NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062780

Metagenome / Metatranscriptome Family F062780

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062780
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 149 residues
Representative Sequence LIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Number of Associated Samples 108
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 73.85 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.231 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(37.692 % of family members)
Environment Ontology (ENVO) Unclassified
(73.846 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.69%    β-sheet: 3.45%    Coil/Unstructured: 55.86%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006419|Ga0075496_1379718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Pseudovibrio → unclassified Pseudovibrio → Pseudovibrio sp. JE062568Open in IMG/M
3300006424|Ga0075497_1516513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300008993|Ga0104258_1114295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300009071|Ga0115566_10313193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300009071|Ga0115566_10383149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300009077|Ga0115552_1165682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300009193|Ga0115551_1191989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300009432|Ga0115005_10668988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300009442|Ga0115563_1186912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani805Open in IMG/M
3300009445|Ga0115553_1202697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300009476|Ga0115555_1222633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300009505|Ga0115564_10261740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani877Open in IMG/M
3300009592|Ga0115101_1544253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300009599|Ga0115103_1056923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300009599|Ga0115103_1788875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300009606|Ga0115102_10330042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300009606|Ga0115102_10721910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300009606|Ga0115102_10762094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300009608|Ga0115100_10248540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300009677|Ga0115104_10462701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300009677|Ga0115104_10759773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300010404|Ga0129323_1044858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300010987|Ga0138324_10600733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300012417|Ga0138262_1506821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300012472|Ga0129328_1001727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300012504|Ga0129347_1043515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300012516|Ga0129325_1017570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300012518|Ga0129349_1205500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300012520|Ga0129344_1388070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300012522|Ga0129326_1281881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300012523|Ga0129350_1276195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300012524|Ga0129331_1034083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300012528|Ga0129352_10271686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300012782|Ga0138268_1319899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300012966|Ga0129341_1203057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300012969|Ga0129332_1011449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300016732|Ga0182057_1118957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300018426|Ga0181566_10518022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300018692|Ga0192944_1045384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300018714|Ga0193349_1053463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300018724|Ga0193391_1046185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300018742|Ga0193138_1046298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300018742|Ga0193138_1046468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300018745|Ga0193000_1072713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300018765|Ga0193031_1054718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300018787|Ga0193124_1071444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300018831|Ga0192949_1112832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018832|Ga0194240_1019840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300018832|Ga0194240_1020852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300018842|Ga0193219_1058570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300018874|Ga0192977_1098797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300018874|Ga0192977_1102081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300018899|Ga0193090_1145570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300018899|Ga0193090_1145579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300018905|Ga0193028_1116532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300018926|Ga0192989_10173762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300018932|Ga0192820_10121588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018932|Ga0192820_10177525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018967|Ga0193178_10064483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300018967|Ga0193178_10080449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018980|Ga0192961_10183853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300018980|Ga0192961_10230144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300018982|Ga0192947_10209086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300018989|Ga0193030_10195334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300018989|Ga0193030_10251381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019010|Ga0193044_10204203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300019021|Ga0192982_10280560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300019032|Ga0192869_10447343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300019032|Ga0192869_10460012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300019032|Ga0192869_10474463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300019036|Ga0192945_10292284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300019045|Ga0193336_10572787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300019048|Ga0192981_10354606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300019095|Ga0188866_1026281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300019095|Ga0188866_1029203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300019116|Ga0193243_1031762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300019116|Ga0193243_1038302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300019149|Ga0188870_10137021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300019150|Ga0194244_10047912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300019153|Ga0192975_10289953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300019262|Ga0182066_1372955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019272|Ga0182059_1164423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300019276|Ga0182067_1041093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300021353|Ga0206693_1504192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300021365|Ga0206123_10227590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani818Open in IMG/M
