NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062746

Metagenome / Metatranscriptome Family F062746

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062746
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 42 residues
Representative Sequence HDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Number of Associated Samples 109
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 4.62 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 91.54 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (82.308 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(17.692 % of family members)
Environment Ontology (ENVO) Unclassified
(43.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(52.308 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF04973NMN_transporter 0.77
PF06067DUF932 0.77
PF136402OG-FeII_Oxy_3 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG3201Nicotinamide riboside transporter PnuCCoenzyme transport and metabolism [H] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.46 %
UnclassifiedrootN/A1.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10112270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300000882|FwDRAFT_10007858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6991Open in IMG/M
3300000882|FwDRAFT_10050159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300003277|JGI25908J49247_10169742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300003499|JGI25930J51415_1082134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300004112|Ga0065166_10245771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300004773|Ga0007795_10142136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300004792|Ga0007761_11226056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300004796|Ga0007763_10745696All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300005517|Ga0070374_10315062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300005517|Ga0070374_10403016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300005527|Ga0068876_10150238All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300005527|Ga0068876_10697928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300005580|Ga0049083_10208030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300005581|Ga0049081_10132290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300005581|Ga0049081_10204666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300005662|Ga0078894_10251920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1601Open in IMG/M
3300005662|Ga0078894_10771250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300005662|Ga0078894_10991676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300005941|Ga0070743_10251102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300006030|Ga0075470_10102403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300006484|Ga0070744_10186080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300007544|Ga0102861_1217634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300007545|Ga0102873_1258886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300007554|Ga0102820_1015682All Organisms → Viruses → Predicted Viral1878Open in IMG/M
3300007593|Ga0102918_1192690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300007606|Ga0102923_1104535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300007629|Ga0102895_1040033All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300007630|Ga0102903_1025127All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300007636|Ga0102856_1035732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300007716|Ga0102867_1218031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300007861|Ga0105736_1063520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300007992|Ga0105748_10526002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300008107|Ga0114340_1076036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4073Open in IMG/M
3300008107|Ga0114340_1115917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1045Open in IMG/M
3300008107|Ga0114340_1191147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300008108|Ga0114341_10513176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300008110|Ga0114343_1150540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300008113|Ga0114346_1300807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300008116|Ga0114350_1117331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1885Open in IMG/M
3300008258|Ga0114840_1034403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300008448|Ga0114876_1241005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300008964|Ga0102889_1041616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1412Open in IMG/M
3300008996|Ga0102831_1201000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300009026|Ga0102829_1339640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300009181|Ga0114969_10488776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300009194|Ga0114983_1113636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300009419|Ga0114982_1182083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300010157|Ga0114964_10197968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage966Open in IMG/M
