NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062711

Metagenome Family F062711

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062711
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 54 residues
Representative Sequence MKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Number of Associated Samples 100
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 4.62 %
% of genes near scaffold ends (potentially truncated) 60.77 %
% of genes from short scaffolds (< 2000 bps) 82.31 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (79.231 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(27.692 % of family members)
Environment Ontology (ENVO) Unclassified
(93.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.923 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.93%    β-sheet: 7.41%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF03237Terminase_6N 3.08
PF00166Cpn10 0.77
PF01612DNA_pol_A_exo1 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A79.23 %
All OrganismsrootAll Organisms20.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10200863Not Available669Open in IMG/M
3300000115|DelMOSum2011_c10152826Not Available683Open in IMG/M
3300000115|DelMOSum2011_c10156405Not Available671Open in IMG/M
3300000115|DelMOSum2011_c10209984Not Available537Open in IMG/M
3300000115|DelMOSum2011_c10217933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.522Open in IMG/M
3300000116|DelMOSpr2010_c10040742Not Available2098Open in IMG/M
3300000116|DelMOSpr2010_c10065102Not Available1511Open in IMG/M
3300000117|DelMOWin2010_c10148164Not Available779Open in IMG/M
3300001460|JGI24003J15210_10008187All Organisms → cellular organisms → Bacteria4340Open in IMG/M
3300001460|JGI24003J15210_10067809Not Available1122Open in IMG/M
3300001956|GOS2266_1037921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1585Open in IMG/M
3300005078|Ga0070770_10174570Not Available1242Open in IMG/M
3300006026|Ga0075478_10100901Not Available921Open in IMG/M
3300006637|Ga0075461_10183187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.632Open in IMG/M
3300006735|Ga0098038_1014810Not Available3012Open in IMG/M
3300006735|Ga0098038_1198059Not Available651Open in IMG/M
3300006737|Ga0098037_1023919Not Available2274Open in IMG/M
3300006737|Ga0098037_1038501Not Available1747Open in IMG/M
3300006737|Ga0098037_1150394Not Available782Open in IMG/M
3300006749|Ga0098042_1166774Not Available535Open in IMG/M
3300006754|Ga0098044_1036150Not Available2151Open in IMG/M
3300006789|Ga0098054_1186815Not Available758Open in IMG/M
3300006790|Ga0098074_1032997Not Available1501Open in IMG/M
3300006810|Ga0070754_10132283Not Available1206Open in IMG/M
3300006868|Ga0075481_10113897Not Available998Open in IMG/M
3300006870|Ga0075479_10081254Not Available1355Open in IMG/M
3300006916|Ga0070750_10131931Not Available1140Open in IMG/M
3300006916|Ga0070750_10165747Not Available994Open in IMG/M
3300006916|Ga0070750_10300495Not Available686Open in IMG/M
3300006916|Ga0070750_10358662Not Available614Open in IMG/M
3300006919|Ga0070746_10179753Not Available1017Open in IMG/M
3300006919|Ga0070746_10465720Not Available559Open in IMG/M
3300006921|Ga0098060_1023676All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1896Open in IMG/M
3300006921|Ga0098060_1063006Not Available1080Open in IMG/M
3300006921|Ga0098060_1105879Not Available795Open in IMG/M
3300006921|Ga0098060_1224433Not Available510Open in IMG/M
3300007229|Ga0075468_10134118Not Available759Open in IMG/M
3300007229|Ga0075468_10191730Not Available600Open in IMG/M
3300007234|Ga0075460_10198429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.684Open in IMG/M
3300007346|Ga0070753_1061587Not Available1517Open in IMG/M
3300007963|Ga0110931_1046979Not Available1303Open in IMG/M
3300007963|Ga0110931_1169995Not Available653Open in IMG/M
3300009071|Ga0115566_10035858Not Available3484Open in IMG/M
3300009433|Ga0115545_1180945Not Available725Open in IMG/M
