Basic Information | |
---|---|
Family ID | F062746 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 42 residues |
Representative Sequence | HDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 4.62 % |
% of genes near scaffold ends (potentially truncated) | 92.31 % |
% of genes from short scaffolds (< 2000 bps) | 91.54 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (82.308 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.692 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.077 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF04973 | NMN_transporter | 0.77 |
PF06067 | DUF932 | 0.77 |
PF13640 | 2OG-FeII_Oxy_3 | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.46 % |
Unclassified | root | N/A | 1.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10112270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300000882|FwDRAFT_10007858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6991 | Open in IMG/M |
3300000882|FwDRAFT_10050159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300003277|JGI25908J49247_10169742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300003499|JGI25930J51415_1082134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300004112|Ga0065166_10245771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300004773|Ga0007795_10142136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300004792|Ga0007761_11226056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300004796|Ga0007763_10745696 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
3300005517|Ga0070374_10315062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300005517|Ga0070374_10403016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300005527|Ga0068876_10150238 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
3300005527|Ga0068876_10697928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300005580|Ga0049083_10208030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300005581|Ga0049081_10132290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300005581|Ga0049081_10204666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300005662|Ga0078894_10251920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1601 | Open in IMG/M |
3300005662|Ga0078894_10771250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300005662|Ga0078894_10991676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300005941|Ga0070743_10251102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300006030|Ga0075470_10102403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300006484|Ga0070744_10186080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300007544|Ga0102861_1217634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300007545|Ga0102873_1258886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300007554|Ga0102820_1015682 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
3300007593|Ga0102918_1192690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300007606|Ga0102923_1104535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300007629|Ga0102895_1040033 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300007630|Ga0102903_1025127 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
3300007636|Ga0102856_1035732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300007716|Ga0102867_1218031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300007861|Ga0105736_1063520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300007992|Ga0105748_10526002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300008107|Ga0114340_1076036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4073 | Open in IMG/M |
3300008107|Ga0114340_1115917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
3300008107|Ga0114340_1191147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300008108|Ga0114341_10513176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300008110|Ga0114343_1150540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300008113|Ga0114346_1300807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300008116|Ga0114350_1117331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
3300008258|Ga0114840_1034403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300008448|Ga0114876_1241005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300008964|Ga0102889_1041616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
3300008996|Ga0102831_1201000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300009026|Ga0102829_1339640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300009181|Ga0114969_10488776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300009194|Ga0114983_1113636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300009419|Ga0114982_1182083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300010157|Ga0114964_10197968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300010160|Ga0114967_10513201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300010370|Ga0129336_10307007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300010885|Ga0133913_10014588 | Not Available | 20828 | Open in IMG/M |
3300010885|Ga0133913_10894437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
