NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063032

Metagenome / Metatranscriptome Family F063032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063032
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 44 residues
Representative Sequence QEKRDRAEQKAKTEAAFRDEPFVQDVLARFDARIKPDSIKPVS
Number of Associated Samples 122
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.46 %
% of genes from short scaffolds (< 2000 bps) 96.15 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.462 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.461 % of family members)
Environment Ontology (ENVO) Unclassified
(32.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.615 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.62%    β-sheet: 0.00%    Coil/Unstructured: 63.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF02575YbaB_DNA_bd 80.77
PF13662Toprim_4 10.77
PF02132RecR 3.85
PF02652Lactate_perm 1.54
PF06808DctM 0.77
PF01425Amidase 0.77
PF03480DctP 0.77
PF01546Peptidase_M20 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0718DNA-binding nucleoid-associated protein YbaB/EfbCTranscription [K] 80.77
COG0353Recombinational DNA repair protein RecRReplication, recombination and repair [L] 3.85
COG1620L-lactate permeaseEnergy production and conversion [C] 1.54
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.46 %
UnclassifiedrootN/A21.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003203|JGI25406J46586_10215459All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300004155|Ga0066600_10053157All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1440Open in IMG/M
3300004156|Ga0062589_101254309All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales713Open in IMG/M
3300004635|Ga0062388_101931776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria609Open in IMG/M
3300005163|Ga0066823_10045926All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300005295|Ga0065707_10706792All Organisms → cellular organisms → Bacteria → Proteobacteria637Open in IMG/M
3300005328|Ga0070676_11081551All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae605Open in IMG/M
3300005330|Ga0070690_100511319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria900Open in IMG/M
3300005331|Ga0070670_100217090All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1664Open in IMG/M
3300005364|Ga0070673_100290322All Organisms → cellular organisms → Bacteria → Proteobacteria1437Open in IMG/M
3300005366|Ga0070659_101973595All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae524Open in IMG/M
3300005367|Ga0070667_100542394All Organisms → cellular organisms → Bacteria → Proteobacteria1069Open in IMG/M
3300005444|Ga0070694_101566064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales559Open in IMG/M
3300005458|Ga0070681_11330215All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300005458|Ga0070681_11330216All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300005466|Ga0070685_11249133All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales566Open in IMG/M
3300005536|Ga0070697_101781081All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae551Open in IMG/M
3300005548|Ga0070665_101479278All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria688Open in IMG/M
3300006031|Ga0066651_10106128All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1422Open in IMG/M
3300006046|Ga0066652_101468404All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300006173|Ga0070716_100117425All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1659Open in IMG/M
3300006224|Ga0079037_101343659All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria712Open in IMG/M
3300006237|Ga0097621_101903145All Organisms → cellular organisms → Bacteria → Proteobacteria568Open in IMG/M