3300009435|Ga0115546_1021370Not Available2731Open in IMG/M
3300010149|Ga0098049_1036453Not Available1588Open in IMG/M
3300010149|Ga0098049_1205839Not Available602Open in IMG/M
3300010149|Ga0098049_1212106Not Available592Open in IMG/M
3300010149|Ga0098049_1241447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.550Open in IMG/M
3300010153|Ga0098059_1040780Not Available1875Open in IMG/M
3300010296|Ga0129348_1017785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.2589Open in IMG/M
3300010316|Ga0136655_1245397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.533Open in IMG/M
3300011250|Ga0151666_1038324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.558Open in IMG/M
3300013010|Ga0129327_10023249Not Available3249Open in IMG/M
3300017706|Ga0181377_1014840Not Available1790Open in IMG/M
3300017709|Ga0181387_1030964Not Available1049Open in IMG/M
3300017710|Ga0181403_1057790Not Available809Open in IMG/M
3300017710|Ga0181403_1072106Not Available718Open in IMG/M
3300017713|Ga0181391_1083064Not Available731Open in IMG/M
3300017713|Ga0181391_1108839Not Available624Open in IMG/M
3300017714|Ga0181412_1036620Not Available1294Open in IMG/M
3300017720|Ga0181383_1092312Not Available813Open in IMG/M
3300017721|Ga0181373_1062426Not Available670Open in IMG/M
3300017721|Ga0181373_1073052Not Available611Open in IMG/M
3300017725|Ga0181398_1013010Not Available2110Open in IMG/M
3300017727|Ga0181401_1009742Not Available3073Open in IMG/M
3300017729|Ga0181396_1014244All Organisms → cellular organisms → Bacteria → Proteobacteria1585Open in IMG/M
3300017731|Ga0181416_1029534Not Available1286Open in IMG/M
3300017734|Ga0187222_1131908Not Available558Open in IMG/M
3300017737|Ga0187218_1094569Not Available720Open in IMG/M
3300017740|Ga0181418_1040960Not Available1167Open in IMG/M
3300017741|Ga0181421_1044018Not Available1193Open in IMG/M
3300017743|Ga0181402_1037388Not Available1336Open in IMG/M
3300017748|Ga0181393_1072114Not Available914Open in IMG/M
3300017749|Ga0181392_1038991Not Available1477Open in IMG/M
3300017751|Ga0187219_1079696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1025Open in IMG/M
3300017752|Ga0181400_1033251Not Available1653Open in IMG/M
3300017753|Ga0181407_1138874Not Available603Open in IMG/M
3300017756|Ga0181382_1062354All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300017758|Ga0181409_1052467Not Available1254Open in IMG/M
3300017762|Ga0181422_1230803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.551Open in IMG/M
3300017763|Ga0181410_1019554Not Available2242Open in IMG/M
3300017765|Ga0181413_1169782All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300017768|Ga0187220_1018811Not Available2080Open in IMG/M
3300017772|Ga0181430_1070487Not Available1064Open in IMG/M
3300017773|Ga0181386_1112148Not Available846Open in IMG/M
3300017776|Ga0181394_1231044Not Available557Open in IMG/M
3300017779|Ga0181395_1272836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.514Open in IMG/M
3300017783|Ga0181379_1057206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1481Open in IMG/M
3300017950|Ga0181607_10050345Not Available2834Open in IMG/M
3300018424|Ga0181591_11032513Not Available557Open in IMG/M
3300019738|Ga0193994_1067527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.524Open in IMG/M
3300019751|Ga0194029_1003471Not Available2071Open in IMG/M
3300020274|Ga0211658_1052505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.850Open in IMG/M
3300020325|Ga0211507_1079471Not Available646Open in IMG/M
3300020365|Ga0211506_1028963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1577Open in IMG/M
3300021347|Ga0213862_10235643Not Available645Open in IMG/M
3300022053|Ga0212030_1028873Not Available767Open in IMG/M
3300022072|Ga0196889_1000277Not Available16217Open in IMG/M
3300022169|Ga0196903_1044191Not Available517Open in IMG/M
3300022183|Ga0196891_1002776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.3752Open in IMG/M
