NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062770

Metagenome / Metatranscriptome Family F062770

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062770
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 49 residues
Representative Sequence MYMQTSQYFICKQDKHRVKHSTLADYCDMIVDGVSTEDEHFKENVV
Number of Associated Samples 114
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 83.85 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.308 % of family members)
Environment Ontology (ENVO) Unclassified
(61.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(61.538 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.51%    β-sheet: 8.11%    Coil/Unstructured: 78.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF03796DnaB_C 76.15
PF13479AAA_24 4.62
PF13155Toprim_2 1.54
PF09601DUF2459 0.77
PF07460NUMOD3 0.77
PF03819MazG 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 76.15
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 76.15

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.46 %
UnclassifiedrootN/A1.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10087540All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1158Open in IMG/M
3300000928|OpTDRAFT_10045003All Organisms → Viruses → Predicted Viral4020Open in IMG/M
3300000949|BBAY94_10022130All Organisms → Viruses → Predicted Viral1783Open in IMG/M
3300001351|JGI20153J14318_10000037All Organisms → cellular organisms → Bacteria89257Open in IMG/M
3300002226|M1t6FKB2_1438816All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium763Open in IMG/M
3300003754|Ga0005853_1074409All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium806Open in IMG/M
3300005239|Ga0073579_1020986All Organisms → Viruses → Predicted Viral1897Open in IMG/M
3300005589|Ga0070729_10316022All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium877Open in IMG/M
3300005600|Ga0070726_10481379All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium626Open in IMG/M
3300005609|Ga0070724_10092604All Organisms → Viruses → Predicted Viral1305Open in IMG/M
3300006467|Ga0099972_13244984All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium659Open in IMG/M
3300006734|Ga0098073_1038046All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium661Open in IMG/M
3300006734|Ga0098073_1040215All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium639Open in IMG/M
3300006752|Ga0098048_1076022All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1030Open in IMG/M
3300006790|Ga0098074_1010573All Organisms → Viruses → Predicted Viral3035Open in IMG/M
3300006793|Ga0098055_1109275All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1078Open in IMG/M
3300006810|Ga0070754_10285777All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium744Open in IMG/M
3300006922|Ga0098045_1126794All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium594Open in IMG/M
3300006928|Ga0098041_1194484All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium650Open in IMG/M
3300007538|Ga0099851_1082558All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1236Open in IMG/M
3300007540|Ga0099847_1023544All Organisms → Viruses → Predicted Viral1996Open in IMG/M
3300007555|Ga0102817_1102063All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium631Open in IMG/M
3300008999|Ga0102816_1136419All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium757Open in IMG/M
3300008999|Ga0102816_1182987All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium653Open in IMG/M
3300009149|Ga0114918_10209579All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300009172|Ga0114995_10062181All Organisms → Viruses → Predicted Viral2115Open in IMG/M
3300009172|Ga0114995_10838495All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium504Open in IMG/M
3300009420|Ga0114994_10436515All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium865Open in IMG/M
3300009438|Ga0115559_1312847All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium550Open in IMG/M
3300009505|Ga0115564_10618657All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium509Open in IMG/M
