NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062589

Metagenome / Metatranscriptome Family F062589

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062589
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 49 residues
Representative Sequence RDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED
Number of Associated Samples 119
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.08 %
% of genes near scaffold ends (potentially truncated) 93.08 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.615 % of family members)
Environment Ontology (ENVO) Unclassified
(23.846 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.231 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.00%    β-sheet: 0.00%    Coil/Unstructured: 52.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF13343SBP_bac_6 43.85
PF01557FAA_hydrolase 10.77
PF03401TctC 1.54
PF12826HHH_2 0.77
PF13175AAA_15 0.77
PF00764Arginosuc_synth 0.77
PF02900LigB 0.77
PF00903Glyoxalase 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.54
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.23 %
UnclassifiedrootN/A0.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12596972All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300002568|C688J35102_118929533All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300004114|Ga0062593_101788463All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria675Open in IMG/M
3300005148|Ga0066819_1013882All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005163|Ga0066823_10147067All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300005166|Ga0066674_10321527All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales727Open in IMG/M
3300005169|Ga0066810_10060012All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales765Open in IMG/M
3300005177|Ga0066690_10311111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1065Open in IMG/M
3300005179|Ga0066684_10197994All Organisms → cellular organisms → Bacteria → Proteobacteria1298Open in IMG/M
3300005330|Ga0070690_100190997All Organisms → cellular organisms → Bacteria → Proteobacteria1420Open in IMG/M
3300005332|Ga0066388_100904320All Organisms → cellular organisms → Bacteria → Proteobacteria1460Open in IMG/M
3300005332|Ga0066388_106809583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300005340|Ga0070689_100720833All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales872Open in IMG/M
3300005347|Ga0070668_101847386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales556Open in IMG/M
3300005364|Ga0070673_100453230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1154Open in IMG/M
3300005367|Ga0070667_100197571All Organisms → cellular organisms → Bacteria → Proteobacteria1784Open in IMG/M
3300005440|Ga0070705_101163301All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria634Open in IMG/M
3300005451|Ga0066681_10992401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales501Open in IMG/M
3300005540|Ga0066697_10174049All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1276Open in IMG/M
3300005549|Ga0070704_100599658All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales968Open in IMG/M
3300005552|Ga0066701_10223965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1159Open in IMG/M
3300005557|Ga0066704_10311371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1062Open in IMG/M
3300005576|Ga0066708_10055262All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2236Open in IMG/M
3300005618|Ga0068864_100089151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae2717Open in IMG/M
3300005713|Ga0066905_102033493All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria533Open in IMG/M
3300005764|Ga0066903_100748101All Organisms → cellular organisms → Bacteria → Proteobacteria1735Open in IMG/M
3300005764|Ga0066903_108502019All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria523Open in IMG/M
3300005981|Ga0081538_10153321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1039Open in IMG/M
3300006031|Ga0066651_10408188All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300006038|Ga0075365_10734045All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria697Open in IMG/M
3300006046|Ga0066652_101215645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria713Open in IMG/M