3300006358|Ga0068871_101948310All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300006638|Ga0075522_10328064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales736Open in IMG/M
3300006853|Ga0075420_101161049All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales664Open in IMG/M
3300006903|Ga0075426_11471273All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300009088|Ga0099830_11103220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria658Open in IMG/M
3300009131|Ga0115027_11245240Not Available597Open in IMG/M
3300009147|Ga0114129_12594677All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium605Open in IMG/M
3300009153|Ga0105094_10252401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1013Open in IMG/M
3300009167|Ga0113563_10482107Not Available1347Open in IMG/M
3300009167|Ga0113563_13028243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium569Open in IMG/M
3300009506|Ga0118657_10498179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1578Open in IMG/M
3300009545|Ga0105237_12360479All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium542Open in IMG/M
3300009553|Ga0105249_13525293Not Available504Open in IMG/M
3300010043|Ga0126380_11132457Not Available669Open in IMG/M
3300010335|Ga0134063_10658293Not Available538Open in IMG/M
3300010337|Ga0134062_10328822All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria731Open in IMG/M
3300010343|Ga0074044_10650760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria688Open in IMG/M
3300010360|Ga0126372_12067314Not Available617Open in IMG/M
3300010360|Ga0126372_12682878Not Available550Open in IMG/M
3300010362|Ga0126377_12484588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria594Open in IMG/M
3300010371|Ga0134125_10138050All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300010398|Ga0126383_12206520Not Available637Open in IMG/M
3300010399|Ga0134127_11677041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales711Open in IMG/M
3300011270|Ga0137391_10893895Not Available727Open in IMG/M
3300012205|Ga0137362_11417787All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300012209|Ga0137379_10754072All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria878Open in IMG/M
3300012210|Ga0137378_10057574All Organisms → cellular organisms → Bacteria → Proteobacteria3507Open in IMG/M
3300012211|Ga0137377_11805809Not Available531Open in IMG/M
3300012350|Ga0137372_10861190All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria646Open in IMG/M
3300012353|Ga0137367_10179595All Organisms → cellular organisms → Bacteria → Proteobacteria1538Open in IMG/M
3300012361|Ga0137360_11070109All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria696Open in IMG/M
3300012960|Ga0164301_11853535Not Available508Open in IMG/M
3300012971|Ga0126369_10006505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8705Open in IMG/M
3300012985|Ga0164308_11205948All Organisms → cellular organisms → Bacteria → Proteobacteria683Open in IMG/M
3300012989|Ga0164305_10320457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1154Open in IMG/M
3300013306|Ga0163162_12044686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria657Open in IMG/M
3300014266|Ga0075359_1001984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2145Open in IMG/M
3300014325|Ga0163163_11831821Not Available667Open in IMG/M
3300014745|Ga0157377_10262972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1123Open in IMG/M
3300014829|Ga0120104_1052856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria768Open in IMG/M
3300015075|Ga0167636_1006711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1831Open in IMG/M
3300015077|Ga0173483_10550851Not Available625Open in IMG/M
3300015256|Ga0180073_1083860Not Available679Open in IMG/M
3300015371|Ga0132258_13800116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1028Open in IMG/M