3300010149|Ga0098049_1165203All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium683Open in IMG/M
3300010153|Ga0098059_1209540All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium757Open in IMG/M
3300010153|Ga0098059_1230694All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium716Open in IMG/M
3300010883|Ga0133547_11326676All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300011118|Ga0114922_11409872All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium561Open in IMG/M
3300011261|Ga0151661_1155952All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium709Open in IMG/M
3300012954|Ga0163111_10296399All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1435Open in IMG/M
3300013099|Ga0164315_11337353All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium564Open in IMG/M
3300013101|Ga0164313_11434672All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium556Open in IMG/M
3300013372|Ga0177922_10969139All Organisms → cellular organisms → Bacteria4678Open in IMG/M
3300017719|Ga0181390_1017806All Organisms → Viruses → Predicted Viral2363Open in IMG/M
3300017728|Ga0181419_1166752All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium524Open in IMG/M
3300017735|Ga0181431_1085732All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium707Open in IMG/M
3300017755|Ga0181411_1165689All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium632Open in IMG/M
3300017770|Ga0187217_1233000All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium604Open in IMG/M
3300017777|Ga0181357_1318465All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium524Open in IMG/M
3300017781|Ga0181423_1017713All Organisms → Viruses → Predicted Viral2940Open in IMG/M
3300017786|Ga0181424_10394409All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium564Open in IMG/M
3300017958|Ga0181582_10894777All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium522Open in IMG/M
3300019122|Ga0188839_1023352All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium632Open in IMG/M
3300020165|Ga0206125_10111058All Organisms → Viruses → Predicted Viral1146Open in IMG/M
3300020182|Ga0206129_10000164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales114890Open in IMG/M
3300020191|Ga0181604_10457722All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium535Open in IMG/M
3300020352|Ga0211505_1109262All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium658Open in IMG/M
3300020417|Ga0211528_10362743All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium536Open in IMG/M
3300020421|Ga0211653_10184296All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium917Open in IMG/M
3300020442|Ga0211559_10421225All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium615Open in IMG/M
3300021368|Ga0213860_10453996All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium551Open in IMG/M
3300021958|Ga0222718_10055976All Organisms → Viruses → Predicted Viral2478Open in IMG/M
3300021959|Ga0222716_10263221All Organisms → Viruses → Predicted Viral1058Open in IMG/M
3300022068|Ga0212021_1053631All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium820Open in IMG/M
(restricted) 3300022938|Ga0233409_10174314All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium717Open in IMG/M
(restricted) 3300022938|Ga0233409_10356411All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium515Open in IMG/M
3300023081|Ga0255764_10038332All Organisms → cellular organisms → Bacteria3043Open in IMG/M
(restricted) 3300023089|Ga0233408_10113520All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium584Open in IMG/M
(restricted) 3300023089|Ga0233408_10164019All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium520Open in IMG/M
(restricted) 3300023210|Ga0233412_10188143All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium893Open in IMG/M
3300024191|Ga0228636_1005358All Organisms → cellular organisms → Bacteria3158Open in IMG/M
3300024229|Ga0233402_1081430All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium676Open in IMG/M
(restricted) 3300024259|Ga0233437_1048850All Organisms → Viruses → Predicted Viral2499Open in IMG/M
