTTDVSRTIQAHMPTGSGLVAV
Ga0318504_1017605433300032063SoilVSRRLTRIAVVFVGAFAAAQIVRPDLANPATDPTRSIQA
Ga0318540_1053534723300032094SoilMSRRLKWAAVAVVAVLAAAQLIRPERTNPPTDEGRTIQAHAGTASALAAVLD
Ga0310889_1047700213300032179SoilVSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQAHVGTASGLVAVLDRACS
Ga0310896_1034506613300032211SoilVSRRLKEAAVVFIIVVAAAQFVRPERVSPATDACRTTQAHVGTA
Ga0326726_1216346413300033433Peat SoilMRSRLKQAAVVFAVIIAAAQFVRPDRSNPATEASRTIRAH
Ga0316620_1212716613300033480SoilMNKRLKQAAVAFAVAFAAAQLVRPERANPPIDAGRTIQARVGTASGLSAVLNRACGQCH
Ga0316628_10279484013300033513SoilVSRRLKRAAVVFVVVFSAAQLVRPERANPPTDARRTIQA
Ga0316628_10362951123300033513SoilVSRRLKQTAVVLVLAFAAAQLVRPDFANPATDVDRTIQA
Ga0247830_1074063433300033551SoilMSRRLKQGAVAFVVVIAAAQLVRPERSNPATDVKRTIQAHAGTASGLVAV
Ga0364935_0145944_3_1163300034151SedimentMSTRLKQAAVVFIIVFAAAQFVRPERANPATDARRTIQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.