3300017792|Ga0163161_10927704All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales739Open in IMG/M
3300017927|Ga0187824_10065611All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1134Open in IMG/M
3300017947|Ga0187785_10719855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium525Open in IMG/M
3300018060|Ga0187765_10782043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium635Open in IMG/M
3300018076|Ga0184609_10203518All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria922Open in IMG/M
3300018084|Ga0184629_10720880Not Available501Open in IMG/M
3300018431|Ga0066655_10083212All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1749Open in IMG/M
3300018433|Ga0066667_10717020All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria841Open in IMG/M
3300019888|Ga0193751_1206184All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300020001|Ga0193731_1129934All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria634Open in IMG/M
3300022385|Ga0210376_1085179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium544Open in IMG/M
3300022534|Ga0224452_1271603All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300025893|Ga0207682_10496410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium578Open in IMG/M
3300025906|Ga0207699_10401495All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria976Open in IMG/M
3300025908|Ga0207643_10133799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1477Open in IMG/M
3300025914|Ga0207671_10618386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria863Open in IMG/M
3300025919|Ga0207657_11457277Not Available513Open in IMG/M
3300025939|Ga0207665_10711511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium790Open in IMG/M
3300025941|Ga0207711_11008178All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium772Open in IMG/M
3300025986|Ga0207658_10573946Not Available1011Open in IMG/M
3300026095|Ga0207676_10196911All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300026332|Ga0209803_1263895All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria592Open in IMG/M
3300026360|Ga0257173_1043258All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria626Open in IMG/M
3300027829|Ga0209773_10135271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1024Open in IMG/M
3300027890|Ga0209496_10756337Not Available534Open in IMG/M
3300028803|Ga0307281_10249812All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium651Open in IMG/M
3300028861|Ga0302259_1122000All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria641Open in IMG/M
3300029999|Ga0311339_11195392All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales697Open in IMG/M
3300030490|Ga0302184_10397971Not Available536Open in IMG/M
3300030491|Ga0302211_10098006All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria848Open in IMG/M
3300031231|Ga0170824_105536108All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax644Open in IMG/M
3300031562|Ga0310886_10875511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium570Open in IMG/M
3300031747|Ga0318502_10078554All Organisms → cellular organisms → Bacteria → Proteobacteria1794Open in IMG/M
3300031747|Ga0318502_10828704All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria561Open in IMG/M
3300031748|Ga0318492_10272165All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria878Open in IMG/M
3300031751|Ga0318494_10283445All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria954Open in IMG/M
3300031779|Ga0318566_10596922All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium538Open in IMG/M
3300031798|Ga0318523_10520298All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria588Open in IMG/M
3300031820|Ga0307473_11219609Not Available560Open in IMG/M