3300025070|Ga0208667_1018780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1377Open in IMG/M
3300025083|Ga0208791_1022794Not Available1252Open in IMG/M
3300025086|Ga0208157_1028759Not Available1620Open in IMG/M
3300025086|Ga0208157_1063503Not Available959Open in IMG/M
3300025098|Ga0208434_1004882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.4323Open in IMG/M
3300025099|Ga0208669_1076278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.726Open in IMG/M
3300025099|Ga0208669_1105254Not Available584Open in IMG/M
3300025102|Ga0208666_1119655Not Available626Open in IMG/M
3300025120|Ga0209535_1001921Not Available13765Open in IMG/M
3300025120|Ga0209535_1002152Not Available12900Open in IMG/M
3300025128|Ga0208919_1051680Not Available1409Open in IMG/M
3300025508|Ga0208148_1000580Not Available14056Open in IMG/M
3300025610|Ga0208149_1006562All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium3731Open in IMG/M
3300025630|Ga0208004_1126773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.577Open in IMG/M
3300025652|Ga0208134_1119409Not Available702Open in IMG/M
3300025652|Ga0208134_1145529Not Available603Open in IMG/M
3300025674|Ga0208162_1094602Not Available900Open in IMG/M
3300025674|Ga0208162_1131708Not Available705Open in IMG/M
3300025751|Ga0208150_1035057Not Available1744Open in IMG/M
3300025759|Ga0208899_1077775Not Available1304Open in IMG/M
3300025759|Ga0208899_1106450Not Available1036Open in IMG/M
3300025759|Ga0208899_1228978Not Available568Open in IMG/M
3300025769|Ga0208767_1219833Not Available621Open in IMG/M
3300025803|Ga0208425_1135867Not Available554Open in IMG/M
3300025806|Ga0208545_1087743Not Available836Open in IMG/M
3300025869|Ga0209308_10036177Not Available2753Open in IMG/M
3300029448|Ga0183755_1027189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.1753Open in IMG/M
3300032136|Ga0316201_11448115Not Available570Open in IMG/M
3300034374|Ga0348335_187498Not Available517Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine27.69%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.15%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater24.62%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine6.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.08%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.08%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.54%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.77%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.77%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001956Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051EnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300011250Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.2EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019738Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020325Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966)EnvironmentalOpen in IMG/M
3300020365Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1020086323300000101MarineKIIMKVKAQAPSNKLRQIVAGQFVQLTKPQASSFRVRQSVQCFKPGRRVKNRSRRNI*
DelMOSum2011_1015282623300000115MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSFRVRQSVQCFKPGRRVKNRFRRNI*
DelMOSum2011_1015640513300000115MarinePSNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFRRNI*
DelMOSum2011_1020998423300000115MarineMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFR
DelMOSum2011_1021793313300000115MarineDYKVKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFRRNI*
DelMOSpr2010_1004074223300000116MarineMKEKAQALSNKLRQIAAGQFVQLTKPHASGFRMRQSVQCFKPGLRVKNRFNRKR*
DelMOSpr2010_1006510223300000116MarineMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
DelMOWin2010_1014816423300000117MarineYKVKIIMKVKAQAPSNKLRQIVAGQFVQLTKPQASSFRVRQSVQCFKPGRRVKNRSRRNI
JGI24003J15210_1000818793300001460MarineMKVKAQAPSHKLRQIVAGQFGQWTKTQASSNKLRQSVQCFIPGRRVNNLFRRNI*
JGI24003J15210_1006780933300001460MarineMKVTSHKLRQIVAGQFVQLTNPQASSFRVRQSVQCFKPGRRVKNRFKRNV*
GOS2266_103792123300001956MarineMKVKSQAPSNKLRQIVAGQFDQLTKAQASSNKLRQNVKCFIPGRRVKNRFRRNI*