3300010885|Ga0133913_11665005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300012017|Ga0153801_1054823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300013005|Ga0164292_10318555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300013295|Ga0170791_12031237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
3300013372|Ga0177922_11104221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300017766|Ga0181343_1057912 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
3300017766|Ga0181343_1154563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300017785|Ga0181355_1029543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2369 | Open in IMG/M |
3300019784|Ga0181359_1075466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300020160|Ga0211733_10609879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2021 | Open in IMG/M |
3300020162|Ga0211735_10159111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300020486|Ga0208698_100906 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
3300020498|Ga0208050_1006526 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
3300020498|Ga0208050_1009349 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
3300021961|Ga0222714_10240989 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
3300021961|Ga0222714_10401879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300021962|Ga0222713_10724179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300022190|Ga0181354_1089203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300024306|Ga0255148_1010089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
3300024306|Ga0255148_1062716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300024343|Ga0244777_10000630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27401 | Open in IMG/M |
3300024346|Ga0244775_11195591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300024352|Ga0255142_1058048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300024481|Ga0256330_1018881 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
3300024573|Ga0256337_1021762 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
3300024863|Ga0255246_1005028 | All Organisms → Viruses → Predicted Viral | 2528 | Open in IMG/M |
3300025532|Ga0208249_1094651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300025585|Ga0208546_1039825 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
3300026457|Ga0255160_1018258 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
3300026566|Ga0256334_1079209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300026572|Ga0255270_1143062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300027141|Ga0255076_1074185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027156|Ga0255078_1051154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300027224|Ga0208164_1071966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300027241|Ga0208805_1052877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300027246|Ga0208931_1008768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
3300027246|Ga0208931_1012564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1814 | Open in IMG/M |
3300027250|Ga0208310_1025992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300027260|Ga0208027_1042265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300027418|Ga0208022_1018791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1627 | Open in IMG/M |
3300027571|Ga0208897_1039027 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
3300027581|Ga0209651_1207725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027608|Ga0208974_1050106 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
3300027656|Ga0209357_1029020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1865 | Open in IMG/M |
3300027679|Ga0209769_1043263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
3300027756|Ga0209444_10212114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300027759|Ga0209296_1072957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1713 | Open in IMG/M |
3300027769|Ga0209770_10123821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300027793|Ga0209972_10075319 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
3300027797|Ga0209107_10075397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1851 | Open in IMG/M |
3300028025|Ga0247723_1060280 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1033374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3328 | Open in IMG/M |
3300031758|Ga0315907_11238972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300031784|Ga0315899_10242704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1800 | Open in IMG/M |
3300031786|Ga0315908_10660655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300031787|Ga0315900_10626654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300031857|Ga0315909_10479632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300031857|Ga0315909_10607729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300032093|Ga0315902_10548109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300032093|Ga0315902_11116339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300032093|Ga0315902_11273499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300032116|Ga0315903_10356074 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
