NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062959

Metagenome / Metatranscriptome Family F062959

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062959
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 46 residues
Representative Sequence FHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGRH
Number of Associated Samples 116
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.92 %
% of genes from short scaffolds (< 2000 bps) 90.77 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.846 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.154 % of family members)
Environment Ontology (ENVO) Unclassified
(22.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.923 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 45.21%    β-sheet: 0.00%    Coil/Unstructured: 54.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01850PIN 10.77
PF01674Lipase_2 9.23
PF03259Robl_LC7 6.92
PF01145Band_7 5.38
PF01402RHH_1 3.85
PF04909Amidohydro_2 2.31
PF00743FMO-like 2.31
PF01717Meth_synt_2 1.54
PF04672Methyltransf_19 1.54
PF13450NAD_binding_8 1.54
PF00881Nitroreductase 1.54
PF00534Glycos_transf_1 0.77
PF02900LigB 0.77
PF05088Bac_GDH 0.77
PF028262-Hacid_dh_C 0.77
PF00871Acetate_kinase 0.77
PF13738Pyr_redox_3 0.77
PF13231PMT_2 0.77
PF01047MarR 0.77
PF08447PAS_3 0.77
PF00561Abhydrolase_1 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG2018Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB familySignal transduction mechanisms [T] 6.92
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 2.31
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.54
COG0282Acetate kinaseEnergy production and conversion [C] 0.77
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.77
COG3426Butyrate kinaseEnergy production and conversion [C] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.85 %
UnclassifiedrootN/A16.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10164618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. AgB32808Open in IMG/M
3300001452|JGI20203J14952_1040622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300001867|JGI12627J18819_10284678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium665Open in IMG/M
3300005334|Ga0068869_100422230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1100Open in IMG/M
3300005336|Ga0070680_100234950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1548Open in IMG/M
3300005338|Ga0068868_100055327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales3130Open in IMG/M
3300005363|Ga0008090_14616782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae527Open in IMG/M
3300005434|Ga0070709_10800618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia740Open in IMG/M
3300005434|Ga0070709_11188400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces612Open in IMG/M
3300005435|Ga0070714_100666212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1002Open in IMG/M
3300005436|Ga0070713_101684763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces615Open in IMG/M
3300005467|Ga0070706_100741898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300005537|Ga0070730_10284856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300005541|Ga0070733_10590445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300005542|Ga0070732_10154062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1368Open in IMG/M
3300005577|Ga0068857_100998007All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005578|Ga0068854_101961510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300005602|Ga0070762_11304162Not Available504Open in IMG/M
3300005610|Ga0070763_10213681Not Available1033Open in IMG/M
3300005614|Ga0068856_100109751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2755Open in IMG/M
3300005764|Ga0066903_107076968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300005843|Ga0068860_100090951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2907Open in IMG/M
3300005952|Ga0080026_10065127Not Available975Open in IMG/M
3300006028|Ga0070717_10789946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300006175|Ga0070712_100637705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300006175|Ga0070712_101492892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces590Open in IMG/M
3300006605|Ga0074057_10024341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2001Open in IMG/M
3300006755|Ga0079222_10422850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces939Open in IMG/M
3300006804|Ga0079221_10246081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1013Open in IMG/M
3300006854|Ga0075425_100764093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300009092|Ga0105250_10260776All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300009177|Ga0105248_13394168All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009520|Ga0116214_1321189Not Available596Open in IMG/M
3300009523|Ga0116221_1247979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300009545|Ga0105237_11977813Not Available591Open in IMG/M
3300009551|Ga0105238_12429869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300009665|Ga0116135_1306112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300009672|Ga0116215_1159211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1001Open in IMG/M
3300009700|Ga0116217_10538105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii731Open in IMG/M
3300009839|Ga0116223_10225674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1137Open in IMG/M