Ga0070770_1017457013300005078WaterMKVKAQAPSHKLRQIVAGQFGQWTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0075478_1010090133300006026AqueousIIMKEKAQALSNKLRQIAAGQFVQLTKPHASGFRMRQSVQCFKPGLRVKNRFNRKR*
Ga0075461_1018318713300006637AqueousKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0098038_101481043300006735MarineMKEKAQAPSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGRRVKNRFRRNI*
Ga0098038_119805913300006735MarineNDYKVKIIMKVKAQAPSNKLRQIVAGQFVQLTKPQASSNKLRQSVQCFKPGKRVKNRFRRNI*
Ga0098037_102391943300006737MarineMKEKAQAPSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGRRVKNRFRR
Ga0098037_103850143300006737MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSNKLRHNVQCFKPGKRVKNRFRRNI*
Ga0098037_115039413300006737MarineMKVKAQAPNHKLRQIVAGQFVQLTKPQASSNKLRQSVQCFVPGRRVKNRFR
Ga0098042_116677413300006749MarineKVNFFMKVKAQAPSNKLRQIVAGQFVQLTKAQVSSNKLRHNVQCFKPGKRVKNRFRRNI*
Ga0098044_103615023300006754MarineMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0098054_118681513300006789MarineNYKVKIIMKVKAQAPSHKLRQIVAGQFDKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0098074_103299723300006790MarineMKVKAQAPSNKLRQIVAGQFDQLTKAQASSNKLRQNVKCFIPGRRVKNRFRRNI*
Ga0070754_1013228353300006810AqueousYKVKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0075481_1011389733300006868AqueousMKVTSNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFR
Ga0075479_1008125413300006870AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFRRNI*
Ga0070750_1013193113300006916AqueousVKIIMKVKAQAPSHKLRQIVAGQFVQLTKPQASSFRVRQSVKCFTPGKRVKNRFKRNV*
Ga0070750_1016574733300006916AqueousMKEKAQALSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGLRVKNRFNRKR*
Ga0070750_1030049513300006916AqueousMKVKAQATSNKLRQIVAGQFGKLTKPQASSDKLRQSVQCFKPGKRVKNRFRRNI*
Ga0070750_1035866213300006916AqueousMKVKAQAPSHKLRQIVAGQFGQWTKTQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0070746_1017975313300006919AqueousNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFKRNV*
Ga0070746_1046572013300006919AqueousMKVKAQAPSHKLRQIVAGQFGQWTKTQASSNKLRQSVQCFVPGRRVKN
Ga0098060_102367623300006921MarineMKEKAQAPSNKLRQIVAGQFVQLTKPQASGFRMRQSVQCFKPGRRVKNRFRRNI*
Ga0098060_106300613300006921MarineDYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFRRNI*
Ga0098060_110587923300006921MarineKRIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVKCFIPGRRVKNRFRRNI*
Ga0098060_122443313300006921MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSNKLRHNVQCFKPGKR
Ga0075468_1013411813300007229AqueousMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFIPGRRVNNLFRRNI*
Ga0075468_1019173023300007229AqueousIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDKLRQSVQCFKPGKRVKNRFRRNI*
Ga0075460_1019842923300007234AqueousNYYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0070753_106158743300007346AqueousMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFRRNI*
Ga0110931_104697943300007963MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSNKLRQSVQCFKPGKRVKNRFRRNI*
Ga0110931_116999513300007963MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSNKLRHNVQCFKPGKRVKNRFR
Ga0115566_1003585853300009071Pelagic MarineMKVKAQATSNKLRQIVAGQFGKLTKPQASGFKVRQSVQCFKPGKRVKNRFRRNI*
Ga0115545_118094513300009433Pelagic MarineMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRN
Ga0115546_102137063300009435Pelagic MarineMKVKAQATSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFRRNI*
Ga0098049_103645313300010149MarineMKVKAQAPNHKLRQIVAGQFVQLTKPQASSNKLRQSVQCFVPGRRVKNR
Ga0098049_120583913300010149MarineNDYKVKIIMKVKAQAPSNKLRQFVAGQFVQLTKPQASSNKLRQSVQCFKPGKRVKNRFRRNI*
Ga0098049_121210613300010149MarineMKVKAQAPSQKLRQIVAGQFDKLTKPQASSNKLRQSVQCFVPGRR
Ga0098049_124144723300010149MarineMKVKAQAPSHKLRQIVAGQFDKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0098059_104078033300010153MarineMKEKAQAPSNKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGRRV
Ga0129348_101778523300010296Freshwater To Marine Saline GradientMKQQASSNKLRHFVAGQFGKLTEVQASSNKLRHFVKCFTPGIRVKNRFNRKV*
