NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062490

Metagenome / Metatranscriptome Family F062490

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062490
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 39 residues
Representative Sequence MAKQFFGGFFATLAFVAVVLAALFGIFTLVSYIAGPVGG
Number of Associated Samples 105
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.62 %
% of genes near scaffold ends (potentially truncated) 21.54 %
% of genes from short scaffolds (< 2000 bps) 72.31 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.308 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(16.923 % of family members)
Environment Ontology (ENVO) Unclassified
(28.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(28.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.25%    β-sheet: 0.00%    Coil/Unstructured: 50.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01987AIM24 36.92
PF13307Helicase_C_2 12.31
PF00202Aminotran_3 3.85
PF03358FMN_red 3.85
PF00005ABC_tran 3.08
PF12840HTH_20 3.08
PF01022HTH_5 2.31
PF11074DUF2779 1.54
PF01061ABC2_membrane 0.77
PF12320SbcD_C 0.77
PF06089Asparaginase_II 0.77
PF03747ADP_ribosyl_GH 0.77
PF02579Nitro_FeMo-Co 0.77
PF12698ABC2_membrane_3 0.77
PF03167UDG 0.77
PF13476AAA_23 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG2013AIM24 protein, required for mitochondrial respirationEnergy production and conversion [C] 36.92
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.77
COG1397ADP-ribosylglycohydrolasePosttranslational modification, protein turnover, chaperones [O] 0.77
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.77
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.77
COG4448L-asparaginase IIAmino acid transport and metabolism [E] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.31 %
UnclassifiedrootN/A7.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000506|Soeholt_1000679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941853Open in IMG/M
3300000553|TBL_comb47_HYPODRAFT_10046883All Organisms → cellular organisms → Bacteria2689Open in IMG/M
3300000553|TBL_comb47_HYPODRAFT_10112357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941297Open in IMG/M
3300001213|JGIcombinedJ13530_103673159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094698Open in IMG/M
3300002069|JGIcombinedJ21912_10075479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941373Open in IMG/M
3300002069|JGIcombinedJ21912_10153722All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300002069|JGIcombinedJ21912_10275829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094536Open in IMG/M
3300002549|JGI24130J36418_10009258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3200Open in IMG/M
3300002565|JGI24137J36423_1004449All Organisms → cellular organisms → Bacteria4302Open in IMG/M
3300004028|Ga0055447_10091123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094866Open in IMG/M
3300004072|Ga0055512_10075085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094649Open in IMG/M
3300004146|Ga0055495_10143360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094598Open in IMG/M
3300004481|Ga0069718_15772469All Organisms → cellular organisms → Bacteria3510Open in IMG/M
3300004776|Ga0007800_10067118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094863Open in IMG/M
3300004779|Ga0062380_10449687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094566Open in IMG/M
3300005144|Ga0068711_1012256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942799Open in IMG/M
3300005217|Ga0069005_10058789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094861Open in IMG/M
3300005217|Ga0069005_10070373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094811Open in IMG/M
3300005938|Ga0066795_10006474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3078Open in IMG/M
3300006102|Ga0075015_100752426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094582Open in IMG/M
3300006950|Ga0075524_10244181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094784Open in IMG/M
3300006972|Ga0075518_1008163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942250Open in IMG/M
3300009078|Ga0105106_10098853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942148Open in IMG/M
3300009078|Ga0105106_10580220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094804Open in IMG/M
3300009085|Ga0105103_10961623Not Available503Open in IMG/M