3300032116|Ga0315903_10680208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300032116|Ga0315903_11050438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300033978|Ga0334977_0235210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300034020|Ga0335002_0297135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300034050|Ga0335023_0465281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300034066|Ga0335019_0476949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300034106|Ga0335036_0849849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300034108|Ga0335050_0201639 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
3300034110|Ga0335055_0164425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300034116|Ga0335068_0235704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300034200|Ga0335065_0473106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300034279|Ga0335052_0104951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300034283|Ga0335007_0359158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300034283|Ga0335007_0550957 | Not Available | 679 | Open in IMG/M |
3300034356|Ga0335048_0500830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.69% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.54% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.23% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.46% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.08% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.31% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.54% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.54% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.54% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.54% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.54% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.77% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020486 | Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027241 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027250 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_101122701 | 3300000756 | Freshwater And Sediment | YLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD* |
FwDRAFT_1000785811 | 3300000882 | Freshwater And Marine | SKLFYLRSPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD* |
FwDRAFT_100501592 | 3300000882 | Freshwater And Marine | PSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
JGI25908J49247_101697422 | 3300003277 | Freshwater Lake | VHDSKLFYLRAQSDLMDKSQLRTDLEMANSFLQGLWAEGYFD* |
JGI25930J51415_10821341 | 3300003499 | Freshwater Lake | NAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD* |
Ga0065166_102457711 | 3300004112 | Freshwater Lake | LFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNGDV* |
Ga0007795_101421362 | 3300004773 | Freshwater | TNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD* |
Ga0007761_112260561 | 3300004792 | Freshwater Lake | HDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFD* |
Ga0007763_107456964 | 3300004796 | Freshwater Lake | MTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD* |
Ga0070374_103150621 | 3300005517 | Freshwater Lake | TNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNGDV* |
Ga0070374_104030161 | 3300005517 | Freshwater Lake | TNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDGK* |
Ga0068876_101502386 | 3300005527 | Freshwater Lake | MINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD* |
Ga0068876_106979283 | 3300005527 | Freshwater Lake | LFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0049083_102080303 | 3300005580 | Freshwater Lentic | KLFYLRTPSDLMDKTELRNDLEMAVSFLQGLWAEGYFD* |
Ga0049081_101322901 | 3300005581 | Freshwater Lentic | KAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND* |
Ga0049081_102046664 | 3300005581 | Freshwater Lentic | KAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFD* |
Ga0078894_102519207 | 3300005662 | Freshwater Lake | HDAKLFYIRSASNLVDQSLMVNGLEKTVSFLQGLWAEGYFDGYQD* |
Ga0078894_107712501 | 3300005662 | Freshwater Lake | KLFYLRSPSDLMDKTQLVTNLEMTVSFLQGLWAEGYFD* |
Ga0078894_109916764 | 3300005662 | Freshwater Lake | RTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0070743_102511021 | 3300005941 | Estuarine | NAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNA* |
Ga0075470_101024034 | 3300006030 | Aqueous | INAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDYA* |
Ga0070744_101860804 | 3300006484 | Estuarine | INAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0102861_12176341 | 3300007544 | Estuarine | PSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTD* |
Ga0102873_12588861 | 3300007545 | Estuarine | TPSDLIDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD* |
Ga0102820_10156821 | 3300007554 | Estuarine | KLFYLRHPSSLMDKEPLRKDLEDTVSFLQGLWAEGYFD* |
Ga0102918_11926901 | 3300007593 | Estuarine | AKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDNGDV* |
Ga0102923_11045355 | 3300007606 | Estuarine | FYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN* |
Ga0102895_10400335 | 3300007629 | Estuarine | NAVHDAKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN* |
Ga0102903_10251277 | 3300007630 | Estuarine | TPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN* |
Ga0102856_10357324 | 3300007636 | Estuarine | AKLFYLRTPSDLMDKEPLRKDLEDTVSFLQGLWAEGYFD* |
Ga0102867_12180311 | 3300007716 | Estuarine | HDAKLFYLRYPSDLMDKTELRSDLEMAVSFMQGLWAEGYFDHTN* |