3300024262|Ga0210003_1196348All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium830Open in IMG/M
3300024262|Ga0210003_1299413All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium616Open in IMG/M
3300024281|Ga0228610_1032013All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium681Open in IMG/M
3300024289|Ga0255147_1107112All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium511Open in IMG/M
3300024326|Ga0228652_1138184All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium528Open in IMG/M
3300024334|Ga0228671_1074594All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium849Open in IMG/M
3300024415|Ga0228662_1090129All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium728Open in IMG/M
3300024432|Ga0209977_10599966All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium503Open in IMG/M
(restricted) 3300024519|Ga0255046_10126359All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1113Open in IMG/M
(restricted) 3300024519|Ga0255046_10322437All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium724Open in IMG/M
(restricted) 3300024519|Ga0255046_10458206All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium609Open in IMG/M
3300024556|Ga0256341_1077186All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium666Open in IMG/M
3300025057|Ga0208018_106028All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1925Open in IMG/M
3300025093|Ga0208794_1082407All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium552Open in IMG/M
3300025101|Ga0208159_1095136All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium539Open in IMG/M
3300025118|Ga0208790_1085015All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium939Open in IMG/M
3300025138|Ga0209634_1087575All Organisms → Viruses → Predicted Viral1412Open in IMG/M
3300025151|Ga0209645_1114433All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium862Open in IMG/M
3300025276|Ga0208814_1002481All Organisms → cellular organisms → Bacteria7922Open in IMG/M
3300025276|Ga0208814_1055206All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1140Open in IMG/M
3300025483|Ga0209557_1107955All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium561Open in IMG/M
3300025543|Ga0208303_1044145All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300027186|Ga0208797_1050174All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium526Open in IMG/M
3300027253|Ga0208680_1076464All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium577Open in IMG/M
3300027612|Ga0209037_1046350All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300027612|Ga0209037_1170650All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium524Open in IMG/M
3300027668|Ga0209482_1202336All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium549Open in IMG/M
3300027742|Ga0209121_10084363All Organisms → Viruses → Predicted Viral1417Open in IMG/M
3300027758|Ga0209379_10076784All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300027780|Ga0209502_10294839All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium700Open in IMG/M
3300027785|Ga0209246_10019137All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300027791|Ga0209830_10177473All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1005Open in IMG/M
3300027813|Ga0209090_10248456All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium900Open in IMG/M
3300027813|Ga0209090_10479773All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium583Open in IMG/M
(restricted) 3300027837|Ga0255041_10006471All Organisms → Viruses → Predicted Viral2930Open in IMG/M
3300027847|Ga0209402_10164665All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1472Open in IMG/M
(restricted) 3300027856|Ga0255054_10123859All Organisms → Viruses → Predicted Viral1279Open in IMG/M
(restricted) 3300027856|Ga0255054_10498602All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium590Open in IMG/M
(restricted) 3300027861|Ga0233415_10000073All Organisms → cellular organisms → Bacteria44039Open in IMG/M
(restricted) 3300027861|Ga0233415_10007863All Organisms → cellular organisms → Bacteria4248Open in IMG/M