3300006797|Ga0066659_11097148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300006844|Ga0075428_101941803All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300006846|Ga0075430_100112301All Organisms → cellular organisms → Bacteria → Proteobacteria2272Open in IMG/M
3300006871|Ga0075434_102185623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales557Open in IMG/M
3300006903|Ga0075426_10298199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1179Open in IMG/M
3300006904|Ga0075424_101871550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300006953|Ga0074063_10082785All Organisms → cellular organisms → Bacteria → Proteobacteria2623Open in IMG/M
3300009090|Ga0099827_10173315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1779Open in IMG/M
3300009094|Ga0111539_11897162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300009094|Ga0111539_12248629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300009100|Ga0075418_11862093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300009100|Ga0075418_13178140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300009101|Ga0105247_10162964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1478Open in IMG/M
3300009162|Ga0075423_12416571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300010333|Ga0134080_10387064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria644Open in IMG/M
3300010336|Ga0134071_10570064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300010337|Ga0134062_10028906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2172Open in IMG/M
3300010360|Ga0126372_11167478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300010360|Ga0126372_12003983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300010361|Ga0126378_12839854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300010362|Ga0126377_12179308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300010371|Ga0134125_11399815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300010373|Ga0134128_10094863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3393Open in IMG/M
3300010403|Ga0134123_10051621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3099Open in IMG/M
3300011106|Ga0151489_1028654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300011270|Ga0137391_10250489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1535Open in IMG/M
3300011271|Ga0137393_11390977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300012189|Ga0137388_10629358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria997Open in IMG/M
3300012212|Ga0150985_109052542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1499Open in IMG/M
3300012362|Ga0137361_10541269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1069Open in IMG/M
3300012363|Ga0137390_10481949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1215Open in IMG/M
3300012908|Ga0157286_10262495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300012913|Ga0157298_10424486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300012917|Ga0137395_10055163All Organisms → cellular organisms → Bacteria → Proteobacteria2516Open in IMG/M
3300012927|Ga0137416_12074219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300012929|Ga0137404_10223622All Organisms → cellular organisms → Bacteria → Proteobacteria1605Open in IMG/M
3300012929|Ga0137404_12108549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300012929|Ga0137404_12165615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300012944|Ga0137410_10382622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1131Open in IMG/M
3300012955|Ga0164298_10062506All Organisms → cellular organisms → Bacteria → Proteobacteria1839Open in IMG/M
3300012988|Ga0164306_10913088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300012989|Ga0164305_11022294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300012989|Ga0164305_11184836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria661Open in IMG/M
3300013306|Ga0163162_10209063All Organisms → cellular organisms → Bacteria → Proteobacteria2081Open in IMG/M
3300015359|Ga0134085_10306374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300015371|Ga0132258_11839771All Organisms → cellular organisms → Bacteria → Proteobacteria1525Open in IMG/M
3300015372|Ga0132256_100837167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin11036Open in IMG/M
3300015373|Ga0132257_101323488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria915Open in IMG/M
3300018053|Ga0184626_10392957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300018465|Ga0190269_11109806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria611Open in IMG/M