3300009087|Ga0105107_10123397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941824Open in IMG/M
3300009087|Ga0105107_10607020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094762Open in IMG/M
3300009087|Ga0105107_10750125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094679Open in IMG/M
3300009091|Ga0102851_12241882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094622Open in IMG/M
3300009120|Ga0117941_1040333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941241Open in IMG/M
3300009120|Ga0117941_1102544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094780Open in IMG/M
3300009131|Ga0115027_11283496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094590Open in IMG/M
3300009167|Ga0113563_10994185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094965Open in IMG/M
3300009167|Ga0113563_11427646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094813Open in IMG/M
3300009175|Ga0073936_10009428All Organisms → cellular organisms → Bacteria12136Open in IMG/M
3300009179|Ga0115028_11168097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094631Open in IMG/M
3300009503|Ga0123519_10685392Not Available531Open in IMG/M
3300009607|Ga0123327_1067531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941389Open in IMG/M
3300009670|Ga0116183_1440691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094536Open in IMG/M
3300009689|Ga0116186_1004077All Organisms → cellular organisms → Bacteria12031Open in IMG/M
3300009868|Ga0130016_10031722All Organisms → cellular organisms → Bacteria → Proteobacteria6405Open in IMG/M
3300009868|Ga0130016_10371578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094962Open in IMG/M
3300010347|Ga0116238_10554892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094723Open in IMG/M
3300012005|Ga0120161_1117832Not Available615Open in IMG/M
(restricted) 3300013122|Ga0172374_1089151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941192Open in IMG/M
(restricted) 3300013123|Ga0172368_10387629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094633Open in IMG/M
3300014257|Ga0075319_1004482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941862Open in IMG/M
3300014258|Ga0075315_1003252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941833Open in IMG/M
3300014261|Ga0075360_1100793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094570Open in IMG/M
3300014298|Ga0075341_1130739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094520Open in IMG/M
3300014316|Ga0075339_1022448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941500Open in IMG/M
3300014322|Ga0075355_1024821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941228Open in IMG/M
3300014322|Ga0075355_1220962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094535Open in IMG/M
3300014502|Ga0182021_11939322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094709Open in IMG/M
3300016687|Ga0180047_1079075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094533Open in IMG/M
3300017944|Ga0187786_10202324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094756Open in IMG/M
3300017947|Ga0187785_10245967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094799Open in IMG/M
3300020163|Ga0194039_1033151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941986Open in IMG/M
3300020163|Ga0194039_1163786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094763Open in IMG/M
3300020228|Ga0194040_1206781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094581Open in IMG/M
3300021070|Ga0194056_10088578All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300021520|Ga0194053_10065482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941568Open in IMG/M
3300025461|Ga0208851_1002660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0945108Open in IMG/M
3300025499|Ga0207931_1001744All Organisms → cellular organisms → Bacteria6560Open in IMG/M
3300025533|Ga0208584_1108781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094657Open in IMG/M
3300025548|Ga0208716_1086909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094628Open in IMG/M
3300025564|Ga0210084_1038012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094917Open in IMG/M
3300025724|Ga0208196_1011147All Organisms → cellular organisms → Bacteria → Proteobacteria5169Open in IMG/M
3300025829|Ga0209484_10046581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094937Open in IMG/M