(restricted) 3300027868|Ga0255053_10342140All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium723Open in IMG/M
3300027883|Ga0209713_10140639All Organisms → Viruses → Predicted Viral1639Open in IMG/M
3300027917|Ga0209536_100524746All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1477Open in IMG/M
3300027917|Ga0209536_100528363All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1471Open in IMG/M
3300027978|Ga0209165_10191107All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium704Open in IMG/M
(restricted) 3300027996|Ga0233413_10504790All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium536Open in IMG/M
3300028131|Ga0228642_1125210All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium629Open in IMG/M
3300029309|Ga0183683_1044762All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium665Open in IMG/M
3300031565|Ga0307379_10350632All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1434Open in IMG/M
3300031659|Ga0307986_10162559All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1028Open in IMG/M
3300031660|Ga0307994_1183277All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium675Open in IMG/M
3300031683|Ga0308006_10066253All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1101Open in IMG/M
3300031687|Ga0308008_1149359All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium541Open in IMG/M
3300031702|Ga0307998_1114050All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium987Open in IMG/M
3300032073|Ga0315315_10844714All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium831Open in IMG/M
3300032277|Ga0316202_10360888All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium678Open in IMG/M
3300033742|Ga0314858_008367All Organisms → Viruses → Predicted Viral2008Open in IMG/M
3300034116|Ga0335068_0047327All Organisms → cellular organisms → Bacteria2531Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.31%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater9.23%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.46%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.62%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.85%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment3.85%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.85%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.85%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.31%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.54%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.54%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.54%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.54%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.54%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.54%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.77%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.77%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.77%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.77%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.77%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.77%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.77%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.77%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001351Pelagic Microbial community sample from North Sea - COGITO 998_met_03EnvironmentalOpen in IMG/M
3300002226Marine microbial communities from the Baltic Sea - M1t6 FKB2 (106N)EnvironmentalOpen in IMG/M
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005609Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019122Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023081Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300024432Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024556Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031683Marine microbial communities from water near the shore, Antarctic Ocean - #69EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1008754013300000130MarineFICKQDKHRVKHSTLADYCDMIIEGVSTEDDHFKEKVV*
OpTDRAFT_1004500313300000928Freshwater And MarineYFICKQDKHRVKHSTLADYCDMIVEGVSTEEDHFRENVV*