Ga0136655_124539713300010316Freshwater To Marine Saline GradientNDYKVKIIMKVKAQAPSHKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFRRNI*
Ga0151666_103832413300011250MarineKVKAQAPSHKLRQIVAGQFGKLTKPQATSNKLRQSVQCFVPGRRVKNRFRRNI*
Ga0129327_1002324963300013010Freshwater To Marine Saline GradientMKVKAQAPSHKLQQIVAGQFGKLTKPQASSNNLRQSVQCFIPGRRVNNLFRRNI*
Ga0181377_101484033300017706MarineMKVKAQAPSHKLRQIVAGQFGKLTKPQATSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0181387_103096433300017709SeawaterYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSIRVRQSVQCFKPGRRVKNRFRRNI
Ga0181403_105779023300017710SeawaterYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFRRNI
Ga0181403_107210613300017710SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASGFKVRQSVQCFKPGRRVKNRFRRNI
Ga0181391_108306413300017713SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFR
Ga0181391_110883913300017713SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASGFKVRQSVQCFTPGKRVKNRFRRNI
Ga0181412_103662013300017714SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKVRQSVKCFTPGKRVKNRFRRNI
Ga0181383_109231213300017720SeawaterVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFRRNI
Ga0181373_106242613300017721MarineMKVKAQAPSNKLRQIVAGQFVQLTKPQASSNKLRQSVQCFKPGKRVKNRFRRN
Ga0181373_107305213300017721MarineKIIMKEKAQAPSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGRRVKNRFRRNI
Ga0181398_101301033300017725SeawaterMKEKAQAPSNKLRQIVAGQFGKLTKPQASGFKVRQSVQCFKPGRRVKNRFRRNI
Ga0181401_100974253300017727SeawaterMKEKAQAPSNKLRQIVAGQFVQLTKPQESGFRVRQSVQCFKPGRRVKNRFRRNI
Ga0181396_101424413300017729SeawaterKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0181416_102953443300017731SeawaterKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVKCFTPGKRVKNRFRRNI
Ga0187222_113190813300017734SeawaterAQAPSHKLRQIVAGQFGKLTKPQASGFKVRQSVQCFTPGKRVKNRFRRNI
Ga0187218_109456913300017737SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKN
Ga0181418_104096013300017740SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKVRQSVQCFKPGRRVKNRFRRNI
Ga0181421_104401833300017741SeawaterYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSFRVRQSVQCFKPGRRVKNRFRRNI
Ga0181402_103738813300017743SeawaterNDYKVKFIMKVKAEAPSNKLRQIVAGQFGKLTKPQASSFRVRQSVQCFKPGRRVKNRFRRNI
Ga0181393_107211413300017748SeawaterKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0181392_103899113300017749SeawaterNNYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKVRQSVQCFKPGRRVKNRFRRNI
Ga0187219_107969613300017751SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGR
Ga0181400_103325113300017752SeawaterMKVKAQAPSHKLRQIVAGQFGQWTKPQASSNKLRQSVQCFVPGRRVKNRSRRN
Ga0181407_113887423300017753SeawaterYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVKCFTPGKRVKNRFRRNI
Ga0181382_106235433300017756SeawaterIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0181409_105246713300017758SeawaterMKVKAQATSNKLRQIVAGQFGKLTKPQASSDKLRQSVQCFKPGKRVKNRFKRNI
Ga0181422_123080313300017762SeawaterMKVKAQAPSHKLQQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0181410_101955423300017763SeawaterMKEKAQAPSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGLRVKNRFNRKR
Ga0181413_116978213300017765SeawaterVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRSRRNI
Ga0187220_101881123300017768SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASGFKVRQSVQGFTPGKRVKNRFRRNI
Ga0181430_107048733300017772SeawaterDYKVKIIMKVKAQAPSHKLRQIVAGQFVQLTKPQASSNKVRQSVQCFKPGRRVKNRFRRN
Ga0181386_111214833300017773SeawaterAPSHKLRQIVAGQFGKLTKPQASSNKVRQSVKCFTPGKRVKNRFRRNI
Ga0181394_123104413300017776SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVK
Ga0181395_127283623300017779SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASGFKVRQSVKCFTPGKRVKNRFRRNI
Ga0181379_105720613300017783SeawaterMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFRRN
Ga0181607_1005034523300017950Salt MarshMKEKAQAPSNKLRQIAAGQFVQLTKPHASGFRMRQSVQCFKPGLRVKNRFNRKR