3300010043|Ga0126380_10244575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1237Open in IMG/M
3300010360|Ga0126372_12040514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300010371|Ga0134125_10988559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300010371|Ga0134125_12191724All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300010373|Ga0134128_11718310Not Available690Open in IMG/M
3300010396|Ga0134126_10537602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1343Open in IMG/M
3300010880|Ga0126350_10575672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1236Open in IMG/M
3300011271|Ga0137393_11757671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae508Open in IMG/M
3300012207|Ga0137381_10358829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1271Open in IMG/M
3300012209|Ga0137379_10037554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae4672Open in IMG/M
3300012360|Ga0137375_11436183All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300012478|Ga0157328_1029693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300012924|Ga0137413_11778831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012957|Ga0164303_10612165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300012971|Ga0126369_11846241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300013102|Ga0157371_10466388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300013105|Ga0157369_10128554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2685Open in IMG/M
3300013307|Ga0157372_11389855All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300015372|Ga0132256_103362473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300016357|Ga0182032_11694049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300017970|Ga0187783_11141508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300017975|Ga0187782_10932807Not Available674Open in IMG/M
3300018007|Ga0187805_10276195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300018007|Ga0187805_10599098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300018058|Ga0187766_10217243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1212Open in IMG/M
3300018062|Ga0187784_10066177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2931Open in IMG/M
3300018062|Ga0187784_10489949Not Available991Open in IMG/M
3300018062|Ga0187784_11066832Not Available641Open in IMG/M
3300018433|Ga0066667_10587811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300021088|Ga0210404_10075877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1644Open in IMG/M
3300021088|Ga0210404_10215717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1033Open in IMG/M
3300021402|Ga0210385_10355723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium agri1094Open in IMG/M
3300021403|Ga0210397_11274640All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300021404|Ga0210389_10135911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1903Open in IMG/M
3300021420|Ga0210394_10175616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1865Open in IMG/M
3300021432|Ga0210384_10593103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Beutenbergiaceae → Beutenbergia → Beutenbergia cavernae995Open in IMG/M
3300021475|Ga0210392_11485100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi507Open in IMG/M
3300021477|Ga0210398_10930968All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300021560|Ga0126371_12729454All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300022467|Ga0224712_10250881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Beutenbergiaceae → Beutenbergia → Beutenbergia cavernae817Open in IMG/M
3300024055|Ga0247794_10167890All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300024181|Ga0247693_1005374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces anthocyanicus group → Streptomyces tricolor1541Open in IMG/M
3300024286|Ga0247687_1041226All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300024288|Ga0179589_10047791Not Available1596Open in IMG/M
3300024325|Ga0247678_1053663All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300025898|Ga0207692_10100039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1589Open in IMG/M
3300025898|Ga0207692_10136162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1392Open in IMG/M
3300025906|Ga0207699_10435742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300025915|Ga0207693_10433014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300025921|Ga0207652_10606702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300025924|Ga0207694_10267535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300025928|Ga0207700_10233044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1566Open in IMG/M
3300025929|Ga0207664_10208175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1691Open in IMG/M
3300025929|Ga0207664_10880613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300025929|Ga0207664_10954009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300026035|Ga0207703_11459925All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300026078|Ga0207702_12024284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces566Open in IMG/M
3300026118|Ga0207675_101852002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia622Open in IMG/M
3300027662|Ga0208565_1059212All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300027725|Ga0209178_1011229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2801Open in IMG/M
3300027738|Ga0208989_10271384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae548Open in IMG/M