BBAY94_1002213043300000949Macroalgal SurfaceMDKHKVKHSKLADYCDMIKDGVQTKQHHFKEKVV*
JGI20153J14318_1000003713300001351Pelagic MarineCKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKERVV*
M1t6FKB2_143881613300002226MarineKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV*
Ga0005853_107440913300003754Freshwater And SedimentYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIETEAKHFKENVI*
Ga0073579_102098643300005239MarineVNEYRDAGYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV*
Ga0070729_1031602223300005589Marine SedimentEYRDAQYMYMQTSQYFVCKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV*
Ga0070726_1048137913300005600Marine SedimentMQTSQYFVCKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV*
Ga0070724_1009260413300005609Marine SedimentKQDKHRVKHSTLADYCDMIIDGVETEKEHFKENVV*
Ga0099972_1324498413300006467MarineMYVNEYRDAGYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV*
Ga0098073_103804613300006734MarineKQDKHRVKHSTLADYCDMIIDGINTEEEYFKENVV*
Ga0098073_104021533300006734MarineYVNQYEENDFNYMMTSQYFIAKQDKHKVKTSTLADYCDMIVDGVSEITDNHFKEKVV*
Ga0098042_105214913300006749MarineENYEFTWDEVIDATKMYVNAYRDNDYMYMKTSQYFISKQDKSKVRTSDLADYCDMIRDGVEPDDNHFKEKVV*
Ga0098048_107602213300006752MarineREYMYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGIEPEDSHFKEKVV*
Ga0098074_101057363300006790MarineKQDKHRVKHSALADYCDMIIDGIDTEDDHFKEKVV*
Ga0098055_110927513300006793MarineWDEVIDATKMYVNEYRDREYMYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGIEPEDSHFKEKVV*
Ga0070754_1028577713300006810AqueousKQDKHKIKISELADYCDMIRDGIEDIDNYFKDTVV*
Ga0098045_112679413300006922MarineMQTSQYFISKQDKHKVKHSTLADYCDMILEGIETEDEHFKEKVV*
Ga0098041_119448433300006928MarineFISKQDKHKVKTSKLADYCDMIKDGVSTEEKHFKEKVV*
Ga0099851_108255823300007538AqueousMQNSQYFISKQDKHKVKTSKLADYCDMIRDGISTEEDHFKERVV*
Ga0099847_102354453300007540AqueousEATRMYVNEYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQQTFKEKVV*
Ga0102817_110206313300007555EstuarineTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEEKTFKEKVV*
Ga0102816_113641913300008999EstuarineKATKMYVNEYRDAQYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIETEAKHFKENVI*
Ga0102816_118298713300008999EstuarineYRDAEYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEEDHFRENVV*
Ga0114918_1020957913300009149Deep SubsurfaceQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV*
Ga0114995_1006218153300009172MarineYRDADYLYMQTSQYFISKQDKHKVKHSRLADYCDMIVDGVSTEDEHFKETVV*
Ga0114995_1083849533300009172MarineQTSQYFVCKQDKHRVKHSTLADYCDMILEGINTEDDHFKENVV*
Ga0114994_1012752433300009420MarineIKATKMYVNSYEDNQFMYMKTSQYFVAKEDKNKVKSSDLADYCDMIRDGVEPEDNHFKEKVV*
Ga0114994_1043651533300009420MarineYLYMQTSQYFISKQDKHKVKHSRLADYCDMIVDGVSTEDEHFKETVV*
Ga0115559_131284713300009438Pelagic MarineEYMYMQTSQYFISKQDKHRVKHSTLADYCDMIIDGVETEKEHFKENVV*
Ga0115564_1061865713300009505Pelagic MarineRMYVNEYRDAEYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVDGVSTEDEHFKENVV*
Ga0098049_116520313300010149MarineMNATRMYVNEYRDKEYMYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGVQIEDDHFKEKVV*
Ga0098059_120954013300010153MarineEYRDKEYMYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGVQIEDDHFKEKVV*
Ga0098059_123069413300010153MarineEYRDAQYMYMKTSQYFVAKEDKNKVKSSDLADYCDMIRDGVETEDDHFKENVV*
Ga0133547_1132667613300010883MarineNEYRDADYLYMQTSQYFICKQDKHRVKHSTLADYCDMIKEGVNTEDDHFKENVV*
Ga0114922_1140987223300011118Deep SubsurfaceLNATKMYVNEYRANNYLYMNNSQYFISKQDKHKVKTSKLSDYCDMIRDGVSTEEEHFKEKVV*
Ga0151661_115595223300011261MarineMYVNEYRDADYLYMQTSQYFISKQDKHRVKHSRLADYCDMIVDGVSTEDEHFKENVV*
Ga0163111_1029639933300012954Surface SeawaterNEYAQKDYLYMQTSQYFISKADQSKVKQSQLADYCDMIRDGVEEEDNNHFSENVV*
Ga0164315_1133735313300013099Marine SedimentMYVNEYRDAEYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEEDHFKEDVV*
Ga0164313_1143467213300013101Marine SedimentKQDKHRVKHSTLADYCDMIVEGINTEDDHFSENVV*
Ga0177922_1096913993300013372FreshwaterIKATKMYVNEYRDAQYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIETESKHFKENVI*
Ga0181390_101780643300017719SeawaterYLYMQTSQYFICKQDKHRVKHSTLADYCDMIREGVNTEGDHFKENVV