3300010160|Ga0114967_10513201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300010370|Ga0129336_10307007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300010885|Ga0133913_10014588Not Available20828Open in IMG/M
3300010885|Ga0133913_10894437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2306Open in IMG/M
3300010885|Ga0133913_11665005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1606Open in IMG/M
3300012017|Ga0153801_1054823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300013005|Ga0164292_10318555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300013295|Ga0170791_12031237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1706Open in IMG/M
3300013372|Ga0177922_11104221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300017766|Ga0181343_1057912All Organisms → Viruses → Predicted Viral1130Open in IMG/M
3300017766|Ga0181343_1154563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300017785|Ga0181355_1029543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2369Open in IMG/M
3300019784|Ga0181359_1075466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1271Open in IMG/M
3300020160|Ga0211733_10609879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2021Open in IMG/M
3300020162|Ga0211735_10159111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300020486|Ga0208698_100906All Organisms → Viruses → Predicted Viral2811Open in IMG/M
3300020498|Ga0208050_1006526All Organisms → Viruses → Predicted Viral1403Open in IMG/M
3300020498|Ga0208050_1009349All Organisms → Viruses → Predicted Viral1124Open in IMG/M
3300021961|Ga0222714_10240989All Organisms → Viruses → Predicted Viral1019Open in IMG/M
3300021961|Ga0222714_10401879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300021962|Ga0222713_10724179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300022190|Ga0181354_1089203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300024306|Ga0255148_1010089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300024306|Ga0255148_1062716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300024343|Ga0244777_10000630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage27401Open in IMG/M
3300024346|Ga0244775_11195591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300024352|Ga0255142_1058048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300024481|Ga0256330_1018881All Organisms → Viruses → Predicted Viral1448Open in IMG/M
3300024573|Ga0256337_1021762All Organisms → Viruses → Predicted Viral1597Open in IMG/M
3300024863|Ga0255246_1005028All Organisms → Viruses → Predicted Viral2528Open in IMG/M
3300025532|Ga0208249_1094651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300025585|Ga0208546_1039825All Organisms → Viruses → Predicted Viral1136Open in IMG/M
3300026457|Ga0255160_1018258All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300026566|Ga0256334_1079209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300026572|Ga0255270_1143062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300027141|Ga0255076_1074185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300027156|Ga0255078_1051154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300027224|Ga0208164_1071966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300027241|Ga0208805_1052877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300027246|Ga0208931_1008768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2224Open in IMG/M
3300027246|Ga0208931_1012564All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1814Open in IMG/M
3300027250|Ga0208310_1025992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300027260|Ga0208027_1042265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300027418|Ga0208022_1018791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1627Open in IMG/M
3300027571|Ga0208897_1039027All Organisms → Viruses → Predicted Viral1286Open in IMG/M
3300027581|Ga0209651_1207725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300027608|Ga0208974_1050106All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300027656|Ga0209357_1029020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1865Open in IMG/M
3300027679|Ga0209769_1043263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1533Open in IMG/M
3300027756|Ga0209444_10212114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300027759|Ga0209296_1072957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1713Open in IMG/M
3300027769|Ga0209770_10123821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1053Open in IMG/M
3300027793|Ga0209972_10075319All Organisms → Viruses → Predicted Viral1755Open in IMG/M
3300027797|Ga0209107_10075397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1851Open in IMG/M
3300028025|Ga0247723_1060280All Organisms → Viruses → Predicted Viral1052Open in IMG/M
(restricted) 3300028553|Ga0247839_1033374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3328Open in IMG/M
3300031758|Ga0315907_11238972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300031784|Ga0315899_10242704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1800Open in IMG/M