3300025846|Ga0209538_1268349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094611Open in IMG/M
3300025852|Ga0209124_10265513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094658Open in IMG/M
3300025857|Ga0209014_10028070All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300025888|Ga0209540_10062997All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300025888|Ga0209540_10383407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094772Open in IMG/M
3300025891|Ga0209585_10096057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941120Open in IMG/M
3300027051|Ga0209269_1000019All Organisms → cellular organisms → Bacteria434838Open in IMG/M
3300027818|Ga0209706_10057423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941958Open in IMG/M
3300027818|Ga0209706_10564026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094515Open in IMG/M
3300027863|Ga0207433_10571736Not Available643Open in IMG/M
3300027885|Ga0209450_10039454All Organisms → cellular organisms → Bacteria2843Open in IMG/M
3300027897|Ga0209254_10538741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094836Open in IMG/M
3300027899|Ga0209668_10375354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094927Open in IMG/M
3300027900|Ga0209253_10653822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094764Open in IMG/M
3300027902|Ga0209048_10008361All Organisms → cellular organisms → Bacteria9457Open in IMG/M
3300028032|Ga0265296_1008165All Organisms → cellular organisms → Bacteria7628Open in IMG/M
3300028176|Ga0268284_1011318All Organisms → cellular organisms → Bacteria → Terrabacteria group2862Open in IMG/M
3300028665|Ga0302160_10117814Not Available597Open in IMG/M
3300028679|Ga0302169_10074371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094805Open in IMG/M
3300028732|Ga0302264_1003250All Organisms → cellular organisms → Bacteria3951Open in IMG/M
3300028733|Ga0302261_1171224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094518Open in IMG/M
3300028764|Ga0302260_1076917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094689Open in IMG/M
(restricted) 3300029286|Ga0247841_10092656All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300029288|Ga0265297_10127903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941966Open in IMG/M
3300029987|Ga0311334_10581829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094907Open in IMG/M
3300030010|Ga0302299_10083377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941771Open in IMG/M
3300030294|Ga0311349_10658263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094989Open in IMG/M
3300031746|Ga0315293_10002692All Organisms → cellular organisms → Bacteria17071Open in IMG/M
3300031834|Ga0315290_10074796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2807Open in IMG/M
3300031834|Ga0315290_10081884All Organisms → cellular organisms → Bacteria2689Open in IMG/M
3300031834|Ga0315290_10204797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1715Open in IMG/M
3300031834|Ga0315290_10224559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941636Open in IMG/M
3300031834|Ga0315290_10238006Not Available1587Open in IMG/M
3300031918|Ga0311367_10464576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941300Open in IMG/M
3300031997|Ga0315278_10025971All Organisms → cellular organisms → Bacteria → Proteobacteria5597Open in IMG/M
3300031997|Ga0315278_10026257All Organisms → cellular organisms → Bacteria5568Open in IMG/M
3300031997|Ga0315278_10110027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942785Open in IMG/M
3300031997|Ga0315278_10247693All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300032018|Ga0315272_10036231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942231Open in IMG/M
3300032143|Ga0315292_11652951Not Available515Open in IMG/M
3300032156|Ga0315295_10139242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942404Open in IMG/M
3300032173|Ga0315268_10125857All Organisms → cellular organisms → Bacteria2423Open in IMG/M
3300032173|Ga0315268_12165192Not Available570Open in IMG/M
3300032173|Ga0315268_12533845Not Available526Open in IMG/M
3300032256|Ga0315271_10000966All Organisms → cellular organisms → Bacteria16940Open in IMG/M
3300032256|Ga0315271_10735609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094848Open in IMG/M
3300032263|Ga0316195_10352729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094777Open in IMG/M