3300018468|Ga0066662_10731877All Organisms → cellular organisms → Bacteria → Proteobacteria949Open in IMG/M
3300018468|Ga0066662_12016679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300020002|Ga0193730_1052469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1175Open in IMG/M
3300021363|Ga0193699_10142880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria982Open in IMG/M
3300021560|Ga0126371_10990637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria982Open in IMG/M
3300025899|Ga0207642_10097407All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300025915|Ga0207693_10885108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300025916|Ga0207663_10133624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin11718Open in IMG/M
3300025928|Ga0207700_11298110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300025929|Ga0207664_10528843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin11057Open in IMG/M
3300025936|Ga0207670_11040545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300025939|Ga0207665_10602414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria858Open in IMG/M
3300025960|Ga0207651_10776259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria848Open in IMG/M
3300026078|Ga0207702_10166591All Organisms → cellular organisms → Bacteria → Proteobacteria2017Open in IMG/M
3300026330|Ga0209473_1121354Not Available1083Open in IMG/M
3300026361|Ga0257176_1076360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300026490|Ga0257153_1005558All Organisms → cellular organisms → Bacteria → Proteobacteria2476Open in IMG/M
3300026551|Ga0209648_10019808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605882Open in IMG/M
3300026552|Ga0209577_10479694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300026552|Ga0209577_10623560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300027310|Ga0207983_1011239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1026Open in IMG/M
3300027633|Ga0208988_1053242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1029Open in IMG/M
3300027909|Ga0209382_10118313All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax3092Open in IMG/M
3300028379|Ga0268266_11476134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300028710|Ga0307322_10108421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300028712|Ga0307285_10013146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1814Open in IMG/M
3300028714|Ga0307309_10028489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1130Open in IMG/M
3300028715|Ga0307313_10038199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1378Open in IMG/M
3300028790|Ga0307283_10170770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria610Open in IMG/M
3300028807|Ga0307305_10234820All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales839Open in IMG/M
3300028824|Ga0307310_10344715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria731Open in IMG/M
3300028828|Ga0307312_10630298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria709Open in IMG/M
3300028876|Ga0307286_10372228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300028881|Ga0307277_10477632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300031544|Ga0318534_10043060All Organisms → cellular organisms → Bacteria → Proteobacteria2510Open in IMG/M
3300031572|Ga0318515_10269309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria913Open in IMG/M
3300031573|Ga0310915_10573124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria800Open in IMG/M
3300031764|Ga0318535_10012535All Organisms → cellular organisms → Bacteria → Proteobacteria3073Open in IMG/M
3300031771|Ga0318546_10873075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300031819|Ga0318568_10907118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300031845|Ga0318511_10149462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1020Open in IMG/M
3300031896|Ga0318551_10118534All Organisms → cellular organisms → Bacteria → Proteobacteria1423Open in IMG/M
3300031912|Ga0306921_12284121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300032035|Ga0310911_10517860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300032075|Ga0310890_10744763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria771Open in IMG/M