Ga0105736_10635201 | 3300007861 | Estuary Water | KLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN* |
Ga0105748_105260023 | 3300007992 | Estuary Water | KLFYLRYPSDLMDKQPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0114340_10760361 | 3300008107 | Freshwater, Plankton | SPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD* |
Ga0114340_11159175 | 3300008107 | Freshwater, Plankton | MINAIHDSKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD* |
Ga0114340_11911474 | 3300008107 | Freshwater, Plankton | AVHDAKLFYLRSPYDLMNKDPLVKDLEDAVSFMQGLWAEGYFD* |
Ga0114341_105131761 | 3300008108 | Freshwater, Plankton | LRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD* |
Ga0114343_11505404 | 3300008110 | Freshwater, Plankton | DSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD* |
Ga0114346_13008071 | 3300008113 | Freshwater, Plankton | KQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND* |
Ga0114350_11173313 | 3300008116 | Freshwater, Plankton | MLGLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDYANN* |
Ga0114840_10344034 | 3300008258 | Freshwater, Plankton | VKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD* |
Ga0114876_12410051 | 3300008448 | Freshwater Lake | DVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD* |
Ga0102889_10416167 | 3300008964 | Estuarine | LRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD* |
Ga0102831_12010001 | 3300008996 | Estuarine | TPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0102829_13396401 | 3300009026 | Estuarine | LRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD* |
Ga0114969_104887764 | 3300009181 | Freshwater Lake | IHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTD* |
Ga0114983_11136363 | 3300009194 | Deep Subsurface | AIHVSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0114982_11820831 | 3300009419 | Deep Subsurface | HDAKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD* |
Ga0114964_101979681 | 3300010157 | Freshwater Lake | MINAIHDAKLFYLRTPSDLMDKQPLIKDLEDAVSFMQGLWAEGYFD* |
Ga0114967_105132011 | 3300010160 | Freshwater Lake | PSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD* |
Ga0129336_103070071 | 3300010370 | Freshwater To Marine Saline Gradient | MINAVHDAKLFYLRHPSDLMDKTQLRSDLEDTVSFLQGLWAEGYFD* |
Ga0133913_100145881 | 3300010885 | Freshwater Lake | KLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAEGYFD* |
Ga0133913_108944371 | 3300010885 | Freshwater Lake | INAVHDAKLFYLRTPSDLMDKAPLRKDLEDAVSFLQGLWAEGYFDYSIRI* |
Ga0133913_116650051 | 3300010885 | Freshwater Lake | NAVHDAKLFYLRTPSDLMDKAPLRKDLEDAVSFLQGLWAEGYFDYSTGI* |
Ga0153801_10548234 | 3300012017 | Freshwater | VHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN* |
Ga0164292_103185555 | 3300013005 | Freshwater | YLRYPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHA* |
Ga0170791_120312371 | 3300013295 | Freshwater | AKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTD* |
Ga0177922_111042211 | 3300013372 | Freshwater | EKAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFD* |
Ga0181343_10579126 | 3300017766 | Freshwater Lake | VHDAKLFYLRSPSDLMNKDPLVKDLEDAVSFMQGLWAEGYFD |
Ga0181343_11545633 | 3300017766 | Freshwater Lake | MINAVHDVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD |
Ga0181355_10295439 | 3300017785 | Freshwater Lake | HDSKLFYLRTPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN |
Ga0181359_10754661 | 3300019784 | Freshwater Lake | RDDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAQI |
Ga0211733_106098798 | 3300020160 | Freshwater | HDSKLFYLRTPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHTN |
Ga0211735_101591113 | 3300020162 | Freshwater | NAVHDAKLFYLRTPSDLMDKEPLRKDLEDTVSFLQGLWAEGYFD |
Ga0208698_1009063 | 3300020486 | Freshwater | MINAIHDSKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD |
Ga0208050_10065261 | 3300020498 | Freshwater | VHDAKLFYLRTPSDLMDKSLLTEGLLKTNDFLQGLWAEGYFD |
Ga0208050_10093496 | 3300020498 | Freshwater | YLRTPSDLMDKQPLRKDLEDAVSFMQGLWAEGYFD |
Ga0222714_102409895 | 3300021961 | Estuarine Water | INAIHDVKLFYLRSPNDLMNKDPLVKDLEDAVSFLQGLWAEGYFD |
Ga0222714_104018793 | 3300021961 | Estuarine Water | NAIHDAKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD |
Ga0222713_107241794 | 3300021962 | Estuarine Water | MINAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0181354_10892031 | 3300022190 | Freshwater Lake | SKLFYLRTPSDLMDKTELRNDLEMAVSFLQGLWAEGYFD |
Ga0255148_10100891 | 3300024306 | Freshwater | FYLKYPSDLMDKTRIVTGLEQANSFFDGLWAEGYFD |
Ga0255148_10627161 | 3300024306 | Freshwater | YLRTPSDLMDKEPLRRDLEDAVSFMQGLWAEGYFD |
Ga0244777_100006309 | 3300024343 | Estuarine | MINAVHDAKLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAEGYFD |
Ga0244775_111955911 | 3300024346 | Estuarine | LFYLRTPSDLIDKTELVKDLEMSVSFLQGLWAEGYFDHTD |
Ga0255142_10580483 | 3300024352 | Freshwater | FYLRHPSDLMDKEPLRRDLEDAVSFMQGLWAEGYFD |
Ga0256330_10188811 | 3300024481 | Freshwater | RMINAVHDSKLFYLRYPSDLMDKTQLRTDLEDTVSFLLGLLAEGHVQ |
Ga0256337_10217626 | 3300024573 | Freshwater | RMINAVHDSKLFYLRYPSDLMDKSQLRADLEDTVSFLQGILAEGHVQ |
Ga0255246_100502811 | 3300024863 | Freshwater | AIHDSKLFDLRTPSDLMAKEPLRKDLEDAVSFLQGLWAEGYFDYTN |
Ga0208249_10946513 | 3300025532 | Freshwater | TNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD |
Ga0208546_10398255 | 3300025585 | Aqueous | INAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDYA |
Ga0255160_10182581 | 3300026457 | Freshwater | AVHDSKLFYLRYPSDLMDKTQLRTDLEDTVSFLLGLLAEGHVQ |
Ga0256334_10792091 | 3300026566 | Freshwater | IETAKQFYLKYPSDLMDKTRIVTGLEQANSFFDGLWAEGYFD |
Ga0255270_11430623 | 3300026572 | Freshwater | VHDAKLFYLRSPSDLIDKAPLKKDLEDAVSFMQGLWAEGYFD |
Ga0255076_10741853 | 3300027141 | Freshwater | FYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN |
Ga0255078_10511541 | 3300027156 | Freshwater | INAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTD |
Ga0208164_10719663 | 3300027224 | Estuarine | LRYPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDNAN |
Ga0208805_10528774 | 3300027241 | Estuarine | YIRTPSDLIDKQPLIKDLEDAVSFLQGLWAEGYFD |
Ga0208931_10087681 | 3300027246 | Estuarine | SKLFYLRTPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN |
Ga0208931_10125641 | 3300027246 | Estuarine | YLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN |
Ga0208310_10259921 | 3300027250 | Estuarine | MINAVHDAKLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAE |
Ga0208027_10422654 | 3300027260 | Estuarine | KLFYIRTPSDLIDKQPLIKDLEDAVSFLQGLWAEGYFD |
Ga0208022_10187917 | 3300027418 | Estuarine | FYLRYPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN |
Ga0208897_10390276 | 3300027571 | Estuarine | TNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNA |
Ga0209651_12077251 | 3300027581 | Freshwater Lake | INAVHDSKLFYLRAQSDLMDKSQLRTDLEMANSFLQGLWAEGYFD |
Ga0208974_10501061 | 3300027608 | Freshwater Lentic | MINAIHDSKLFYLRTPSDLMDKEPLKKDLEDAVSFMQGLLAEGYFDND |
Ga0209357_10290201 | 3300027656 | Freshwater Lake | HDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAQI |
Ga0209769_10432631 | 3300027679 | Freshwater Lake | LFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDHTD |
Ga0209444_102121143 | 3300027756 | Freshwater Lake | MTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0209296_10729571 | 3300027759 | Freshwater Lake | KLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDNTN |
Ga0209770_101238211 | 3300027769 | Freshwater Lake | AIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0209972_100753199 | 3300027793 | Freshwater Lake | YLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD |
Ga0209107_100753977 | 3300027797 | Freshwater And Sediment | NAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD |
Ga0247723_10602801 | 3300028025 | Deep Subsurface Sediment | HDAKLFYLRTPSDLMDKTELRTDLEMAVSFMQGLWAEGYFD |
(restricted) Ga0247839_103337410 | 3300028553 | Freshwater | YLRTPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHTN |
Ga0315907_112389721 | 3300031758 | Freshwater | LFYLRTPSDLMDKTELRADLEMAVSFMQGLWAEGYFD |
Ga0315899_102427049 | 3300031784 | Freshwater | FYLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD |
Ga0315908_106606554 | 3300031786 | Freshwater | NAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0315900_106266544 | 3300031787 | Freshwater | INAVHDVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD |
Ga0315909_104796321 | 3300031857 | Freshwater | VHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD |
Ga0315909_106077291 | 3300031857 | Freshwater | AIHDVKLFYLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD |
Ga0315902_105481095 | 3300032093 | Freshwater | PSDLIDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD |
Ga0315902_111163394 | 3300032093 | Freshwater | KQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND |
Ga0315902_112734991 | 3300032093 | Freshwater | SKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD |
Ga0315903_103560746 | 3300032116 | Freshwater | NAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN |
Ga0315903_106802081 | 3300032116 | Freshwater | RTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN |
Ga0315903_110504383 | 3300032116 | Freshwater | NAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD |
Ga0334977_0235210_774_905 | 3300033978 | Freshwater | DSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN |
Ga0335002_0297135_2_112 | 3300034020 | Freshwater | MTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQ |
Ga0335023_0465281_1_123 | 3300034050 | Freshwater | KLFYLRTPSDLIDKTELVKDLEMTVSFLQGLWAEGYFDED |
Ga0335019_0476949_3_152 | 3300034066 | Freshwater | TNAVHDAKLFYLRSPSDLMDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD |
Ga0335036_0849849_2_127 | 3300034106 | Freshwater | HDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0335050_0201639_3_110 | 3300034108 | Freshwater | TPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN |
Ga0335055_0164425_870_995 | 3300034110 | Freshwater | KLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN |
Ga0335068_0235704_833_940 | 3300034116 | Freshwater | TPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN |
Ga0335065_0473106_2_142 | 3300034200 | Freshwater | MINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD |
Ga0335052_0104951_3_119 | 3300034279 | Freshwater | YLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN |
Ga0335007_0359158_803_928 | 3300034283 | Freshwater | KLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN |
Ga0335007_0550957_1_114 | 3300034283 | Freshwater | YLRTPSDLIDKEPLKKDLEEAVSFLLGLVAEGHFDND |
Ga0335048_0500830_462_581 | 3300034356 | Freshwater | AKLFYLRTPSDLMDKQPLRKDLEDAVSFMQGLWAEGYFD |
⦗Top⦘ |