3300032275|Ga0315270_10084980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941830Open in IMG/M
3300032276|Ga0316188_10364311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094755Open in IMG/M
3300032342|Ga0315286_10326452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941621Open in IMG/M
3300032397|Ga0315287_11331234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094820Open in IMG/M
3300032401|Ga0315275_10403990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941531Open in IMG/M
3300032562|Ga0316226_1000978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria33694Open in IMG/M
3300032605|Ga0316232_1345374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094544Open in IMG/M
3300032782|Ga0335082_10091969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0943023Open in IMG/M
3300032897|Ga0335071_10110341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942697Open in IMG/M
3300032897|Ga0335071_12110669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094506Open in IMG/M
3300033418|Ga0316625_100580728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094909Open in IMG/M
3300033521|Ga0316616_100642273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941257Open in IMG/M
3300033810|Ga0314872_035165Not Available502Open in IMG/M
3300034123|Ga0370479_0021665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941500Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment16.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil13.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands6.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen6.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.15%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.85%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater3.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.08%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.08%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge3.08%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.31%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.54%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring1.54%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment1.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.54%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater1.54%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.54%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.77%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.77%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.77%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.77%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.77%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.77%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.77%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.77%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.77%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.77%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.77%
Anaerobic DigesterEngineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester0.77%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000506Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludgeEngineeredOpen in IMG/M
3300000553Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002069Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300002565Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311EnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300004072Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2EnvironmentalOpen in IMG/M
3300004146Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004776Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14MEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005144Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaGEngineeredOpen in IMG/M
3300005217Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300006972Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-AEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009607Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNAEngineeredOpen in IMG/M
3300009670Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaGEngineeredOpen in IMG/M
3300009689Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaGEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010347AD_JPHGcaEngineeredOpen in IMG/M