3300021872|Ga0063132_106443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300021872|Ga0063132_119473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300021930|Ga0063145_1051263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300021941|Ga0063102_1064930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300021950|Ga0063101_1126753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300025640|Ga0209198_1146434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300025680|Ga0209306_1090336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300025690|Ga0209505_1098424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300025712|Ga0209305_1101197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300025830|Ga0209832_1189429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300026448|Ga0247594_1103875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300026495|Ga0247571_1145059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300027771|Ga0209279_10264434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300028137|Ga0256412_1254738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300028137|Ga0256412_1383406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300028282|Ga0256413_1258083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300028282|Ga0256413_1258950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300028290|Ga0247572_1107045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300028290|Ga0247572_1125863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300030721|Ga0308133_1054589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300030724|Ga0308138_1054880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300030954|Ga0073942_11326840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300031032|Ga0073980_11393601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300031037|Ga0073979_12315504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300031579|Ga0308134_1148433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300031622|Ga0302126_10160861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani827Open in IMG/M
3300031622|Ga0302126_10255056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300031725|Ga0307381_10369370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300031750|Ga0307389_11210351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300032463|Ga0314684_10767668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300032470|Ga0314670_10609444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300032481|Ga0314668_10690749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300032517|Ga0314688_10732905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300032518|Ga0314689_10625907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300032519|Ga0314676_10788119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300032615|Ga0314674_10574954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300032617|Ga0314683_10777243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300032707|Ga0314687_10848804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300032711|Ga0314681_10739383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300032714|Ga0314686_10569107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300032727|Ga0314693_10781835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300032732|Ga0314711_10587879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300032749|Ga0314691_10276755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300032752|Ga0314700_10725893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300032755|Ga0314709_10887048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine37.69%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.08%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater12.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine10.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.15%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.31%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.54%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.77%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.77%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018714Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075496_137971813300006419AqueousKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0075497_151651313300006424AqueousISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKDDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0104258_111429513300008993Ocean WaterLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115566_1031319313300009071Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH*
Ga0115566_1038314913300009071Pelagic MarineMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKDDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0115552_116568213300009077Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH*
Ga0115551_119198913300009193Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH*
Ga0115005_1066898813300009432MarinePKTPKPLKNEISLSSRSVVVVFYIILIKMKYTLIISALLASTSAIKLEQEFSSSSRDPKKPDYYPFEDGFSGHWSYTRTEPENYQGAGSGDDQFMNSMIMNYAMESATKEGVPTGNFYFTHLTAFTAASEVIKTHLGLEGKAADDYLDQYFDKTWDHFNTADDGKIEVARMGGFFRFLCANMQVVLH*
Ga0115563_118691213300009442Pelagic MarineMPNNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0115553_120269713300009445Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115555_122263313300009476Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH*
Ga0115564_1026174013300009505Pelagic MarineMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0115101_154425313300009592MarineKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0115103_105692313300009599MarineTLIVSALLAGASAIKLEQEFSSSTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115103_178887513300009599MarineNNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0115102_1033004213300009606MarineMKYTLIVSALLARASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115102_1072191013300009606MarineIKMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKDDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0115102_1076209413300009606MarineMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0115100_1024854013300009608MarineFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMSYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115104_1046270113300009677MarineIVSALLAGASAIKLEQEFSSSTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH*
Ga0115104_1075977313300009677MarineMKYTLIVSALLASVSAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFDKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH*