3300032180|Ga0307471_101251473All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300032180|Ga0307471_103781082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300032261|Ga0306920_102064883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300034151|Ga0364935_0190907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.54%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.31%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.54%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.77%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.77%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1259697213300000789SoilWNELANAALRDPVVRDQIAGLDYEARGGTAKEFSDFVMLDISRYKHLAQDMGLGED*
C688J35102_11892953323300002568SoilDPKVRDQISALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0062593_10178846313300004114SoilVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0066819_101388223300005148SoilVTRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0066823_1014706713300005163SoilDAKVREQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066674_1032152723300005166SoilRAQISALDYEIRGGTPAEFANFMTLDISRYARLAQDMGLGED*
Ga0066810_1006001213300005169SoilIVTRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYNKLAADMGLAED
Ga0066690_1031111113300005177SoilNAALRVAKVREQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066684_1019799423300005179SoilVARWNELANAALHDPKLRDQVSALDYEVRGGTAKEFAEFMMHDISRYKRLAEDMALAED*
Ga0070690_10019099713300005330Switchgrass RhizosphereRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0066388_10090432033300005332Tropical Forest SoilALRESAVRDQIAALDYEARGGTAREFSDFIMLDISRYKHLAHDMGLGED*
Ga0066388_10680958313300005332Tropical Forest SoilRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE*
Ga0070689_10072083313300005340Switchgrass RhizosphereKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0070668_10184738623300005347Switchgrass RhizosphereDALRDAKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0070673_10045323023300005364Switchgrass RhizosphereRDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0070667_10019757133300005367Switchgrass RhizosphereTRWNELANDALRDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0070705_10116330113300005440Corn, Switchgrass And Miscanthus RhizosphereDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0066681_1099240123300005451SoilEAVVARWNELANAALLDAKLRDQVSALDYGVRGGSAKEFAEFMMHGISRYKRLAEDMALAED*
Ga0066697_1017404913300005540SoilPRIVSNANAALRVAKVREQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0070704_10059965813300005549Corn, Switchgrass And Miscanthus RhizosphereAIVTRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0066701_1022396523300005552SoilALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066704_1031137123300005557SoilMPRLDYGIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066708_1005526233300005576SoilNELANAALRDAAVRDQIAGLDYEARGGTAREFSDFVILDISRYKHLAQDMGLGED*
Ga0068864_10008915113300005618Switchgrass RhizosphereRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0066905_10203349323300005713Tropical Forest SoilAVVARWNELANAALRDPKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066903_10074810113300005764Tropical Forest SoilEQIATLDYDIRGGAIAEFTDYFTRDISRYKKLAEDMGLAED*
Ga0066903_10850201923300005764Tropical Forest SoilQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE*
Ga0081538_1015332113300005981Tabebuia Heterophylla RhizosphereALDYDVRGGSARDFAGVLALDIGRYRKLAEDMGLAED*
Ga0066651_1040818813300006031SoilKLRDQVSALDYEVRGGTAKEFAEFKMHDISRYKRLAEDMALAED*
Ga0075365_1073404513300006038Populus EndosphereLANEALRDPKVRDQISALDYDIRGGSAKEFAEFIALDISRYKKLAADMGLAED*
Ga0066652_10121564523300006046SoilYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0066659_1109714813300006797SoilEAMRDPKVRDQIAALDYDVRGGTAKAFADFIALDISRYRKLAVDMGLSED*
Ga0075428_10194180313300006844Populus RhizosphereELANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0075430_10011230133300006846Populus RhizosphereNDALGDTKLREQISALDYDVRGGSAREFAEFLVLDIGRYRKLAEDMGLAED*
Ga0075434_10218562323300006871Populus RhizosphereLANEALRDPRTQEQIAALDYDARGGTVAQFADFLARDISRYKKLAEDMGLAED*
Ga0075426_1029819913300006903Populus RhizosphereISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0075424_10187155023300006904Populus RhizosphereSALDYDVRGGSVREFAEFLALDIGRYRKLAEDLGLAED*
Ga0074063_1008278513300006953SoilDQITALDYDIRGGSAKEFAEFITLDINRYKKLAADMGLAED*
Ga0099827_1017331513300009090Vadose Zone SoilDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0111539_1189716223300009094Populus RhizosphereRDQITALDYDIRGGSAKEFAEFIALDISRYKKLAADMGLAED*