3300031845|Ga0318511_10588153Not Available518Open in IMG/M
3300031902|Ga0302322_103363339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium548Open in IMG/M
3300031938|Ga0308175_102498255Not Available579Open in IMG/M
3300031942|Ga0310916_11384471All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300031945|Ga0310913_11046957All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium571Open in IMG/M
3300032001|Ga0306922_11715396All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria621Open in IMG/M
3300032060|Ga0318505_10186373All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria969Open in IMG/M
3300032180|Ga0307471_101161878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria937Open in IMG/M
3300032180|Ga0307471_101704008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria784Open in IMG/M
3300032205|Ga0307472_101387629All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria681Open in IMG/M
3300032211|Ga0310896_10270259All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria868Open in IMG/M
3300032211|Ga0310896_10567572All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium630Open in IMG/M
3300032256|Ga0315271_10369803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1195Open in IMG/M
3300032275|Ga0315270_10150137All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1402Open in IMG/M
3300032275|Ga0315270_10641067Not Available692Open in IMG/M
3300032516|Ga0315273_10650885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1391Open in IMG/M
3300032516|Ga0315273_12468525All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium600Open in IMG/M
3300033413|Ga0316603_12059086Not Available539Open in IMG/M
3300033414|Ga0316619_12083085Not Available518Open in IMG/M
3300033419|Ga0316601_100239836All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1621Open in IMG/M
3300033482|Ga0316627_101606022Not Available662Open in IMG/M
3300033493|Ga0316631_10161046All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria840Open in IMG/M
3300034176|Ga0364931_0244902Not Available589Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.62%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.08%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.31%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.31%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.54%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.54%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.77%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.77%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.77%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.77%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Glacier Forefield SoilsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.77%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.77%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.77%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015075Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300022385Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10227868713300001213WetlandLAARDKRERAEARAKTESQFREEPFVRDLVERFDAKVKTESIKPVGPAEGASR*
JGI25406J46586_1021545923300003203Tabebuia Heterophylla RhizosphereQERRERAEQKAQSEAQFRDEPFVRDVLARFDARIKPDSVKPG*
Ga0066600_1005315743300004155FreshwaterRERDDEKARNEAQFRAEPFVRDVLERFDATIRPGSIKPVS*
Ga0062589_10125430933300004156SoilQRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPLT*
Ga0062388_10193177623300004635Bog Forest SoilLRFEFGGVAGTSLAATEKREREAGEAKTEAAFRDDPFVQDLLTRFEARIKPNSIKPT*
Ga0066823_1004592633300005163SoilADSSLAAQERRTRAEEKAKAEAAFRDEPFVRDVLERFDAKIRPDSVKPAS*
Ga0065707_1070679213300005295Switchgrass RhizosphereSRAQAEEKSRVEAAFRGEPFVEDVLSRFGAKIKPDSIKPLG*
Ga0070676_1108155123300005328Miscanthus RhizosphereAHEKRERAQQQANTEAAFREEPFVRDMLERFDARIRPDSIKPIS*