3300012005Permafrost microbial communities from Nunavut, Canada - A15_80cm_0MEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014258Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1EnvironmentalOpen in IMG/M
3300014261Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016687Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300020228Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10mEnvironmentalOpen in IMG/M
3300021070Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13mEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025499Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025548Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025564Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025724Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025829Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes)EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300027051Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300028176Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40mEnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028732Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4EnvironmentalOpen in IMG/M
3300028733Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4EnvironmentalOpen in IMG/M
3300028764Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029288Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91EngineeredOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033810Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_EEnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Soeholt_100067923300000506Anaerobic DigesterMKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG*
TBL_comb47_HYPODRAFT_1004688333300000553FreshwaterMARQFFWGMFITLAFVAVVTVGLLGIFTLVSLITGPVGG*
TBL_comb47_HYPODRAFT_1011235713300000553FreshwaterMAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG*
JGIcombinedJ13530_10367315923300001213WetlandVGGVFKGFFQTLAFMAVVIVVLFGIFTLVSYLAGPVGG*
JGIcombinedJ21912_1007547953300002069Arctic Peat SoilQFFGGFFATLTFVAVILAALFCIFTLVSFIAGPVGG*
JGIcombinedJ21912_1015372213300002069Arctic Peat SoilERERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG*
JGIcombinedJ21912_1027582913300002069Arctic Peat SoilERERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG*
JGI24130J36418_1000925823300002549Arctic Peat SoilMAKQFFGGFFATLAFAAGILVALLGIFTLVSYIAGPVGG*
JGI24137J36423_100444983300002565Arctic Peat SoilERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG*
Ga0055447_1009112323300004028Natural And Restored WetlandsMTRGLFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG*
Ga0055512_1007508523300004072Natural And Restored WetlandsMGRQFIVGFFLTIVFGVVVLAGLFGIFTLVSYLAGPVGG*
Ga0055495_1014336023300004146Natural And Restored WetlandsMSRGLFGGFFQTLGFLVLVAVVLFGIFTLVSYLAGPVGG*
Ga0069718_1577246933300004481SedimentMSRGLFAGFFQTLGFIVIVLVALFGIFTLVSYLAGPVGG*
Ga0007800_1006711813300004776FreshwaterMAKQFFGGFFATLTFVVVVLAALFGIFTLVSYLDGPGEVADQGE
Ga0062380_1044968713300004779Wetland SedimentMRTRELFAGFFQTLFFIAAAAALLFVIFTLVSYLAGPVGG*
Ga0068711_101225633300005144Enrichment CultureMKTRGWFAGFISTLAFVVIVLAALFGIFTLVSYWAGPVGG*
Ga0069005_1005878913300005217Natural And Restored WetlandsMGRQFFVGFFLTALFGVVVLAGLFGIFTLVSYIAGPVGGG*
Ga0069005_1007037323300005217Natural And Restored WetlandsMGRQFIVGFFLTVVFGVVVLAGLFGIFTLVSYLAGPVGG*
Ga0066795_1000647493300005938SoilMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG*
Ga0075015_10075242623300006102WatershedsMARQFFWGMFITLAFVAVVTVGLLGIFTLVSYITGPVGG*
Ga0075524_1024418123300006950Arctic Peat SoilMAKQFFGGFFATLTFVAVVLAALFCIFTLVSYIAGPVGG*
Ga0075518_100816343300006972Arctic Peat SoilMAKQFLGGFFATLAFAAGILAALLGIFTLVSYIAGPVGG*
Ga0105106_1009885323300009078Freshwater SedimentVGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG*
Ga0105106_1058022023300009078Freshwater SedimentMSRGLFAGFFQTLGFVVIVLVVLFGIFTLVSYLAGPVGG*
Ga0105103_1096162323300009085Freshwater SedimentMSRGLFAGFFQTLGFIVIVLVVLFGIFTLVSYLAGPVGA*
Ga0105107_1012339713300009087Freshwater SedimentGSVHMSRGLFAGFFQTLGFVVIVLVVLFGIFTLVSYLAGPVGA*
Ga0105107_1060702023300009087Freshwater SedimentMSRELFAGFFITLAFGAVVLIALFGIFTLVSYLAGPAGG*
Ga0105107_1075012513300009087Freshwater SedimentMKTRGWLAGFFSTLAFVVVVLAALFGIFTLVSYWAGPVGG*
Ga0102851_1224188223300009091Freshwater WetlandsMKTRELFAGFFSTLAFFIVAAALLFGIFTLVSYLAGPVGG*
Ga0117941_104033313300009120Lake SedimentMTRGFFVGFFSILAFVAVVLVGLFGIFTLVSYLAG*
Ga0117941_110254413300009120Lake SedimentGVQMSRGLFAGFFQTLGFIVIVLVALFGIFTLVSYLAGPVGG*