Ga0111539_1224862913300009094Populus RhizosphereLGDTKLREQISALDYDVRGGSAREFAEFLVLDIGRYRKLAEDMGLAED*
Ga0075418_1186209313300009100Populus RhizosphereKLREQISALDYDVRGGSAREFAEFLVLDIGRYRKLAEDMGLAED*
Ga0075418_1317814023300009100Populus RhizosphereRWNELVNDALGDPKLREQISALDYDVRGGSAREFAEFLALDIARYRKLAEDMGLAED*
Ga0105247_1016296423300009101Switchgrass RhizosphereWNELANEALRDPKVRDQITALDYDIRGGSAKEFAAFIALDINRYKKLAADMGLGED*
Ga0075423_1241657123300009162Populus RhizosphereLDYDVRGGSAKDFAEYLALDIGRYKKLAEDMGLTED*
Ga0134080_1038706413300010333Grasslands SoilIAGLDYEARGGTAREFSDFIILDISRYKHLAQDMGLGED*
Ga0134071_1057006413300010336Grasslands SoilGLDYEARGGTAREFSDFVILDISRYKHLAQDMGLGED*
Ga0134062_1002890633300010337Grasslands SoilAALRDPTLRAQISALDYEIRGGTPAEFANFMTLDISRYARLAQDMGLGED*
Ga0126372_1116747823300010360Tropical Forest SoilVVARWNELANAALNDPKLRDQVSALDYEVRGGTAKEFAEFMMHDLSRYKRLAEDMALAED
Ga0126372_1200398313300010360Tropical Forest SoilIAALDYDIRGGTITEFTDYFTRDITRYKKLAEDMSLAED*
Ga0126378_1283985423300010361Tropical Forest SoilSALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE*
Ga0126377_1217930823300010362Tropical Forest SoilPESVVARWNELANAALNDPKLRDQVSALDYEVRGGTAKEFAEFMMHDISRYKRLAEGMGLAED*
Ga0134125_1139981513300010371Terrestrial SoilQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLGED*
Ga0134128_1009486343300010373Terrestrial SoilLANDALRDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0134123_1005162143300010403Terrestrial SoilVTRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAAFIALDINRYKKLAADMGLGED*
Ga0151489_102865423300011106SoilTALDYDIRGGSAKEFAAFIALDINRYKKLAADMGLGED*
Ga0137391_1025048913300011270Vadose Zone SoilVISRWNELANAALRDPVVRDQISALDYEARGGTAREFSDFVMLDISRYKQLAQDMGLGED
Ga0137393_1139097713300011271Vadose Zone SoilQVSALDYDIRGGTSAQFADFLAQDISRYKKLAEDMGLAED*
Ga0137388_1062935823300012189Vadose Zone SoilSAMDYDIRGGTPSEFIQFLASDISRCKKLADDMGFAED*
Ga0150985_10905254213300012212Avena Fatua RhizosphereGRWNELVNESLNDPKLREQISALDYDIRGGTAGEFMRFLASDISRYKKLADDMGLAED*
Ga0137361_1054126923300012362Vadose Zone SoilDAVVARWNELANAALRDPKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE*
Ga0137390_1048194913300012363Vadose Zone SoilALGDPKLREQISLMDYEVRGGTASAFMQFLTADISRYKKLADDMGLAED*
Ga0157286_1026249523300012908SoilSRWNELANEALRDPKVRDQITALDYDIRGGSAKEFAEFITLDISRYKKLAADMGLAED*
Ga0157298_1042448613300012913SoilQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0137395_1005516343300012917Vadose Zone SoilPRIVSNANAALRDAKVREQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE*
Ga0137416_1207421913300012927Vadose Zone SoilSVVARWNQLVNEALGDPKLREQISLMDYEVRGGTASAFMQFLTADISRYKKLADDMGLAED*
Ga0137404_1022362213300012929Vadose Zone SoilDPTLRAQISALDYEIRGGTPAEFADFMTLDITRYTRLAQDMGLGED*
Ga0137404_1210854913300012929Vadose Zone SoilLREQIAALDYDIRGGTAAQFADFIAADISRYKKLAEDMGLAED*
Ga0137404_1216561523300012929Vadose Zone SoilRWNELTNEALRDPKLRDQISALDYDIRGGTVTEFADFLTADINRYKKLAEDMGLAED*
Ga0137410_1038262213300012944Vadose Zone SoilDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED*
Ga0164298_1006250633300012955SoilRWNELANEALRDPKVRDQITALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0164306_1091308813300012988SoilRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0164305_1102229413300012989SoilDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED*
Ga0164305_1118483623300012989SoilVREQISALDYDIRGGTAGEFAAFVSLDISRYKRPAEDMGLAEE*
Ga0163162_1020906333300013306Switchgrass RhizosphereELANDALRDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED*
Ga0134085_1030637423300015359Grasslands SoilQISALDYDIRGGTAREFAQFFTLDISRYKKLAEDMGLAED*
Ga0132258_1183977133300015371Arabidopsis RhizosphereARWNELTNEAMRDPTVRAQIFALDYDIRGGSAKEFADFMALDIGRYKKLAEDMGLAED*
Ga0132256_10083716713300015372Arabidopsis RhizosphereELANAALRDPKLRDQVSALDYEVRGGTAEEFAEFMMHDISRYKRLAEDMALIED*
Ga0132257_10132348823300015373Arabidopsis RhizosphereLREQISALDYDVRGGAVREFAEFLSLDIGRYRKLAEDLGLAED*
Ga0184626_1039295723300018053Groundwater SedimentVNEALRDPKVREQISALDYDIRGGTAREFTDFFTSDMSRYRKLAEDMGLSED
Ga0190269_1110980623300018465SoilLDYDVRGGTAPQFADFIAVDISRYKKLAEDMGLAED
Ga0066662_1073187723300018468Grasslands SoilVCATPRCGKLRDQVSALDYEVRGGTAKEFSEFMMHDISRYKRLAEDMALAED
Ga0066662_1201667923300018468Grasslands SoilSALDYEIRGGTPAEFANFMTLDISRYTRLAQDMGLGED