Ga0070690_10051131933300005330Switchgrass RhizosphereASLAAQDKRERDERKAQTEAAFRDEPFVREVLARFDAKIRPGSIKPIS*
Ga0070670_10021709043300005331Switchgrass RhizosphereAQKSRAQAEEKSRVESAFRGEPFVQDVLSRFDAKIRPDSIKDVSR*
Ga0070673_10029032213300005364Switchgrass RhizosphereREQAEQKSRTEAAFRAEPFVQDVHARFDAKIKPDSIKPVP*
Ga0070659_10197359513300005366Corn RhizosphereAAEGSLASQRERERVEAKARDEAAFNDEPFVRDVVSRFGATIKPDSIKRVP*
Ga0070667_10054239413300005367Switchgrass RhizosphereKSRAQAAEKSRVEAAFRDEPFVQDVLSRFDAKIRPDSIKPLG*
Ga0070694_10156606413300005444Corn, Switchgrass And Miscanthus RhizosphereFDVDAAAGATLAAQEKRERAEVKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS*
Ga0070681_1133021513300005458Corn RhizosphereATLAAQEKRERAEAKAKTEAAFRDDPFVQDVLSRFDATIKPESIKPNS*
Ga0070681_1133021613300005458Corn RhizosphereATLAAQEKRERAEAKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS*
Ga0070685_1124913313300005466Switchgrass RhizosphereERERAVERAKTEEKFRDEPFVREALARFDATIKPDSIKPLP*
Ga0070697_10178108123300005536Corn, Switchgrass And Miscanthus RhizosphereAQRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPLT*
Ga0070665_10147927833300005548Switchgrass RhizosphereQERERAVERAKTEEKFRDEPFVREALARFDATIKPDSIKPLP*
Ga0066651_1010612813300006031SoilESSLAAQEKRARSEQQARTEAAFRDEPFVRDVLDRFDATIRPDSIKPVS*
Ga0066652_10146840433300006046SoilRARSEQQARTEAAFRDEPFVRDVLDRFDATIRPDSIKPVS*
Ga0070716_10011742543300006173Corn, Switchgrass And Miscanthus RhizosphereKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS*
Ga0079037_10134365933300006224Freshwater WetlandsSLAARERRERAQQKAQTEASFRDEPFVRDAVAQLGARINPDSIKPVS*
Ga0097621_10190314523300006237Miscanthus RhizosphereAQDKRERALQKAKDESTFREEPFVRDVVARFDARIKPDSIKPVS*
Ga0068871_10194831023300006358Miscanthus RhizosphereERERAQNEARFRDEPFVKDLVTRFDGRINPDSIKPVS*
Ga0075522_1032806433300006638Arctic Peat SoilSQQQRERSETRARTEAAFNEEPFVRDVLSRFDATIKPDSIKRVP*
Ga0075420_10116104933300006853Populus RhizosphereAQKSRAQAEEKSRVEAAFRGEPFVEDVLSRFGAKIKPDSIKPLG*
Ga0075426_1147127313300006903Populus RhizosphereKAKTEAAFRSEPFVQDALTRFDARIRPDSIKPVS*
Ga0099830_1110322013300009088Vadose Zone SoilLAAQEKREREAARASTEAAFRDDPFVQDVLSRFDARIKPNSIKPV*
Ga0115027_1124524013300009131WetlandLAAQEKRQRAEQQARAEAAFRDEPFVRDVLERFDARIRPDSIKPVS*
Ga0114129_1259467713300009147Populus RhizosphereSSLAAQEKRARSEQQAKTEAQFRAEPFVRDVLERFDAKIRPDSIKPV*
Ga0105094_1025240133300009153Freshwater SedimentSLAAQEKRERAEQKAKTEAAFREEPFVQDVLARFDARIKPDSIKPVS*
Ga0113563_1048210743300009167Freshwater WetlandsAEQKAKTEEAFRSEPFVQEALARFDAKIRPDSIKPAS*
Ga0113563_1302824313300009167Freshwater WetlandsQEKRDRAEQKAKTEAAFRDEPFVQDVLARFDARIKPDSIKPVS*
Ga0118657_1049817943300009506Mangrove SedimentKAKTEAQFRDEPFVREVISRFDAKIRPDSIKPVS*
Ga0105237_1236047923300009545Corn RhizosphereAAQRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPLT*
Ga0105249_1352529323300009553Switchgrass RhizosphereAEVKAKTEAAFRDDPFVQDLLSRFDATIKTDSIKPNS*
Ga0126380_1113245733300010043Tropical Forest SoilRERAAQQAKTEAAFRDDPFVQDVLSRFDGRIKPDSIKPL*
Ga0134063_1065829323300010335Grasslands SoilQEKRGRTEAQARTEATFRNDPFVQDVLARFGATIKPDSIKPL*
Ga0134062_1032882213300010337Grasslands SoilKRERDAAQAKTEAAFRDDPFVQDLLTRFDARIKPNSIKPV*
Ga0074044_1065076013300010343Bog Forest SoilRLRFEFGGVAGISLAATEKREREAVEAKTEAAFRDDPFVQDVLSRFEARIKPNSIKPI*
Ga0126372_1206731433300010360Tropical Forest SoilAAAESSLAAQEKRARVEQQAKTEETFRSEPFVRDMLERFDAKIKPDSIKPVS*
Ga0126372_1268287823300010360Tropical Forest SoilGETLSTQQKRERAAKQAKTEAAFRDDPFVQDVLSRFDARIKPDSIKPH*
Ga0126377_1248458833300010362Tropical Forest SoilQQAKTEAAFRDDPFVQDVLSRFDGRIKPDSIKPL*
Ga0134125_1013805013300010371Terrestrial SoilEKRERAEAKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS*
Ga0126383_1220652033300010398Tropical Forest SoilRVRFETADIAESTLAAQEKREREAARARTEEAFRDDPFVQDIVSRFDARVRPDSIKPS*
Ga0134127_1167704113300010399Terrestrial SoilKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPLT*