3300031786|Ga0315908_10660655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300031787|Ga0315900_10626654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300031857|Ga0315909_10479632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300031857|Ga0315909_10607729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300032093|Ga0315902_10548109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage989Open in IMG/M
3300032093|Ga0315902_11116339All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300032093|Ga0315902_11273499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300032116|Ga0315903_10356074All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300032116|Ga0315903_10680208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300032116|Ga0315903_11050438All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300033978|Ga0334977_0235210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300034020|Ga0335002_0297135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage944Open in IMG/M
3300034050|Ga0335023_0465281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300034066|Ga0335019_0476949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300034106|Ga0335036_0849849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300034108|Ga0335050_0201639All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300034110|Ga0335055_0164425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage997Open in IMG/M
3300034116|Ga0335068_0235704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage941Open in IMG/M
3300034200|Ga0335065_0473106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300034279|Ga0335052_0104951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1702Open in IMG/M
3300034283|Ga0335007_0359158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300034283|Ga0335007_0550957Not Available679Open in IMG/M
3300034356|Ga0335048_0500830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake17.69%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine15.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.23%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater8.46%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.85%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.08%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.31%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.54%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.54%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine1.54%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.54%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.54%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.77%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1MEnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020486Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024481Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025532Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026457Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300026566Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027224Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027241Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027250Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1011227013300000756Freshwater And SedimentYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD*
FwDRAFT_10007858113300000882Freshwater And MarineSKLFYLRSPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD*
FwDRAFT_1005015923300000882Freshwater And MarinePSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
JGI25908J49247_1016974223300003277Freshwater LakeVHDSKLFYLRAQSDLMDKSQLRTDLEMANSFLQGLWAEGYFD*
JGI25930J51415_108213413300003499Freshwater LakeNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD*
Ga0065166_1024577113300004112Freshwater LakeLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNGDV*
Ga0007795_1014213623300004773FreshwaterTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD*
Ga0007761_1122605613300004792Freshwater LakeHDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFD*
Ga0007763_1074569643300004796Freshwater LakeMTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD*
Ga0070374_1031506213300005517Freshwater LakeTNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNGDV*
Ga0070374_1040301613300005517Freshwater LakeTNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDGK*
Ga0068876_1015023863300005527Freshwater LakeMINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD*
Ga0068876_1069792833300005527Freshwater LakeLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0049083_1020803033300005580Freshwater LenticKLFYLRTPSDLMDKTELRNDLEMAVSFLQGLWAEGYFD*
Ga0049081_1013229013300005581Freshwater LenticKAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND*
Ga0049081_1020466643300005581Freshwater LenticKAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFD*
Ga0078894_1025192073300005662Freshwater LakeHDAKLFYIRSASNLVDQSLMVNGLEKTVSFLQGLWAEGYFDGYQD*
Ga0078894_1077125013300005662Freshwater LakeKLFYLRSPSDLMDKTQLVTNLEMTVSFLQGLWAEGYFD*
Ga0078894_1099167643300005662Freshwater LakeRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0070743_1025110213300005941EstuarineNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNA*
Ga0075470_1010240343300006030AqueousINAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDYA*