Ga0129323_104485823300010404AqueousKMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0138324_1060073313300010987MarineVLVLLASSTSAIKFSSTTRDPKKPDYYPFEDGFEGHWSYNRVAPEHFDGPGTGDDQFMNSMIMNYAMESATKEGVPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH*
Ga0138262_150682113300012417Polar MarineLIISALLAGTSAISLERKGDFHPFEDGFEGHWTYNRVTPDNFDGPGTGDDQFMNSMVSKYAMESADKEGVPSGLFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFEKTWEHFDTANDGKIETARMSGFFRFLCANMQINLH*
Ga0129328_100172713300012472AqueousMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0129347_104351513300012504AqueousMKYTLIISALLASTSAIKLENEFSSTTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFTASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0129325_101757023300012516AqueousKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAIEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0129349_120550013300012518AqueousSTSAIKLENEFSSTTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFTASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0129344_138807013300012520AqueousYTLIISALLASTSAIKLENEFSSTTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFTASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0129326_128188113300012522AqueousMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGNAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0129350_127619513300012523AqueousIKMKYTLIISALLASTSAIKLENEFSSTTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0129331_103408313300012524AqueousLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0129352_1027168613300012528AqueousIISALLASTSAIKLENEFSSTTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0138268_131989913300012782Polar MarineMPNNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH*
Ga0129341_120305713300012966AqueousMKYTLIISALLASTSAIKLENEFSSNTRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFTASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH*
Ga0129332_101144913300012969AqueousLIKIKMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH*
Ga0182057_111895713300016732Salt MarshSTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH
Ga0181566_1051802213300018426Salt MarshMKYTLIISALLASTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH
Ga0192944_104538413300018692MarineMGNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0193349_105346313300018714MarineMKYLCLALLASSASAIKFSSTTRDPKKPDYYPFEDGFEGHWSYTRVEPEHFQGAGSGDDQFMNSMIMNYAMESATPAGVPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVTLH
Ga0193391_104618513300018724MarineFSSSSRDPKKPDYYPFEDGFEGHWTYNRVAPEHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVTLH
Ga0193138_104629813300018742MarineKYFVLALLASSTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0193138_104646813300018742MarineIIKMKYSFVIAALASASAVELTHLGVHDGPYYPFQDGFEGHWSYNRAAPDHFDGPGSGDDQFMNSMITKYAMEAAAKDGSPSGDFYFNHITAFEAAKEILETHLGLKGKDADDYLDKYFEKTWEHFDTASDGKIETARMSGFFRFLCANMQIVLH
Ga0193000_107271313300018745MarineKPDYYPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMIMNYAMEAATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0193031_105471813300018765MarineMKYTLIISALLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFTAAKEILDTHLGLKGKDADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0193124_107144413300018787MarineFSSSSRDPKKPDYYPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMIMNYAMEAATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0192949_111283213300018831MarineLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0194240_101984013300018832MarineMKYTLIVSALLASVSAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFDKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0194240_102085213300018832MarineMKYTLIISALLASTSAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYNRVAPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGQFYFNHITAFTAAAEILKTHLGLEGKDADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQINLH
Ga0193219_105857013300018842MarineKYTLIISALLASASAVKIEQKFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESAKPDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192977_109879713300018874MarineNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0192977_110208113300018874MarineIKMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0193090_114557013300018899MarineMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0193090_114557913300018899MarineMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0193028_111653213300018905MarineLLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFTAAKEILDTHLGLKGKDPDDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192989_1017376213300018926MarineISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0192820_1012158813300018932MarineMKYTLIVSALLASVSAIKIEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQIVLH
Ga0192820_1017752513300018932MarineKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESAKPDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQIVLH
Ga0193178_1006448313300018967MarineLLATSTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYTRTAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFSHITAFNAAYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVNLH
Ga0193178_1008044913300018967MarineSSSRNPKKPDYYPFEDGFEGHWSYERKSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192961_1018385313300018980MarineMGNNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0192961_1023014413300018980MarineIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0192947_1020908613300018982MarineMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGAGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMSGFFRFLCANMQITLH
Ga0193030_1019533413300018989MarineHGNNINYKLRMKYFVLALLASSTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0193030_1025138113300018989MarineLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGQFYFNHITAFTAAAEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQINLH
Ga0193044_1020420313300019010MarineMKYTLIISALLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFTAAKEILDTHLGLKGKDADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192982_1028056013300019021MarineHGLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0192869_1044734313300019032MarineTWDPKKPDYYPFEDGFEGHWSYERKSPEHFDGAGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGGFFRFLCANMQITLH
Ga0192869_1046001213300019032MarineKPDYYPFEDGFEGHWSYTRVNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0192869_1047446313300019032MarineMKYFSVLALLATSTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYTRSAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFSHITAFNAAYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0192945_1029228413300019036MarineGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGSFYFNHITAFTAAKEILDTHLGLKGKDADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQINLH
Ga0193336_1057278713300019045MarineSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192981_1035460613300019048MarineFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0188866_102628113300019095Freshwater LakeIKMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH
Ga0188866_102920313300019095Freshwater LakeLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH
Ga0193243_103176213300019116MarineMKYTLIISALLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDVQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFTAAKEILDTHLGLKGKDADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0193243_103830213300019116MarineMGNNINYKIRMKYFVLALLASSTSAIKFSSSTRDPKKPDYYPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0188870_1013702113300019149Freshwater LakeKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH
Ga0194244_1004791213300019150MarineMKYTLIISALLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTENFYFNHITAFTAAKEILDTHLGLKGKDADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0192975_1028995313300019153MarineLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0182066_137295513300019262Salt MarshSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH
Ga0182059_116442313300019272Salt MarshISALLASTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH
Ga0182067_104109323300019276Salt MarshIISALLASTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYERKAPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGQFYFNHMTAFQASYEILKTHLGLEGKAADDYLDKYFEKTWEHFNTADDGKIEVARMGGFFRFLCANMQINLH
Ga0206693_150419213300021353SeawaterMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0206123_1022759013300021365SeawaterMKFSLIISALVATSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGSGDDQFMNSMISKYAMEAADKNDQPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTANDGKIETARMGGFFRFLCANMQINLH
Ga0063132_10644313300021872MarineSALLASTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPDHFDGAGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFTAAKEILDTHLGLKGKDADDYLDKYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQITLH
Ga0063132_11947313300021872MarineLIISALLAATSAIKIERSGDFHPFEDGFEGHWTYHRSAPEHFDGPGSGDDQFMNSMISKYAMEKADKDNNPTGEFYFNHITAFTAADEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIEVARMGGFFRFLCANMQINLH
Ga0063145_105126313300021930MarineFSVLALLATSTSAIKLENEFSSSSRDPKKPDYYPFEDGFEGHWSYTRSSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFSHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0063102_106493013300021941MarineIISALLASTSAIKLEQEFSSSSRDPKKPDYYPFEDGFSGHWSYTRTEPENYQGAGSGDDQFMNSMIMNYAMESATKEGVPTGNFYFTHLTAFTAASEVIKTHLGLEGKAADDYLDQYFDKTWDHFNTADDGKIEVARMGGFFRFLCANMQVVLH
Ga0063101_112675313300021950MarineYTLIISALLASTSAIKLEQEFSSSSRDPKKPDYYPFEDGFSGHWSYTRTEPENYQGAGSGDDQFMNSMIMNYAMESATKEGVPTGNFYFTHLTAFTAASEVIKTHLGLEGKAADDYLDQYFDKTWDHFNTADDGKIEVARMGGFFRFLCANMQVVLH
Ga0209198_114643413300025640Pelagic MarineEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINL
Ga0209306_109033613300025680Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0209505_109842413300025690Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH
Ga0209305_110119713300025712Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQINLH
Ga0209832_118942913300025830Pelagic MarineMKYTLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESASKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWEHFDTAGDGKIEPERMGGFYRFLCGNMQITLH
Ga0247594_110387513300026448SeawaterPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0247571_114505913300026495SeawaterSTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0209279_1026443413300027771MarineRKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0256412_125473823300028137SeawaterKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0256412_138340613300028137SeawaterTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0256413_125808313300028282SeawaterISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0256413_125895013300028282SeawaterYTLIVSALLAGASAIKLEQEFSSSTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0247572_110704513300028290SeawaterMKYTLIVSALLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMGGFFRFLCANMQITLH
Ga0247572_112586313300028290SeawaterNNNYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMEAADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0308133_105458913300030721MarineSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0308138_105488013300030724MarineIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0073942_1132684013300030954MarineLIVSALLAGASAIKLEQEFSSSSRNPKKPDYYPFEDGFEGHWSYERKSPEHFDGAGSGDDQFMNSMIMNYAMESATKDGTPLGEFYFNHMTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGGFFRFLCANMQITLH
Ga0073980_1139360113300031032MarineMKYFVLALLASSTSAIKFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVNLH
Ga0073979_1231550423300031037MarineFSSSSRDPKKPDYYPFEDGFEGHWTYNRVSPEHFDGPGSGDDQFMNSMIMNYAMESATKDGTPTGNFYFNHITAFNAAYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIEVARMGSFFRFLCANMQVVLH
Ga0308134_114843313300031579MarineSALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0302126_1016086113300031622MarineMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0302126_1025505613300031622MarineMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVAPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLNLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0307381_1036937013300031725MarineAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGPGSGDDQFMNSMIMNNAMESATKDGTPLGEFYFNHLTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMSGFFRFLCANMQITLH
Ga0307389_1121035113300031750MarineLAGASAIKLEQEFSSTTRDPKKPDYYPFEDGFEGHWSYERKNPEHFDGAGSGDDQFMNSMIMNNAMESATKDGTPLGEFYFNHLTAFQASYEILKTHLGLEGKAADDYLDQYFEKTWDHFNTADDGKIETARMSGFFRFLCANMQITLH
Ga0314684_1076766813300032463SeawaterPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314670_1060944413300032470SeawaterKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314668_1069074913300032481SeawaterYIKMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLHWLSLA
Ga0314688_1073290513300032517SeawaterKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314689_1062590713300032518SeawaterLIISALLASTSAISLERNGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314676_1078811913300032519SeawaterKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314674_1057495413300032615SeawaterYIKMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314683_1077724313300032617SeawaterYKIKMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314687_1084880413300032707SeawaterKMKYSLIISALVASSSAISLERKGYFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFKQITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314681_1073938313300032711SeawaterYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314686_1056910713300032714SeawaterLIISALLASTSAISLERKGDFHPFENGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFLRFLCANMQINLH
Ga0314693_1078183513300032727SeawaterSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKDGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314711_1058787913300032732SeawaterFYIKMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314691_1027675523300032749SeawaterMKYSLIISALLASTSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314700_1072589313300032752SeawaterIKMKYSLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH
Ga0314709_1088704813300032755SeawaterLIISALVASSSAISLERKGDFHPFEDGFEGHWTYNRVTPEHFDGPGTGDDQFMNSMISNYAMESADKEGNPTGQFYFNHITAFTAASEILKTHLGLEGKAADDYLDKYFDKTWEHFDTASDGKIETARMGGFFRFLCANMQINLH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.