Ga0181419_116675213300017728SeawaterFICKQDKHRVKHSTLADYCDMIVEGVSTEEDHFKENVV
Ga0181431_108573233300017735SeawaterMNDNQKNNYLYMQNSQYFISKQDKHKVKTSKLADYCDMIRDGISTEDDHFKEKVV
Ga0181411_116568913300017755SeawaterRDAEYMYMQTSQYFICKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV
Ga0187217_123300013300017770SeawaterMQTSQYFISKQDKHKVKHSSLADYCDMILEGINTEDEHFKENVV
Ga0181357_131846513300017777Freshwater LakeYMYMQTSQYFICKQDKHKVKSSTLADYCDMIKDGVETESKHFKENVI
Ga0181423_101771313300017781SeawaterVMKATKMYVNEYRDADYLYMQTSQYFISKQDKHKVKHSRLADYCDLIIEGINTEDDHFKEKVV
Ga0181424_1039440913300017786SeawaterFISKQDKHKVKTSKLADYCDMIRDGISTEDDHFKEKVV
Ga0181582_1089477723300017958Salt MarshKMYVNEYRATDYKYMKTSQYFVAKQDKHRVKHSELADYCDMINDGVQTQTHHFKDKVV
Ga0188839_102335233300019122Freshwater LakeQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV
Ga0206125_1011105823300020165SeawaterNEYRDAEYLYMQTSQYFICKQDKHRVKHSTLADYCDMIREGVNTEGDHFKENVV
Ga0206129_100001641083300020182SeawaterYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV
Ga0181604_1045772213300020191Salt MarshSQYFICKQDKHRVKHSTLADYCDMMIEGINTEQEHFKENVV
Ga0211505_110926213300020352MarineSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEEKTFKEKVV
Ga0211528_1036274313300020417MarineTKMYVNEYQKNNYMYMQNSQYFISKQDKHKVKTSKLADYCDMIRDGIVNEEDHFKEKVV
Ga0211653_1018429613300020421MarineYVNEYRDKEYMYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGVQTEEDHFKEKVV
Ga0211559_1042122513300020442MarineKMYVNEFRDKEYLYMKNSQYFISKQDKNKVKHSELADYCDMIKDGIVDRPNHFKDKVV
Ga0213860_1045399623300021368SeawaterYFICKQDKHRVKHSTLADYCDMMIEGINTEQEHFKENVV
Ga0222718_1005597613300021958Estuarine WaterKMYVSEYVSTDYLYMMTSQYFISKQDKHKVKTSTLSDYCDMIRDGVQTKVEHFSDKVV
Ga0222716_1026322113300021959Estuarine WaterYFICKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV
Ga0212021_105363113300022068AqueousVNEYAQKDYLYMQTSQYFISKADQSKVKQSQLADYCDMIRDGVEEEDNNHFSENVV
(restricted) Ga0233409_1017431423300022938SeawaterVNEYRDAQYMYMQTSQYFVCKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV
(restricted) Ga0233409_1035641133300022938SeawaterQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV
Ga0255764_1003833253300023081Salt MarshFVAKQDKHRVKHSELADYCDMINDGVQTQTHHFKDKVV
(restricted) Ga0233408_1011352023300023089SeawaterDADYLYMQTSQYFISKQDKHRVKHYRLADYCDMIVDGVSTEDEHFKENVV
(restricted) Ga0233408_1016401913300023089SeawaterDYLYMQTSQYFIAKQDKHKVKTSTLSDYCDMIRDGVQTKVEHFSDKVV
(restricted) Ga0233412_1018814333300023210SeawaterKMYVNEYQKNNYLYMQNSQYFISKQDKHKVKTSKLADYCDMIRDGISTEDDHFKEKVV
Ga0228636_100535813300024191SeawaterMYVNEYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQQTFKEKVV
Ga0233402_108143023300024229SeawaterAEYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEQDHFKENVV
(restricted) Ga0233437_104885053300024259SeawaterTRMYVNEYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV
Ga0210003_119634813300024262Deep SubsurfaceYVNEYRNAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEEKTFKEKVV
Ga0210003_129941333300024262Deep SubsurfaceQYFICKQDKHKIKSSTLADYCDMIRDGIDTEERTFKEKVV
Ga0228610_103201313300024281SeawaterMYVNEYRDADYMYMQTSQYFICKQDKHRVKHSTLADYCDMIIDGVSTEDEHFKENVV
Ga0255147_110711213300024289FreshwaterDEYRANNYLYMQTSQYFIAKQDKHKVKKSALADYCDMVRDGVQIETQHFTEKVV
Ga0228652_113818423300024326SeawaterSQYFICKQDKHRVKHSTLADYCDMIIDGVSTEDEHFKENVV
Ga0228671_107459433300024334SeawaterKMYVNEYRDKEYMYMQTSQYFICKQDKHRVKHSTLADYCDMSIEGISTENEHFKENVV
Ga0228662_109012933300024415SeawaterTSQYFICKQDKHRVKHSTLADYCDMSIEGISTENEHFKENVV
Ga0209977_1059996623300024432Deep SubsurfaceMYVNEYRDKEYLYMQNSQYFISKQDKHRVKTSKLADYCDMIRDGVTTEEEHFKDKVV
(restricted) Ga0255046_1012635923300024519SeawaterYRDADYLYMQTSQYFISKQDKHRVKHSRLADYCDMIVDGVSTEDEHFKENVV
(restricted) Ga0255046_1032243713300024519SeawaterDYELSDVINATKMYVNEFRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV
(restricted) Ga0255046_1045820623300024519SeawaterYFICKQDKHKVKSSTLADYCDMIRDGIDTEEKTFKEKVV
Ga0256341_107718613300024556FreshwaterTSQYFIAKQDKHKVKKSALADYCDMVRDGVQIETQHFTEKVV
Ga0208018_10602843300025057MarineSQYDFTWDEVLGATKMYIEEYKRENYQYMQNSLYFISKQDKNKVKFSKLADYCDMIRDGYNMNNNDFFKDKIV
Ga0208794_108240713300025093MarineFISKQDKHRVKHSALADYCDMVIDGVDTEDDHFKEKVV