3300027775|Ga0209177_10064643Not Available1076Open in IMG/M
3300027869|Ga0209579_10056155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2090Open in IMG/M
3300027905|Ga0209415_10216462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1780Open in IMG/M
3300027905|Ga0209415_10376760Not Available1162Open in IMG/M
3300027905|Ga0209415_10503088Not Available932Open in IMG/M
3300027905|Ga0209415_10791416Not Available662Open in IMG/M
3300030007|Ga0311338_10491430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1290Open in IMG/M
3300031236|Ga0302324_101462677Not Available890Open in IMG/M
3300031543|Ga0318516_10844002Not Available517Open in IMG/M
3300031546|Ga0318538_10831950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300031708|Ga0310686_100423945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12490Open in IMG/M
3300031708|Ga0310686_117922389Not Available672Open in IMG/M
3300031713|Ga0318496_10693954All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031715|Ga0307476_10392134Not Available1025Open in IMG/M
3300031740|Ga0307468_101988383All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031753|Ga0307477_10216683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1330Open in IMG/M
3300031769|Ga0318526_10370902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300031778|Ga0318498_10159402All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300031782|Ga0318552_10562104Not Available582Open in IMG/M
3300031823|Ga0307478_11312467Not Available601Open in IMG/M
3300031860|Ga0318495_10545359Not Available504Open in IMG/M
3300031897|Ga0318520_10780042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300032067|Ga0318524_10188760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1051Open in IMG/M
3300032074|Ga0308173_11112673All Organisms → cellular organisms → Bacteria → Terrabacteria group736Open in IMG/M
3300032783|Ga0335079_10077863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3769Open in IMG/M
3300032892|Ga0335081_11306100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300032893|Ga0335069_12210648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia miyunensis575Open in IMG/M
3300033475|Ga0310811_10098546All Organisms → cellular organisms → Bacteria3792Open in IMG/M
3300033547|Ga0316212_1005963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1768Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.23%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.08%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.08%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.08%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.08%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil3.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.54%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.77%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.77%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.77%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.77%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001452Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1016461823300000567Peatlands SoilALPAPFHSADKVLGYGAGLAALWYVGALFWRLRKGTAGVKPVDELIDR*
JGI20203J14952_104062223300001452Arctic Peat SoilLIMVVLSFPAPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVDKP*
JGI12627J18819_1028467813300001867Forest SoilLSFPAPFHGSDKMLGYALALAALWYFSCLLWRLRKGTAGVKPVSDLVDRL*
Ga0068869_10042223013300005334Miscanthus RhizosphereVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0070680_10023495043300005336Corn RhizosphereSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0068868_10005532753300005338Miscanthus RhizosphereLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0008090_1461678213300005363Tropical Rainforest SoilPAPFHGSDKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLAEPPSD*
Ga0070709_1080061813300005434Corn, Switchgrass And Miscanthus RhizosphereDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPIEDLASMSRHES*
Ga0070709_1118840013300005434Corn, Switchgrass And Miscanthus RhizosphereGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELASTPPSEP*
Ga0070714_10066621213300005435Agricultural SoilVLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELVSTPPSEP*
Ga0070713_10168476323300005436Corn, Switchgrass And Miscanthus RhizospherePFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELADQSQP*
Ga0070706_10074189813300005467Corn, Switchgrass And Miscanthus RhizosphereGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0070730_1028485613300005537Surface SoilVLGYGAALAALWYFGGLLRRLRKGTAGVRPVEELTGRPEP*
Ga0070733_1059044523300005541Surface SoilYGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDADG*
Ga0070732_1015406213300005542Surface SoilGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDADG*
Ga0068857_10099800723300005577Corn RhizospherePFHGSDKMLGYALALAALWYFSGLLWRLRKGTAGVKPVSDLVDRR*
Ga0068854_10196151023300005578Corn RhizosphereLAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG*
Ga0070762_1130416213300005602SoilLAALWYFGGLMWRLRKGTAGVKPVDDLVDTQPTIR*
Ga0070763_1021368123300005610SoilFHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPISDLGDRS*
Ga0068856_10010975143300005614Corn RhizosphereDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR*
Ga0066903_10707696823300005764Tropical Forest SoilPFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLVDAPPPAG*
Ga0068860_10009095113300005843Switchgrass RhizospherePAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0080026_1006512723300005952Permafrost SoilDKVLLYGFILAVLWYAGALYRRLKAGTAGVKPIDDFID*