Ga0181591_1103251323300018424Salt MarshKAQAPSNKLRQIVAGQFDQLTKAQASSNKLRQSVQCFKPGKRVKNRFRRNI
Ga0193994_106752723300019738SedimentDYKVKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFRRN
Ga0194029_100347143300019751FreshwaterMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNRFRRNI
Ga0211658_105250523300020274MarineMKVKAQAPSQKLRQIVAGQFDKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0211507_107947113300020325MarineVIKKIFFMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQNVKCFIPGRRVKNRFRRN
Ga0211506_102896323300020365MarineMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQNVKCFIPGRRVKNRFRRNI
Ga0213862_1023564323300021347SeawaterMKVKAQAPSNKLRQIVAGQFDQLTKAQASSNKLRQSVQCFKPGKRVKNRFRRNI
Ga0212030_102887313300022053AqueousMKVTSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFIPGRRVNNLFRRNIS
Ga0196889_1000277133300022072AqueousMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0196903_104419113300022169AqueousMKVKAQAPSHKLQQIVAGQFGKLTKPQASSNNLRQSVQCFIPGRRVNNLFRRNI
Ga0196891_100277673300022183AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGRRVKNRFRRNI
Ga0208667_101878043300025070MarineMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0208791_102279443300025083MarineYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0208157_102875923300025086MarineMKVKAQAPSNKLRQIVAGQFVQLTKAQASSNKLRHNVQCFKPGKRVKNRFRRNI
Ga0208157_106350313300025086MarineMKVKAQAPNHKLRQIVAGQFVQLTKPQASSNRVRQSVQCFVPGRRVKNRFRRN
Ga0208434_1004882103300025098MarineMKVKAQAPSHKLRQIVAGQFGQWTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0208669_107627823300025099MarineDYKVKIIMKVKAQAPSHKLRQIVAGQFGKLTKPQASSRKLRQSVQCFVPGRRVKNRFRRN
Ga0208669_110525423300025099MarineKRIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVKCFIPGRRVKNRFRRNI
Ga0208666_111965513300025102MarineMKVKAQAPSHKLRQIVAGQFVQLTKAQASSNKLRQSVQCFKPGRRVKNRFRRNI
Ga0209535_100192113300025120MarineMKVKAQAPSHKLRQIVAGQFGKLTKPQASSFRVRQSVQCFKPGRRVKNRFRRNI
Ga0209535_1002152253300025120MarineMKVKAQAPSHKLRQIVAGQFGQWTKTQASSNKLRQSVQCFIPGRRVNNLFRRNI
Ga0208919_105168013300025128MarineDYKVKIIMKEKAQAPSNKLRQIAAGQFVQLTKPQASGFRMRQSVQCFKPGRRVKNRFRRN
Ga0208148_1000580263300025508AqueousMKVKAQAPSHKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGRRVKNRFRRNI
Ga0208149_100656223300025610AqueousMKVTSNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKRVKNRFRRNI
Ga0208004_112677313300025630AqueousVKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFRRNI
Ga0208134_111940913300025652AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASSFRVRQSVQCFKPGRRVKNRSRRNI
Ga0208134_114552913300025652AqueousMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDRLRQSVQCFKPGKRVKNR
Ga0208162_109460213300025674AqueousYKVKIIMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDKLRQSVQCFKPGKRVKNRFRRNI
Ga0208162_113170813300025674AqueousVKIIMKVKAQAPSNKLRQIVAGQFVQLTKPQASSFRVRQSVQCFKPGRRVKNRSRRNI
Ga0208150_103505713300025751AqueousMKEKAQALSNKLRQIAAGQFVQLTKPHASGFRMRQSVQCFKPGLRVKNRFNRKR
Ga0208899_107777513300025759AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGRRVKNRFR
Ga0208899_110645013300025759AqueousKLRQIVAGQFVQLTKPQASSFRVRQSVKCFTPGKRVKNRFKRNV
Ga0208899_122897813300025759AqueousMKVKAQAPSHKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGRRVKNRFR
Ga0208767_121983313300025769AqueousMKVKAQAPSHKLRQIVAGQFGKLTKPQASSNKLRQSVQCFVPGRRVKNRFR
Ga0208425_113586713300025803AqueousMKVTSNKLRQIVAGQFVQLTKPQASSFRVRQSVKCFTPGKRVKNRFRRN
Ga0208545_108774313300025806AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASGFRVRQSVKCFTPGKR
Ga0209308_1003617763300025869Pelagic MarineMKVKAQATSNKLRQIVAGQFGKLTKPQASGFKVRQSVQCFKPGKRVKNRFRRNI
Ga0183755_102718943300029448MarineMKVKAQAPSNKLRQIVAGQFGKLTKPQASSDKLRQSVQCFKPGKRVENRFRRNI
Ga0316201_1144811513300032136Worm BurrowMKVTSNKLRQIVAGQFVQLTKPQASGFRVRQSVQCFKPGKRVKNRFR
Ga0348335_187498_355_5163300034374AqueousMKVKAQAPSNKLRQIVAGQFVQLTKPQASSFRVRQSVQCFKPGRRVKNRFRRNI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.