Ga0115027_1128349623300009131WetlandPMKTRELFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG*
Ga0113563_1099418523300009167Freshwater WetlandsMKTRELFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG*
Ga0113563_1142764623300009167Freshwater WetlandsMARQFLVALFMTLAFAVVVLGALFGIFTLVSYLAG
Ga0073936_10009428103300009175Freshwater Lake HypolimnionMARQFFWGMFITLAFVAVVTAGLLGIFTLVSYITGPVGG*
Ga0115028_1116809713300009179WetlandVGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPV
Ga0123519_1068539223300009503Hot SpringMADFLKGFVSTLAFAAAVLAALFGIFTLVSWLAGPVGG*
Ga0123327_106753123300009607Anaerobic Biogas ReactorMKTKGWFAGFFSTLAFVVVVLAALFGIFTLISYWAGPVGG*
Ga0116183_144069113300009670Anaerobic Digestor SludgeMKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWA
Ga0116186_100407733300009689Anaerobic Digestor SludgeMKVRGWFVGFFSTFAFVVVVLAALFGIFTLISYWAGPAGG*
Ga0130016_1003172253300009868WastewaterMARGMFAGFLSTLAFAVVVAAVLFGIFTLVSYLAGPVGG*
Ga0130016_1037157813300009868WastewaterVSAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG*
Ga0116238_1055489233300010347Anaerobic Digestor SludgeTGAQMKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG*
Ga0120161_111783223300012005PermafrostMAKQFFGGLFVTLAFAILVLAALFGIFTLVSYMAGPVGG*
(restricted) Ga0172374_108915123300013122FreshwaterMGRQFFVGLLVTLGFAAVVLAALFGIFTLVSYLAGPVGG*
(restricted) Ga0172368_1038762923300013123FreshwaterVGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPIGG*
Ga0075319_100448233300014257Natural And Restored WetlandsVGAFLKGLFQTLAFMVVVITVLFGIFTLVSYLAGPVGG*
Ga0075315_100325223300014258Natural And Restored WetlandsVGAFLKGLFQTLAFMVVVIAVLLGIFTLVSYLAGPVGG*
Ga0075360_110079313300014261Natural And Restored WetlandsMSGVFKGFFQTLLFMVVVAAVLFGIFTLVSYFAGPVGG
Ga0075341_113073913300014298Natural And Restored WetlandsMSRGLFAGFFQTLGFVVLVLVVLFGIFTLVSYLAGPVGG*
Ga0075339_102244833300014316Natural And Restored WetlandsVSAFFKGLFQTLAFMVVVVVVLFGIFTLVSYLAGPVGG*
Ga0075355_102482133300014322Natural And Restored WetlandsVGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYMAGPVGG*
Ga0075355_122096213300014322Natural And Restored WetlandsMGRQFIVGFFLTVVFWVVVLAGLFGIFTLVSYLAGPVGG*
Ga0182021_1193932213300014502FenMRGFSGGFFQTLGFFAVAIVLLFGIFTLVSYLAGPVGG*
Ga0180047_107907513300016687FreshwaterSLREQERSMAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG
Ga0187786_1020232413300017944Tropical PeatlandKQFFAGFFTTLVFVVVVLAGLFGIFVLIDLIAGPVGG
Ga0187785_1024596723300017947Tropical PeatlandMVLKGFFQALAFMVVVIAILFGIFTLVSYLAGPVGG
Ga0194039_103315113300020163Anoxic Zone FreshwaterMARQFFWGMFITLAFVAVVTVGLLGIFTLVSLITGPVGG
Ga0194039_116378613300020163Anoxic Zone FreshwaterERECIMAKQFFGGFFATLTFAAVILAALFGIFTLVSYIAGPVGG
Ga0194040_120678123300020228Anoxic Zone FreshwaterMARQFFWGMFITLAFVAVVTAGLLGIFTLVSYITGPVGG
Ga0194056_1008857823300021070Anoxic Zone FreshwaterMARQFFSAFFLTLVFAAVVLGGLFGIFTLVSYLAGPVGG
Ga0194053_1006548223300021520Anoxic Zone FreshwaterMAKQFFGGFFATLTFAAVILAALFGIFTLVSYIAGPVGG
Ga0208851_100266043300025461Arctic Peat SoilMKARGSFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG
Ga0207931_100174453300025499Arctic Peat SoilMAKQFFGGFFITLAFVVVVLAALFGIFILISYMAGPVGG
Ga0208584_110878123300025533Arctic Peat SoilMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG
Ga0208716_108690913300025548Arctic Peat SoilARGSFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG
Ga0210084_103801233300025564Natural And Restored WetlandsMTRGLFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG
Ga0208196_101114773300025724Anaerobic Digestor SludgeMKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG
Ga0209484_1004658143300025829Arctic Peat SoilRERIMAKQFFGGFFATLAFAAGILVALLGIFTLVSYIAGPVGG
Ga0209538_126834923300025846Arctic Peat SoilMAKQFFGGFFATLAFAAGILAALFGIFTLVSYIAGPVGG
Ga0209124_1026551313300025852Arctic Peat SoilTSLREREHSMAKQFFWGMFITLAFVAVVTAGLLGIFTLVSYLAGPVGG
Ga0209014_1002807053300025857Arctic Peat SoilMAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG
Ga0209540_1006299723300025888Arctic Peat SoilMAKQFFGGFFATLTFVVIVLAALFGIFTLVSYIAGPVGG
Ga0209540_1038340743300025888Arctic Peat SoilIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG
Ga0209585_1009605723300025891Arctic Peat SoilMTRGLFAGFFITLAFVAIVLIALFGIFTLVSYLAGPVGG
Ga0209269_1000019223300027051Enrichment CultureMKTRGWFAGFISTLAFVVIVLAALFGIFTLVSYWAGPVGG
Ga0209706_1005742333300027818Freshwater SedimentMSRGLFAGFFQTLGFIVIVLVVLFGIFTLVSYLAGPVGA