Ga0208159_109513613300025101MarineVNEYRDADYLYMQTSQYFISKQDKHKVKHSRLADYCDLIIEGINTEDDHFKEKVV
Ga0208790_108501513300025118MarineDKEYLYMKTSQYFIAKEGKNKVKSSDLADYCDMIRDGVQTEEDHFKEKVV
Ga0209634_108757533300025138MarineQYFICKQDKHKVKSSTLADYCDMILEGIDTEDKHFKENVV
Ga0209645_111443333300025151MarineRANDYMYMQTSQYFISKQDKHRVKHSALADYCDMVIDGVDTEDDHFKEKVV
Ga0208814_1002481113300025276Deep OceanSQYFICKQDKHRVKHSTLADYCDMVLEGVSNEDEHFKENVV
Ga0208814_105520623300025276Deep OceanMQTSQYFISKQDKHRVKHSRLADYCDMIVDGVSTEDEHFKENVV
Ga0209557_110795533300025483MarineEYQRNNYLYMQNSQYFISKQDKHKVKTSKLADYCDMIRDGITTESDHFKEKVV
Ga0208303_104414533300025543AqueousEATRMYVNEYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQQTFKEKV
Ga0208797_105017423300027186EstuarineNEYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEEKTFKEKVV
Ga0208680_107646413300027253EstuarineEYRDADYLYMQTSQYFISKQDKHRVKHSRLADYCDMIVDGVSTEDEHFKENVV
Ga0209037_104635033300027612MarineLYMMTSQYFISKQDKHKVKTSTLSDYCDMIRDGVQTKVEHFSDKVV
Ga0209037_117065023300027612MarineYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV
Ga0209482_120233613300027668MarineMQTSQYFICKQDKHRVKHSTLADYCDMIRDGIDTEEKNFKEKVV
Ga0209121_1008436333300027742MarineCKQDKHRVKHSTLADYCDMIVEGVSTEQDHFKENVV
Ga0209379_1007678413300027758Marine SedimentSKQDKHRVKHSTLADYCDMIIDGVETEKEHFKENVV
Ga0209502_1029483923300027780MarineATRMYVNEFRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV
Ga0209246_1001913713300027785Freshwater LakeAQYMYMQTSQYFICKQDKHKVKSSTLADYCDMIKDGVETESKHFKENVI
Ga0209830_1017747333300027791MarineCKQDKHRVKHSTLADYCDMILEGINTEDDHFKENVV
Ga0209090_1024845623300027813MarineDYMYMQTSQYFICKQDKHRVKHSTLADYCDMILEGVSTEDDHFKEKVV
Ga0209090_1047977333300027813MarineMQTSQYFISKQDKHKVKHSRLADYCDMIVDGVSTEDEHFKETVV
(restricted) Ga0255041_1000647153300027837SeawaterCKQDKHRVKHSTLADYCDMILEGVSTEDDHFKENVV
Ga0209402_1016466543300027847MarineYEQNDYKYMKTSQYFIAKEDKTKVKYSELADYCDMIREGLEPEQYFKEKVV
(restricted) Ga0255054_1012385933300027856SeawaterRDAGYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV
(restricted) Ga0255054_1049860213300027856SeawaterSQYFICKQDKHRVKHSTLADYCDMILEGVSTEDEYFKENVV
(restricted) Ga0233415_1000007313300027861SeawaterMQNSQYFISKQDKHKVKTSKLADYCDMIRDGISTEDDHFKEKVV
(restricted) Ga0233415_1000786373300027861SeawaterVNEYRDADYMYMQTSQYFICKQDKHRVKHSTLADYCDMIIEGVSTEDDHFKEKVV
(restricted) Ga0255053_1034214013300027868SeawaterKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKENVV
Ga0209713_1014063953300027883MarineTSQYFICKQDKHKVKHSRLADYCDMIVDGVSTEDEHFKENVV
Ga0209536_10052474623300027917Marine SedimentMNNSQYFISKQDKHKVKTSKLSDYCDMIRDGVSTEQEYFKEKVV
Ga0209536_10052836343300027917Marine SedimentREAEYLYMMTSQYFISKQDKHKVKKSTLADYCDMVRDGVISQEPKRFNEKVV
Ga0209165_1019110723300027978Marine SedimentYMYMQTSQYFISKQDKHRVKHSTLADYCDMIIDGVETEKEHFKENVV
(restricted) Ga0233413_1050479013300027996SeawaterEYSSNEYLYMQNSQFFISKQDKHRVKSSKLADYCDMIRDNVKSDDDFHFKEKVV
Ga0228642_112521033300028131SeawaterYRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQQTFKEKVV
Ga0183683_104476213300029309MarineRMNNYMYMQNSQYFISKQDKHRVKRSQLADYCDMIREGIEPDDKHFEEKVV
Ga0307379_1035063213300031565SoilTKMYVNEYRDKEYLYMQNSQYFISKQDKHKVKTSKLADYCDMIKDGVTTEEDHFKEKVV
Ga0307986_1016255943300031659MarineLYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEERTFKEKVV
Ga0307994_118327733300031660MarineMYVNEFRDAEYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTELKTFKEKVV
Ga0308006_1006625353300031683MarineRDAEYLYMQTSQYFICKQDKHRVKSSTLADYCDMIRDGIDTEESKFKEKVV
Ga0308008_114935913300031687MarineICKQDKHRVKHSTLADYCDMVLEGVSSEDEHFKENVV
Ga0307998_111405043300031702MarineDYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEEQTFKEKVV
Ga0315315_1084471423300032073SeawaterYLYMQTSQYFISKQDKHKVKHSTLADYCDMILEGIETEDEHFKEKVV
Ga0316202_1036088813300032277Microbial MatAGYMYMQTSQYFICKQDKHKVKSSTLADYCDMIRDGIDTEQKTFKEKVV
Ga0314858_008367_1839_19793300033742Sea-Ice BrineMYMQTSQYFICKQDKHRVKHSTLADYCDMIVDGVSTEDEHFKENVV
Ga0335068_0047327_2332_25083300034116FreshwaterMYVNEYRDAQYMYMQTSQYFICKQDKHKVKSSTLADYCDMIKDGIEESEAKHFKENVI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.