Ga0137391_1089389523300011270Vadose Zone SoilASLAVVEKRERAEAQSKTEAAFRDDPFVQDVLARFDARIKPDSIKPVS*
Ga0137362_1141778713300012205Vadose Zone SoilESQSKTEAAFRDDPFVQDVLARFEAKIKPDSIKPVS*
Ga0137379_1075407213300012209Vadose Zone SoilKRERDAAQAKTEAAFRDDPFVQDVLSRFDARIKPNSIKPV*
Ga0137378_1005757463300012210Vadose Zone SoilQEKREREAARASTEAAFRDDPFVQDVLSRFDARIKPNSIKPV*
Ga0137377_1180580913300012211Vadose Zone SoilTLAAQERREREAARASTEAAFRDDPFVQDVLSRFDARIKPNSIKPV*
Ga0137372_1086119013300012350Vadose Zone SoilQEKREKEAARTSTEAAFRDDPFVQDILSRFDARVRPDSIKPT*
Ga0137367_1017959513300012353Vadose Zone SoilQEKRERDAAQAKTETAFRDDPFVQDVLSRFDARIKPNSIKPV*
Ga0137360_1107010913300012361Vadose Zone SoilTLAAQEKRERAAAQAKTDTAFRDDPFVQDVLARFDAKVKPDSVKPIE*
Ga0164301_1185353523300012960SoilRERAEVKAKTEAAFRDDPFVQDLLSRFDATIKTDSIKPNS*
Ga0126369_10006505103300012971Tropical Forest SoilEKRERTAQQANTEAAFRDDPFVKDVLSRFDGRIKSDSIKPL*
Ga0164308_1120594833300012985SoilVDAAATATLAAQEKRERAEAKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS*
Ga0164305_1032045713300012989SoilKAKTEAAFRDDPFVQDLLSRFDATIKTDSIKPNS*
Ga0163162_1204468613300013306Switchgrass RhizosphereEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVS*
Ga0075359_100198453300014266Natural And Restored WetlandsEASLAARERRERDDEKARNEAQFRAEPFVRDVLERFDATIRPGSIKPVS*
Ga0163163_1183182133300014325Switchgrass RhizosphereEQSEQKSRTEAAFRGEPFVQDVLTRFDAKIRPDSIKPVS*
Ga0157377_1026297233300014745Miscanthus RhizosphereQAEEKSRVESAFRGEPFVQDVLSRFDAKIRPDSIKPLG*
Ga0120104_105285613300014829PermafrostDAVVGATLAAQEKRERTEANAMTEAAFRDDPFVQDVLSRFDATIKPESIKPSS*
Ga0167636_100671143300015075Glacier Forefield SoilsEKRERAESQSKTEAAFRDDPFVQDVLARFDAKIKPDSIKPVS*
Ga0173483_1055085113300015077SoilSLAAQRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVN*
Ga0180073_108386033300015256SoilRAEQQSQTEAAFRDEPFVRDVLERFDAKIRSDSIKPVS*
Ga0132258_1380011633300015371Arabidopsis RhizosphereRAEQKARAEAQFRDEPFVRDVLTRFDARIKPDSVKRG*
Ga0163161_1092770433300017792Switchgrass RhizosphereGAAAGATLAAQEKRERAEVKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS
Ga0187824_1006561113300017927Freshwater SedimentQQKREREAARASTEAAFRDDPFVQDVLSRFDARIKPDSIKPA
Ga0187785_1071985513300017947Tropical PeatlandQREQAEAKAKTEAAFRSEPFVQDALNRFDARIRPDSIKPVS
Ga0187765_1078204313300018060Tropical PeatlandREQAEAKAKTEAAFRSEPFVQEALARFDAKIRPDSIKPVS
Ga0184609_1020351833300018076Groundwater SedimentLAAQEKRERDAAQAKTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0184629_1072088023300018084Groundwater SedimentRDAMQAKTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0066655_1008321213300018431Grasslands SoilFEVGEVADTTLAAQEKREREAARASTEAAFRDDPFVQDVLSRFDARIKPNSVKPV
Ga0066667_1071702033300018433Grasslands SoilADTTLAAQERREREAARASTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0193751_120618413300019888SoilTLAAQEKRERAEVKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPSS
Ga0193731_112993433300020001SoilAESQSKTEAAFRDDPFVQDVLARFDARIKPDSIKPVS
Ga0210376_108517913300022385EstuarineRSREQAEQKARTEAAFRDEPFVQDALARFDAKIRPDSIKPVS
Ga0224452_127160323300022534Groundwater SedimentGAAATTLAAQEKRERDAAQAKTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0207682_1049641023300025893Miscanthus RhizosphereAEEKSRVEAAFRGEPFVQDVLSRFDAKIRPDSIKPLG
Ga0207699_1040149533300025906Corn, Switchgrass And Miscanthus RhizosphereLAAQEKRERAEAKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS
Ga0207643_1013379943300025908Miscanthus RhizosphereAQEKRERAEVKAKTEAAFRDDPFVQDVLSRFDATIKTESIKPNS
Ga0207671_1061838633300025914Corn RhizosphereAAQRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPLT
Ga0207657_1145727723300025919Corn RhizosphereVEAKARDEAAFNDEPFVRDVVSRFGATIKPDSIKRVP
Ga0207665_1071151123300025939Corn, Switchgrass And Miscanthus RhizosphereMPPSTVITEPVVKRERAEAQSKTEAAFRDDPFVQDVLARFDARIKPDSIKPVS