Ga0070744_1018608043300006484EstuarineINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0102861_121763413300007544EstuarinePSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTD*
Ga0102873_125888613300007545EstuarineTPSDLIDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD*
Ga0102820_101568213300007554EstuarineKLFYLRHPSSLMDKEPLRKDLEDTVSFLQGLWAEGYFD*
Ga0102918_119269013300007593EstuarineAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDNGDV*
Ga0102923_110453553300007606EstuarineFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN*
Ga0102895_104003353300007629EstuarineNAVHDAKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN*
Ga0102903_102512773300007630EstuarineTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN*
Ga0102856_103573243300007636EstuarineAKLFYLRTPSDLMDKEPLRKDLEDTVSFLQGLWAEGYFD*
Ga0102867_121803113300007716EstuarineHDAKLFYLRYPSDLMDKTELRSDLEMAVSFMQGLWAEGYFDHTN*
Ga0105736_106352013300007861Estuary WaterKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN*
Ga0105748_1052600233300007992Estuary WaterKLFYLRYPSDLMDKQPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0114340_107603613300008107Freshwater, PlanktonSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD*
Ga0114340_111591753300008107Freshwater, PlanktonMINAIHDSKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD*
Ga0114340_119114743300008107Freshwater, PlanktonAVHDAKLFYLRSPYDLMNKDPLVKDLEDAVSFMQGLWAEGYFD*
Ga0114341_1051317613300008108Freshwater, PlanktonLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD*
Ga0114343_115054043300008110Freshwater, PlanktonDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD*
Ga0114346_130080713300008113Freshwater, PlanktonKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND*
Ga0114350_111733133300008116Freshwater, PlanktonMLGLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDYANN*
Ga0114840_103440343300008258Freshwater, PlanktonVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD*
Ga0114876_124100513300008448Freshwater LakeDVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD*
Ga0102889_104161673300008964EstuarineLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD*
Ga0102831_120100013300008996EstuarineTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0102829_133964013300009026EstuarineLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD*
Ga0114969_1048877643300009181Freshwater LakeIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTD*
Ga0114983_111363633300009194Deep SubsurfaceAIHVSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0114982_118208313300009419Deep SubsurfaceHDAKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD*
Ga0114964_1019796813300010157Freshwater LakeMINAIHDAKLFYLRTPSDLMDKQPLIKDLEDAVSFMQGLWAEGYFD*
Ga0114967_1051320113300010160Freshwater LakePSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD*
Ga0129336_1030700713300010370Freshwater To Marine Saline GradientMINAVHDAKLFYLRHPSDLMDKTQLRSDLEDTVSFLQGLWAEGYFD*
Ga0133913_1001458813300010885Freshwater LakeKLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAEGYFD*
Ga0133913_1089443713300010885Freshwater LakeINAVHDAKLFYLRTPSDLMDKAPLRKDLEDAVSFLQGLWAEGYFDYSIRI*
Ga0133913_1166500513300010885Freshwater LakeNAVHDAKLFYLRTPSDLMDKAPLRKDLEDAVSFLQGLWAEGYFDYSTGI*
Ga0153801_105482343300012017FreshwaterVHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
Ga0164292_1031855553300013005FreshwaterYLRYPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHA*
Ga0170791_1203123713300013295FreshwaterAKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTD*
Ga0177922_1110422113300013372FreshwaterEKAKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFD*
Ga0181343_105791263300017766Freshwater LakeVHDAKLFYLRSPSDLMNKDPLVKDLEDAVSFMQGLWAEGYFD
Ga0181343_115456333300017766Freshwater LakeMINAVHDVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD
Ga0181355_102954393300017785Freshwater LakeHDSKLFYLRTPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN
Ga0181359_107546613300019784Freshwater LakeRDDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAQI
Ga0211733_1060987983300020160FreshwaterHDSKLFYLRTPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHTN
Ga0211735_1015911133300020162FreshwaterNAVHDAKLFYLRTPSDLMDKEPLRKDLEDTVSFLQGLWAEGYFD
Ga0208698_10090633300020486FreshwaterMINAIHDSKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD
Ga0208050_100652613300020498FreshwaterVHDAKLFYLRTPSDLMDKSLLTEGLLKTNDFLQGLWAEGYFD
Ga0208050_100934963300020498FreshwaterYLRTPSDLMDKQPLRKDLEDAVSFMQGLWAEGYFD
Ga0222714_1024098953300021961Estuarine WaterINAIHDVKLFYLRSPNDLMNKDPLVKDLEDAVSFLQGLWAEGYFD
Ga0222714_1040187933300021961Estuarine WaterNAIHDAKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD
Ga0222713_1072417943300021962Estuarine WaterMINAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0181354_108920313300022190Freshwater LakeSKLFYLRTPSDLMDKTELRNDLEMAVSFLQGLWAEGYFD
Ga0255148_101008913300024306FreshwaterFYLKYPSDLMDKTRIVTGLEQANSFFDGLWAEGYFD
Ga0255148_106271613300024306FreshwaterYLRTPSDLMDKEPLRRDLEDAVSFMQGLWAEGYFD
Ga0244777_1000063093300024343EstuarineMINAVHDAKLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAEGYFD
Ga0244775_1119559113300024346EstuarineLFYLRTPSDLIDKTELVKDLEMSVSFLQGLWAEGYFDHTD
Ga0255142_105804833300024352FreshwaterFYLRHPSDLMDKEPLRRDLEDAVSFMQGLWAEGYFD
Ga0256330_101888113300024481FreshwaterRMINAVHDSKLFYLRYPSDLMDKTQLRTDLEDTVSFLLGLLAEGHVQ
Ga0256337_102176263300024573FreshwaterRMINAVHDSKLFYLRYPSDLMDKSQLRADLEDTVSFLQGILAEGHVQ
Ga0255246_1005028113300024863FreshwaterAIHDSKLFDLRTPSDLMAKEPLRKDLEDAVSFLQGLWAEGYFDYTN
Ga0208249_109465133300025532FreshwaterTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD
Ga0208546_103982553300025585AqueousINAIHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDYA
Ga0255160_101825813300026457FreshwaterAVHDSKLFYLRYPSDLMDKTQLRTDLEDTVSFLLGLLAEGHVQ
Ga0256334_107920913300026566FreshwaterIETAKQFYLKYPSDLMDKTRIVTGLEQANSFFDGLWAEGYFD
Ga0255270_114306233300026572FreshwaterVHDAKLFYLRSPSDLIDKAPLKKDLEDAVSFMQGLWAEGYFD
Ga0255076_107418533300027141FreshwaterFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN
Ga0255078_105115413300027156FreshwaterINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTD
Ga0208164_107196633300027224EstuarineLRYPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDNAN
Ga0208805_105287743300027241EstuarineYIRTPSDLIDKQPLIKDLEDAVSFLQGLWAEGYFD
Ga0208931_100876813300027246EstuarineSKLFYLRTPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN
Ga0208931_101256413300027246EstuarineYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDHTN
Ga0208310_102599213300027250EstuarineMINAVHDAKLFYLRTPSDLMDKTELRKDLEDAVSFLQGLWAE
Ga0208027_104226543300027260EstuarineKLFYIRTPSDLIDKQPLIKDLEDAVSFLQGLWAEGYFD
Ga0208022_101879173300027418EstuarineFYLRYPSDLMDKTELRSDLEMAVSFLQGLWAEGYFDHTN
Ga0208897_103902763300027571EstuarineTNAVHDAKLFYLKYPSDLLDKSELVNDLQDTVSFLQGLWAEGYFDNA
Ga0209651_120772513300027581Freshwater LakeINAVHDSKLFYLRAQSDLMDKSQLRTDLEMANSFLQGLWAEGYFD
Ga0208974_105010613300027608Freshwater LenticMINAIHDSKLFYLRTPSDLMDKEPLKKDLEDAVSFMQGLLAEGYFDND
Ga0209357_102902013300027656Freshwater LakeHDSKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAQI
Ga0209769_104326313300027679Freshwater LakeLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFDHTD
Ga0209444_1021211433300027756Freshwater LakeMTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0209296_107295713300027759Freshwater LakeKLFYLRYPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDNTN
Ga0209770_1012382113300027769Freshwater LakeAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0209972_1007531993300027793Freshwater LakeYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFD
Ga0209107_1007539773300027797Freshwater And SedimentNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFFQGLWAEGYFD
Ga0247723_106028013300028025Deep Subsurface SedimentHDAKLFYLRTPSDLMDKTELRTDLEMAVSFMQGLWAEGYFD
(restricted) Ga0247839_1033374103300028553FreshwaterYLRTPSDLMDKTELRADLEMAVSFLQGLWAEGYFDHTN
Ga0315907_1123897213300031758FreshwaterLFYLRTPSDLMDKTELRADLEMAVSFMQGLWAEGYFD
Ga0315899_1024270493300031784FreshwaterFYLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD
Ga0315908_1066065543300031786FreshwaterNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0315900_1062665443300031787FreshwaterINAVHDVKLFYLRSPSDLMNKDPLVKDLEDTVSFMQGLWAEGYFD
Ga0315909_1047963213300031857FreshwaterVHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD
Ga0315909_1060772913300031857FreshwaterAIHDVKLFYLRSPSDLMNKDPLVKDLEDAVSFLQGLWAEGYFDGYQD
Ga0315902_1054810953300032093FreshwaterPSDLIDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD
Ga0315902_1111633943300032093FreshwaterKQFYLSYPSDLMDKTRVTTGLEQANSFFDGLWAEGYFDND
Ga0315902_1127349913300032093FreshwaterSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD
Ga0315903_1035607463300032116FreshwaterNAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN
Ga0315903_1068020813300032116FreshwaterRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN
Ga0315903_1105043833300032116FreshwaterNAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTD
Ga0334977_0235210_774_9053300033978FreshwaterDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN
Ga0335002_0297135_2_1123300034020FreshwaterMTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFLQ
Ga0335023_0465281_1_1233300034050FreshwaterKLFYLRTPSDLIDKTELVKDLEMTVSFLQGLWAEGYFDED
Ga0335019_0476949_3_1523300034066FreshwaterTNAVHDAKLFYLRSPSDLMDKEPLVKSLEKTVSFLQGLWAEGYFDGYQD
Ga0335036_0849849_2_1273300034106FreshwaterHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0335050_0201639_3_1103300034108FreshwaterTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN
Ga0335055_0164425_870_9953300034110FreshwaterKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDHTN
Ga0335068_0235704_833_9403300034116FreshwaterTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN
Ga0335065_0473106_2_1423300034200FreshwaterMINAIHDSKLFYLRTPSDLMDKEPLRKDLEDAVSFLQGLWAEGYFD
Ga0335052_0104951_3_1193300034279FreshwaterYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN
Ga0335007_0359158_803_9283300034283FreshwaterKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN
Ga0335007_0550957_1_1143300034283FreshwaterYLRTPSDLIDKEPLKKDLEEAVSFLLGLVAEGHFDND
Ga0335048_0500830_462_5813300034356FreshwaterAKLFYLRTPSDLMDKQPLRKDLEDAVSFMQGLWAEGYFD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.