Ga0193730_105246913300020002SoilNELANDALRDPKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0193699_1014288013300021363SoilLANDALRDPKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0126371_1099063713300021560Tropical Forest SoilLRDAKVREQISALDYDSRGGTAGEFAAFIRLDISRYKRLAEDMGLAEE
Ga0207642_1009740713300025899Miscanthus RhizosphereKLRDQVSTLDYEVRGGTAKEFADFVMHDISRYKRLAEDMGLAED
Ga0207693_1088510823300025915Corn, Switchgrass And Miscanthus RhizospherePKLRDQVSTLDYEVRGGTAKEFADFVMHDISRYKRLAEDMGLAED
Ga0207663_1013362423300025916Corn, Switchgrass And Miscanthus RhizosphereELANTALRDPKLRDQVSTLDYEVRGGTAKEFADFVMHDISRYKRLAEDMGLAED
Ga0207700_1129811023300025928Corn, Switchgrass And Miscanthus RhizosphereVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAE
Ga0207664_1052884313300025929Agricultural SoilVVARWNELANTALRDPKLRDQVSTLDYEVRGGTAKEFADFVMHDISRYKRLAEDMGLAED
Ga0207670_1104054523300025936Switchgrass RhizosphereRDAKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED
Ga0207665_1060241413300025939Corn, Switchgrass And Miscanthus RhizosphereIVSNANAALRDDKVREQISALDYDIRGGTAGEFAAFVSLDISRYKRLAEDMGLAEE
Ga0207651_1077625923300025960Switchgrass RhizosphereRDPKVREQISALDYDIRGGTAKEFAEFVALDINRYKKLAADMGLAED
Ga0207702_1016659113300026078Corn RhizosphereRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED
Ga0209473_112135423300026330SoilVARWNELANAALHDAKLRDQVSALDYEVRGGTAKEFAEFMMHDISRYKRLAEDMALAED
Ga0257176_107636023300026361SoilVVRDQISALDYEARGGTAREFSDFVMLDISRYKQLAQDMGLGED
Ga0257153_100555813300026490SoilQISALDYEARGGTAREFSDFVMLDISRYKQLAQDMGLGED
Ga0209648_1001980863300026551Grasslands SoilRWNELANAALRDPVVRDQISALDYEARGGTAREFSDFVMLDISRYKQLAQDMGLGED
Ga0209577_1047969413300026552SoilAALRDAAVRDQIAGLDYEARGGTAREFSDFVILDISRYKHLAQDMGLGED
Ga0209577_1062356023300026552SoilREQVSALDYEVRGGTSKEFADFMMHDINRYKRLAEDMGLAEE
Ga0207983_101123923300027310SoilLRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED
Ga0208988_105324213300027633Forest SoilTRWNELANDALRDPKVRDQISALDYDIRGGTPREFAEFVALDISRYKKLAADMGLAED
Ga0209382_1011831333300027909Populus RhizosphereGQISALDYEIRGGTPTEFAAFMTLDISRYTRLAQDMGLGED
Ga0268266_1147613413300028379Switchgrass RhizosphereSALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED
Ga0307322_1010842113300028710SoilLDYDIRGGSAKEFADFIALDISRYKKLAADMGLAED
Ga0307285_1001314623300028712SoilVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED
Ga0307309_1002848923300028714SoilKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0307313_1003819913300028715SoilTNDALRDPKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0307283_1017077023300028790SoilLRDPKVRDQITALDYDIRGGSAKEFADFIALDISRYKKLAADMGLAED
Ga0307305_1023482023300028807SoilVTRWNQLANDALRDPKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0307310_1034471523300028824SoilDAIVTRWNELTNDALRDPKVRDQISALDYDIRGGTAKDFADFVALDIGRYKKLAADMGLAED
Ga0307312_1063029813300028828SoilLRDPKVRDQISALDYDMRGGTAKDFANFIALDIGRYKKLAADMGLAED
Ga0307286_1037222813300028876SoilELANEALRDPKVRDQITALDYDIRGGSAKEFADFIALDISRYKKLAADMGLAED
Ga0307277_1047763223300028881SoilMRDPKVRDQISALDYDIRGGTASAFAAFLTLDISRYKKLAEAMGLAEE
Ga0318534_1004306043300031544SoilRWNELANAALRDSKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0318515_1026930923300031572SoilRDPKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0310915_1057312423300031573SoilVARWNELANAALRDSKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0318535_1001253543300031764SoilELANAALRDPKVRDQTSALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0318546_1087307523300031771SoilRDAKVREQISALDYDIRGGTTGEFAAFVSLDISRYKRLAEDMGLAEE
Ga0318568_1090711823300031819SoilLANAALRDPKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0318511_1014946223300031845SoilPDALVARWNELANAALRDAKVREQISALDYDIRGGTTGEFAAFVSLDISRYKRLAEDMGLAEE
Ga0318551_1011853413300031896SoilDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0306921_1228412123300031912SoilDYDVRGGTPKEFADFIGLDIGRYRKLAEAMGLAED
Ga0310911_1051786023300032035SoilELANAALRDAKVREQISALDYDIRGGTTGEFAAFVSLDISRYKRLAEDMGLAEE
Ga0310890_1074476323300032075SoilPKIRDQISALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED
Ga0307471_10125147323300032180Hardwood Forest SoilVNEALRDRTLREQIVVLDYEVRGGSAEFRDFIALDISRYKKLAADMSLAED
Ga0307471_10378108213300032180Hardwood Forest SoilVRPGSAGWHAEAVVARWNELANAALRDPKLREQVSALDYEVRGGTAKEFADFMMHDISRYKRLAED
Ga0306920_10206488323300032261SoilNAVVARWNELANAALRDPKVRDQISALDYDIRGGTAGEFAAFVSLDISRYKKLAEDMGLAEE
Ga0364935_0190907_499_6573300034151SedimentANEALRDPKVRDQITALDYDIRGGSAKEFAEFIALDINRYKKLAADMGLAED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.