Ga0209706_1056402623300027818Freshwater SedimentVGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG
Ga0207433_1057173623300027863Hot SpringMADFLKGFVSTLAFAAAVLAALFGIFTLVSWLAGPVGG
Ga0209450_1003945433300027885Freshwater Lake SedimentMTRGFFVGFFSILAFVAVVLVGLFGIFTLVSYLAG
Ga0209254_1053874123300027897Freshwater Lake SedimentMKTRELFAGFFSTLAFFVIAAALLFGIFTLVSFLAGPVGG
Ga0209668_1037535423300027899Freshwater Lake SedimentMTRGFFAGFVWTLAFVVIVLAALFGIFTLVSYVAGPVGG
Ga0209253_1065382223300027900Freshwater Lake SedimentMKTRELFGGFFQTLAFFAVAALLLFGIFTLVSFLAGP
Ga0209048_1000836173300027902Freshwater Lake SedimentMAKQFFGGFFATLTFVAVVLAALFGIFTLVSYIAGPVGG
Ga0265296_100816573300028032GroundwaterMAKQFFSGFLMTLVFAAVVIAGLFGIFTLVSYLTGPVGG
Ga0268284_101131813300028176Saline WaterMTRGFFAGFLTTLAFVVVVLAGLFGIFTLVSYVAGPGGG
Ga0302160_1011781413300028665FenMRGFSGGFFQTLGFFAVAIVLLFGIFTLVSYLAGPVGG
Ga0302169_1007437123300028679FenMKTRGLLGGFFQTLGFFAVALVLLFGIFTLVSYLAGPVGG
Ga0302264_100325063300028732FenMRGLLGGFFQTLGFFAVALVLLFGIFTLVSYLAGPVGG
Ga0302261_117122423300028733FenVHPERECIMAKQFFGGFFITLAFVAVVLVALFGIFTLVSLLAGPVGG
Ga0302260_107691713300028764FenMRGFSGGFFQTLVFFAVAIVLLFGIFTLVSYLAGPVGG
(restricted) Ga0247841_1009265623300029286FreshwaterMAKQFFGGFFATLTFAVVVLAALFGIFTLVSYIAGPVGG
Ga0265297_1012790343300029288Landfill LeachateMAKQFFGGFFATLVFVAIVLAGLFGIFTLVSYLVGPVGG
Ga0311334_1058182923300029987FenMGKGFWGGFVLTLVFMAVVIVALFGIFTLVSYVAGPVGG
Ga0302299_1008337723300030010FenMTRQFFWGMFITLAFVAVVAAGLLGIFTLVSYIAGPVGG
Ga0311349_1065826323300030294FenMTRQFFWGMFITLAFVAVVTAGLLGIFTLVSYIAGPVGG
Ga0315293_1000269233300031746SedimentMAKQFFGGLFVTLAFAAGVLVALFGIFTLVSYLAGPVGG
Ga0315290_1007479623300031834SedimentMAKPFFGGFFVTLAFVAVVLAALFGIFTLVSYIAGPVGG
Ga0315290_1008188443300031834SedimentMAKQFFGGFFATLIFTGVVAVALFLIFTLVSYMAGPVGG
Ga0315290_1020479723300031834SedimentMAKQFFGGFFVTLAFVAVVLAALFGIFTLVSYIAGPVGG
Ga0315290_1022455923300031834SedimentMAKLFFGGFFATLTFVAVVLAALFCIFTLVSYVAGSVGG
Ga0315290_1023800623300031834SedimentMARQFFGGFFATLIFAVVVMVALFAIFTLVSYMAGPVGG
Ga0311367_1046457623300031918FenMNSRGLFAGFFQTLGFFVIAAALLFGIFTLVSYLAGPVGG
Ga0315278_1002597133300031997SedimentMAKLFFGGFFATLTFVAVVLAALFCIFTLVSYVAGPVGG
Ga0315278_1002625743300031997SedimentMAKQFFSGFFATLTFVVVVLAALFGIFTLVSYVAGTVGG
Ga0315278_1011002733300031997SedimentMAKQFFGGFFATLAFVAVVLAALFGIFTLVSYIAGPVGG
Ga0315278_1024769333300031997SedimentMAKQFFGGFFATLTFVVLVLAALFGIFTLVSYIAGPVGG
Ga0315272_1003623123300032018SedimentMSGVFKGFFQTLLFMAVVAAVLFGIFTLVSYLAGPVGG
Ga0315292_1165295123300032143SedimentMAKQFFSGFFATLTFVVFVLAALFGIFTLVSYIAGPVGG
Ga0315295_1013924233300032156SedimentMAKLFFGGFFATLAFVIGVLAALFGIFTLVSYIAGPVGG
Ga0315268_1012585733300032173SedimentMAKQFFGGFFATLAFVAVILAALFGIFTLVSYIAGPVGG
Ga0315268_1216519223300032173SedimentMARQFFSAFFLTLAFAAVVLGALFGIFTLVSYLAGPVGG
Ga0315268_1253384523300032173SedimentMARQFFGGLFATLTFAVIVMVALFAIFTLISYMAGPVGG
Ga0315271_10000966133300032256SedimentMKARGLFAGFFQTLVFFLAAAVLLFGIFTLVSFLAGPVGG
Ga0315271_1073560913300032256SedimentLMKARGLFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG
Ga0316195_1035272923300032263SedimentMTRELFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG
Ga0315270_1008498043300032275SedimentMKARGLFAGFFQTLVFFLAAAVLLFGIFTLVGFLAGPVGG
Ga0316188_1036431143300032276Worm BurrowAHMTRELFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG
Ga0315286_1032645223300032342SedimentMAKQFFGGLFVTLAFAAGVLAALFGIFTLVSYLAGPVGG
Ga0315287_1133123413300032397SedimentMAKQFLGGFFATLGFVAVILAALFGIFTLVSYIAGPVGG
Ga0315275_1040399013300032401SedimentMAKQFFGGLFITLAFAAGVLVALFGIFTLVSYLAGPVGG
Ga0316226_1000978123300032562FreshwaterMAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG
Ga0316232_134537423300032605FreshwaterTSLREREHSMARQFFWGMFITLAFVAVVTVGLLGIFTLVSYLTGPVGG
Ga0335082_1009196933300032782SoilMGGVAKGFFQTLLFMIVVAAVLFGIFTLVSYLAGPVGG
Ga0335071_1011034133300032897SoilMVLKGFFQTLIFMIVVLVVLFGIFTLVSYLAGPVGG
Ga0335071_1211066913300032897SoilMGAVARGFLQTLFFMIVVAVVLFGIFTLVSYLAGPVGG
Ga0316625_10058072833300033418SoilMKTREMFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG
Ga0316616_10064227333300033521SoilMARQFFVALFMTLAFAVVVLGALFGIFTLVSYLAGPVGG
Ga0314872_035165_387_5003300033810PeatlandMKTRGLFAGFFSTLAFVVIVLAVLFGIFTLVSYWAGPV
Ga0370479_0021665_428_5503300034123Untreated Peat SoilMMTRGLFAGFFSTLAFVVIVLAVLFVIFTLVSYWAGPVGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.