Ga0207711_1100817833300025941Switchgrass RhizosphereRDRAEQKAATEAAFRSEPFVRDVLSRFDAKIRPDSIKPLS
Ga0207658_1057394633300025986Switchgrass RhizosphereQKSRAQAAEKSRVEAAFRDEPFVQDVLSRFDAKIRPDSIKPLG
Ga0207676_1019691113300026095Switchgrass RhizosphereAQKSRAQAEEKSRVEAAFRGEPFVQDVLSRFDAKIRPDSIKPLG
Ga0209803_126389513300026332SoilEAARASTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0257173_104325833300026360SoilLRFDVGGGATASLAVVEKRERAEAQSKTEAAFRDDPFVQDVLARFDARIKPDSIKPVS
Ga0209773_1013527113300027829Bog Forest SoilREREAAQATTEAAFRDDPFVQDLLSRFDARVKPNSIKPI
Ga0209496_1075633723300027890WetlandERAEAKARNEAAFRDEPFVRDVVARFDAKVRPDSVKPVS
Ga0307281_1024981213300028803SoilLAAQEKRARAEQQSQTEAAFRDEPFVRDVLERFDAKIKSESIKPVS
Ga0302259_112200033300028861FenGGTATATLAAQEKRERAAAQAKTEAAFRDDPFVQDVLARFDAKVRPDSIKPTE
Ga0311339_1119539233300029999PalsaSLAATEKRQREAAEAKTEAAFRDDPFVQDLLTRFEARIKPNSIKPI
Ga0302184_1039797113300030490PalsaFEFGGVVGTSLAATEKRQREAAEAKTEAAFRDDPFVQDLLTRFEARIKPNSIKPI
Ga0302211_1009800633300030491FenEKRERAAAQAKTEAAFRDDPFVQDVLARFDAKVRPDSIKPTE
Ga0170824_10553610813300031231Forest SoilRKRSEAQASTEAAFRDDPFVQDVLERFNAKVRPDSIKPNE
Ga0310886_1087551123300031562SoilAQRHREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVS
Ga0318502_1007855413300031747SoilAQEKRERAARQAKTEAAFRDDPFVQDVLSRFDAHVKPDSIKPV
Ga0318502_1082870413300031747SoilEKRERAARQAKTEAAFRDDPFVQDMLSRFGARIKPDSIKPV
Ga0318492_1027216533300031748SoilSAQEKRERAARQAKTEAAFRDDPFVQDVLSRFDAHVKPDSIKPV
Ga0318494_1028344513300031751SoilYVAESGETLSAQEKRERAARQAKTEAAFRDDPFVQDVLSRFDAHVKPDSIKPV
Ga0318566_1059692223300031779SoilRQREQAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVR
Ga0318523_1052029833300031798SoilGETLSAQEKRERAARQAKTEAAFRDDPFVQDVLSRFDAHVKPDSIKPV
Ga0307473_1121960913300031820Hardwood Forest SoilTLAAQEKRERDAAQAKTEAAFRDDPFVQDVLSRFDARIKPNSIKPV
Ga0318511_1058815313300031845SoilAMTEAAFRNEPFVRDALARFDAKIKPDSIKSVESKP
Ga0302322_10336333923300031902FenETSLAAQEKRARTEQQAKAEAAFLSEPFVRDVLERFDAKIRPDSIKPVS
Ga0308175_10249825513300031938SoilSLAAQERRERADQKMRQEAAFRDEPFVREVLDRFDARIKPDSIKPAS
Ga0310916_1138447123300031942SoilAAQRQREQADAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVR
Ga0310913_1104695733300031945SoilAEAKAKTEAAFRSEPFVQDALARFDAKIRPDSIKPVR
Ga0306922_1171539613300032001SoilKRERAARQAKTEAAFRDDPFVQDMLSRFGARIKPDSIKPV
Ga0318505_1018637313300032060SoilTLSAQEKRERAARQAKTEAAFRDDPFVQDVLSRFDAHVKPDSIKPV
Ga0307471_10116187833300032180Hardwood Forest SoilSATLAAQEKRERAAAQAKTDTAFRDDPFVQDVLARFDAKVKPDSVKPTE
Ga0307471_10170400833300032180Hardwood Forest SoilEKRERLARQARTEAAFRDDPFVQDVLSRFDARIKPDSIKPV
Ga0307472_10138762913300032205Hardwood Forest SoilEKRERDAAQAKTEAAFREDPFVQDVLSRFDARIKPNSIKRV
Ga0310896_1027025933300032211SoilEKSEAKARHEAAFRDEPFVRDVVTRFDARVRPDSIKPR
Ga0310896_1056757213300032211SoilQKNRALAEEKSRAEAAFRGEPFVQDVLSRFDAKIKPDSIKPLG
Ga0315271_1036980313300032256SedimentRERAEQKAQTEAAFRDEPFVRDALARFDARIKPDSIKRNP
Ga0315270_1015013713300032275SedimentREQAGEKAKAEAAFRSEPFVQDALARFDAKIKPDSVKPVS
Ga0315270_1064106733300032275SedimentASLAAQARRERAEQKARTEAQFRDDPFVRDVVARFDATINPQSIKPVS
Ga0315273_1065088513300032516SedimentAQKSREQAEQKTRAEAAFRGEPFVQDVLARFDAKIRPDSIKPVS
Ga0315273_1246852513300032516SedimentAQRSREQAEQKARTEAAFRGEPFVQDALARFDAKIRPDSIKPLS
Ga0316603_1205908623300033413SoilAETSLAAQEKRQRAEQQARAEAAFRDEPFVRDVLERFDARIRPDSIKPVS
Ga0316619_1208308513300033414SoilGEASLAARKMREQAEQKAKTEEAFRSEPFVQEALARFDAKIRPDSIKPAS
Ga0316601_10023983613300033419SoilARRERAEQKAKTEAQFRDEPFVREVVARFDAKIKPDSIKRVS
Ga0316627_10160602213300033482SoilETSLAAQEKRQRAEQQARAEAAFRDEPFVRDVLERFDARIRPDSIKPVS
Ga0316631_1016104613300033493SoilLAAQARRERAEQKAKTEAQFRDEPFVREVVARFDAKIKPDSIKRVS
Ga0364931_0244902_471_5873300034176SedimentRAEQKARTEAQFRNEPFVRDVVARFDATIIPDSIKPVP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.