Ga0070717_1078994623300006028Corn, Switchgrass And Miscanthus RhizosphereLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG*
Ga0070712_10063770523300006175Corn, Switchgrass And Miscanthus RhizosphereLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG*
Ga0070712_10149289223300006175Corn, Switchgrass And Miscanthus RhizosphereKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELVSTPPSEP*
Ga0074057_1002434113300006605SoilLPAPFHGADKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLIQGPPQAG*
Ga0079222_1042285033300006755Agricultural SoilSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELASAPPPEP*
Ga0079221_1024608143300006804Agricultural SoilSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG*
Ga0075425_10076409323300006854Populus RhizosphereGLVLAALWYFGGLLWRLKKGTAGVKPVEELASTPPSEP*
Ga0105250_1026077623300009092Switchgrass RhizosphereFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH*
Ga0105248_1339416823300009177Switchgrass RhizosphereSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG*
Ga0116214_132118923300009520Peatlands SoilFHGADKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLVAPPPDR*
Ga0116221_124797923300009523Peatlands SoilSLPAPFHGADKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLIAPPDR*
Ga0105237_1197781323300009545Corn RhizosphereVPAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE*
Ga0105238_1242986923300009551Corn RhizosphereVSAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE*
Ga0116135_130611223300009665PeatlandGYGVVLAALWYFGGLLWRLKKGTAGVKPVEELTGRSE*
Ga0116215_115921113300009672Peatlands SoilLAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP*
Ga0116217_1053810523300009700Peatlands SoilVLSLPAPFHGADKVLGYGLALAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP*
Ga0116223_1022567423300009839Peatlands SoilPAPFHSADKVLGYGAGLAALWYVGALVWRLRKGTAGVKPVDELIDR*
Ga0126380_1024457523300010043Tropical Forest SoilLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLADPPSPDR*
Ga0126372_1204051423300010360Tropical Forest SoilAPFHGSDKVLGYGIGLAALWYFGALLWRLRRGTAGVKPVDELVD*
Ga0134125_1098855933300010371Terrestrial SoilSTFHGSDKVLLYGAGVAALWYFAALLWRLRSGTAGVKPVEDLLD*
Ga0134125_1219172413300010371Terrestrial SoilLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG*
Ga0134128_1171831013300010373Terrestrial SoilGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG*
Ga0134126_1053760213300010396Terrestrial SoilLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLARASQQES*
Ga0126350_1057567213300010880Boreal Forest SoilSPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVGKP*
Ga0137393_1175767123300011271Vadose Zone SoilFPAPFHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPLSDLVDRP*
Ga0137381_1035882913300012207Vadose Zone SoilVLSLPAPFHGSDKVLGYGLALAALWYFGGLLRRLKKGTAGVKPVENLVQGPPKAG*
Ga0137379_1003755463300012209Vadose Zone SoilADKVLGYGLALAALWYFGGLLRRLRNGTAGVKPVEDLVDAPPAREP*
Ga0137375_1143618323300012360Vadose Zone SoilVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG*
Ga0157328_102969323300012478Arabidopsis RhizosphereMLVLSLPAPFHGSDRVLGYGLALAALWYFGALLWRLKKGTAGVKPVEDLVDRQH*
Ga0137413_1177883113300012924Vadose Zone SoilAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG*
Ga0164303_1061216513300012957SoilLVLSLPAPFHGSDKVLGYGLVLSALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG*
Ga0126369_1184624113300012971Tropical Forest SoilGSDKVLGYGLVVAALWYFGGLLWRLKKGTAGVKPVEELAERSE*
Ga0157371_1046638823300013102Corn RhizosphereFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGRH*
Ga0157369_1012855433300013105Corn RhizosphereVSATFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE*
Ga0157372_1138985523300013307Corn RhizosphereAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH*
Ga0132256_10336247323300015372Arabidopsis RhizospherePAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAGPSPD*
Ga0182032_1169404923300016357SoilSLPTPFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG
Ga0187783_1114150823300017970Tropical PeatlandGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVESLVDTDQ
Ga0187782_1093280723300017975Tropical PeatlandVVLSFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEALVDQDG
Ga0187805_1027619523300018007Freshwater SedimentPAPFHGADKVLGYGAILAALWYFGGLIWRLRRGTAGVRPVDELVE
Ga0187805_1059909823300018007Freshwater SedimentLVLSLPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLIDANG
Ga0187766_1021724333300018058Tropical PeatlandLSLPAPFHGADKVMGYVLAVAAAWYFGGLLWRLKKGTAGVKPVEDLVDRPTP
Ga0187784_1006617743300018062Tropical PeatlandGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLIDTNG
Ga0187784_1048994923300018062Tropical PeatlandGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDQDG
Ga0187784_1106683223300018062Tropical PeatlandSFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEALVDQDG
Ga0066667_1058781113300018433Grasslands SoilAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDRNH
Ga0210404_1007587713300021088SoilLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG
Ga0210404_1021571743300021088SoilLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG
Ga0210385_1035572333300021402SoilGYGLALAALWYFGGLLRRLKNGTAGVKPLSDLADEP
Ga0210397_1127464013300021403SoilKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG
Ga0210389_1013591113300021404SoilLGYGLVLAALWYFGGLLWRLKKGTAGIKPVEDLVQDPPQAG
Ga0210394_1017561613300021420SoilYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG
Ga0210384_1059310313300021432SoilLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG
Ga0210392_1148510023300021475SoilPSPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVGKP
Ga0210398_1093096823300021477SoilFPAPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVGDLVDKP
Ga0126371_1272945423300021560Tropical Forest SoilFHGADKVIGYGAGLAAIWYFAALLWRLRNGTAGVKPVDELIE
Ga0224712_1025088133300022467Corn, Switchgrass And Miscanthus RhizosphereLVLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0247794_1016789013300024055SoilLALAALWYFGGLLRRLRKGTAGVKPVEDLVQGPPQAG
Ga0247693_100537413300024181SoilLVLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH
Ga0247687_104122623300024286SoilGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH
Ga0179589_1004779123300024288Vadose Zone SoilFHGSDRMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLIDRP
Ga0247678_105366313300024325SoilKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0207692_1010003933300025898Corn, Switchgrass And Miscanthus RhizospherePAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR
Ga0207692_1013616243300025898Corn, Switchgrass And Miscanthus RhizosphereLAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0207699_1043574223300025906Corn, Switchgrass And Miscanthus RhizospherePFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG
Ga0207693_1043301443300025915Corn, Switchgrass And Miscanthus RhizosphereSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0207652_1060670213300025921Corn RhizosphereLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0207694_1026753543300025924Corn RhizosphereSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG
Ga0207700_1023304433300025928Corn, Switchgrass And Miscanthus RhizosphereVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR
Ga0207664_1020817533300025929Agricultural SoilLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR
Ga0207664_1088061323300025929Agricultural SoilMLVLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG
Ga0207664_1095400923300025929Agricultural SoilDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG
Ga0207703_1145992523300026035Switchgrass RhizosphereIMVVLSFPAPFHGSDKMLGYALALAALWYFSGLLWRLRKGTAGVKPVSDLVDRR
Ga0207702_1202428423300026078Corn RhizospherePAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLARASQPES
Ga0207675_10185200213300026118Switchgrass RhizosphereLAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPPAG
Ga0208565_105921223300027662Peatlands SoilDKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLVAPPPDR
Ga0209178_101122913300027725Agricultural SoilGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLLQGRPPSG
Ga0208989_1027138413300027738Forest SoilLSFPAPFHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPLSDLVDRP
Ga0209177_1006464313300027775Agricultural SoilVPAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE
Ga0209579_1005615543300027869Surface SoilSFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDANG
Ga0209415_1021646233300027905Peatlands SoilGADKVLGYGLALAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP
Ga0209415_1037676013300027905Peatlands SoilMVVLSFPSPFHGADKVLGYGLALAALWYFGGLLWRLRAGTAGVKPVEDLVDADG
Ga0209415_1050308813300027905Peatlands SoilMVVLSFPSPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDADV
Ga0209415_1079141613300027905Peatlands SoilGADKVLGYGLALAALWYFGGLVWRLKNGTAGVKPVEDLIAPPPARQP
Ga0311338_1049143033300030007PalsaGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVVDLVDKP
Ga0302324_10146267713300031236PalsaDKMLGYALVLAALWYFGGLLRRLKNGTAGVKPVSDLADKP
Ga0318516_1084400223300031543SoilYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPAG
Ga0318538_1083195013300031546SoilVLGYGLVLAALWYFGGLIWRLKKGTAGVKPVEDLLGPPSP
Ga0310686_10042394593300031708SoilDKMLGYALALAALWYFGGLLRRLRNGTAGVKPVTDLADKP
Ga0310686_11792238913300031708SoilADKVLGYGLVLAALWYFGGLLWRLRRGEAGVKPLDDLTD
Ga0318496_1069395423300031713SoilGSDKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLAEPPSSD
Ga0307476_1039213413300031715Hardwood Forest SoilDKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDANG
Ga0307468_10198838313300031740Hardwood Forest SoilGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGR
Ga0307477_1021668313300031753Hardwood Forest SoilVLSLPAPFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLVDAPPPVG
Ga0318526_1037090223300031769SoilMLILSLPTPFHGADKVLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG
Ga0318498_1015940223300031778SoilLALAALWYFGGLLWRLRKGTAGVKPVEDLAGPPSSD
Ga0318552_1056210423300031782SoilVLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPAG
Ga0307478_1131246713300031823Hardwood Forest SoilVLGYGLAVAAAWYFGGLLWRLRKGTAGVRPVEDLLDASRR
Ga0318495_1054535923300031860SoilLIMIVLSFPAPFHGADKVLGYGLGLAALWYFGGLLWRLRNGTAGVKPVEDLLDKDG
Ga0318520_1078004223300031897SoilKVLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG
Ga0318524_1018876033300032067SoilTGDDLALAPTPFHGADKVLGYGLAVAAAWYFGGLLWRLKKGTAGVKPVEDLVDRPRP
Ga0308173_1111267313300032074SoilVLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQPPPEAV
Ga0335079_1007786353300032783SoilAPFHGSDKVLGYGLVLAALWYFGGLLWRLRKGTAGVKPVEDLASPPPAG
Ga0335081_1130610023300032892SoilPFHGSDKVLGYGLVLAALWYFGGLLWRLRKGTAGVKPVEDLAEPPPSD
Ga0335069_1221064813300032893SoilSDRVLGYGLALAALWYFGGLLWRLKKGTAGVKPISDLVDRP
Ga0310811_1009854613300033475SoilMLGYALALAALWYFGALLWRLRKGTAGVKPVSELVDRP
Ga0316212_100596323300033547RootsLIMVVLSFPAPFHGSDRMLGYALALAALWYFSVLLWRLRKGTAGVKPVSDLVDRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.