NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062378

Metagenome / Metatranscriptome Family F062378

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062378
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 48 residues
Representative Sequence MAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSD
Number of Associated Samples 113
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 95.35 %
% of genes near scaffold ends (potentially truncated) 86.15 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (65.385 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(22.308 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(33.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.78%    β-sheet: 0.00%    Coil/Unstructured: 66.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00499Oxidored_q3 1.54
PF05933Fun_ATP-synt_8 0.77
PF00032Cytochrom_B_C 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0839NADH:ubiquinone oxidoreductase subunit 6 (chain J)Energy production and conversion [C] 1.54
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A65.38 %
All OrganismsrootAll Organisms34.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000036|IMNBGM34_c001504Not Available3969Open in IMG/M
3300000305|bgg_mtDRAFT_1038517All Organisms → cellular organisms → Eukaryota → Opisthokonta2452Open in IMG/M
3300003576|Ga0007413J51701_1037848Not Available646Open in IMG/M
3300003735|Ga0006780_1030075Not Available631Open in IMG/M
3300004080|Ga0062385_10487130Not Available758Open in IMG/M
3300004186|Ga0066647_10178456Not Available949Open in IMG/M
3300004213|Ga0066648_10423987Not Available756Open in IMG/M
3300004557|Ga0068935_1000187Not Available1057Open in IMG/M
3300004612|Ga0068961_1001580Not Available903Open in IMG/M
3300004768|Ga0007762_1031401All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum2099Open in IMG/M
3300004799|Ga0058863_11947087Not Available624Open in IMG/M
3300004803|Ga0058862_10103843Not Available980Open in IMG/M
3300005529|Ga0070741_11475708Not Available562Open in IMG/M
3300005562|Ga0058697_10198970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata906Open in IMG/M
3300005616|Ga0068852_101542325Not Available687Open in IMG/M
3300005661|Ga0058698_10056254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1961Open in IMG/M
3300005827|Ga0074478_1783474Not Available3785Open in IMG/M
3300005842|Ga0068858_101213005Not Available742Open in IMG/M
3300006046|Ga0066652_101412564Not Available651Open in IMG/M
3300009325|Ga0116603_113435All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5885Open in IMG/M
3300010062|Ga0127426_101583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum948Open in IMG/M
3300010064|Ga0127433_112837Not Available812Open in IMG/M
3300010067|Ga0127432_141525All Organisms → cellular organisms → Eukaryota → Opisthokonta1267Open in IMG/M
3300010075|Ga0127434_106619All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis1949Open in IMG/M
3300010088|Ga0127476_1070705Not Available812Open in IMG/M
3300010094|Ga0127480_1011097Not Available845Open in IMG/M
3300010096|Ga0127473_1097974Not Available790Open in IMG/M
3300010110|Ga0126316_1015810All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5540Open in IMG/M
3300010111|Ga0127491_1078813Not Available561Open in IMG/M
3300010127|Ga0127489_1004308Not Available1435Open in IMG/M
3300010128|Ga0127486_1051822Not Available688Open in IMG/M
3300010139|Ga0127464_1048606Not Available778Open in IMG/M
3300010375|Ga0105239_10421809All Organisms → cellular organisms → Eukaryota → Opisthokonta1511Open in IMG/M
3300010859|Ga0126352_1226069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata761Open in IMG/M
3300010874|Ga0136264_10286392Not Available584Open in IMG/M
3300010880|Ga0126350_10573756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1028Open in IMG/M
3300011069|Ga0138592_1098309Not Available1028Open in IMG/M
3300011120|Ga0150983_13744561All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum2668Open in IMG/M
3300012372|Ga0134037_1167777Not Available595Open in IMG/M
3300012375|Ga0134034_1254445Not Available770Open in IMG/M
3300012387|Ga0134030_1293548Not Available649Open in IMG/M
3300012395|Ga0134044_1021789Not Available725Open in IMG/M
3300012395|Ga0134044_1123379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata555Open in IMG/M
3300012407|Ga0134050_1007048Not Available621Open in IMG/M
3300012916|Ga0157310_10089628All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum970Open in IMG/M
3300016294|Ga0182041_11036345Not Available743Open in IMG/M
3300017412|Ga0182199_1085750Not Available704Open in IMG/M
3300017928|Ga0187806_1361478Not Available520Open in IMG/M
3300018760|Ga0103504_10000735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata624Open in IMG/M
3300019238|Ga0180112_1029935All Organisms → cellular organisms → Eukaryota → Opisthokonta1423Open in IMG/M
3300019251|Ga0187795_1311751All Organisms → cellular organisms → Eukaryota → Opisthokonta2869Open in IMG/M
3300019254|Ga0184641_1091874Not Available1098Open in IMG/M
3300019254|Ga0184641_1194099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis592Open in IMG/M
3300019254|Ga0184641_1230920All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum3323Open in IMG/M
3300019256|Ga0181508_1264865Not Available588Open in IMG/M
3300020070|Ga0206356_10020701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis547Open in IMG/M
3300020070|Ga0206356_10480474Not Available587Open in IMG/M
3300020078|Ga0206352_11233612Not Available703Open in IMG/M
3300020080|Ga0206350_11230616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis1269Open in IMG/M
3300021854|Ga0187839_1101063All Organisms → cellular organisms → Eukaryota → Opisthokonta2253Open in IMG/M
3300021947|Ga0213856_1065472All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1913Open in IMG/M
3300022502|Ga0242646_1000118All Organisms → cellular organisms → Eukaryota3014Open in IMG/M
3300022511|Ga0242651_1022456Not Available669Open in IMG/M
3300022713|Ga0242677_1030718Not Available717Open in IMG/M
3300022718|Ga0242675_1069159Not Available628Open in IMG/M
3300022894|Ga0247778_1000702Not Available30762Open in IMG/M
3300023700|Ga0228707_1027453Not Available818Open in IMG/M
3300023703|Ga0228708_1036477Not Available735Open in IMG/M
3300025904|Ga0207647_10326830Not Available870Open in IMG/M
3300025914|Ga0207671_10627909Not Available856Open in IMG/M
3300025916|Ga0207663_11664514Not Available513Open in IMG/M
3300025921|Ga0207652_11293692Not Available632Open in IMG/M
3300026035|Ga0207703_11035570Not Available788Open in IMG/M
3300026864|Ga0209621_1017786Not Available522Open in IMG/M
3300028137|Ga0256412_1244625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata662Open in IMG/M
3300028187|Ga0256901_1126601Not Available670Open in IMG/M
3300028379|Ga0268266_10570686All Organisms → cellular organisms → Eukaryota → Opisthokonta1085Open in IMG/M
3300030495|Ga0268246_10009453All Organisms → cellular organisms → Eukaryota → Opisthokonta2987Open in IMG/M
3300030501|Ga0268244_10177091Not Available1029Open in IMG/M
3300030501|Ga0268244_10264399All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata866Open in IMG/M
3300030585|Ga0247639_1292843Not Available517Open in IMG/M
3300030634|Ga0247636_10094428Not Available819Open in IMG/M
3300030766|Ga0315863_113184Not Available719Open in IMG/M
3300030789|Ga0102766_11006638All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis3127Open in IMG/M
3300030842|Ga0075404_10064796All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum1264Open in IMG/M
3300030903|Ga0308206_1086703Not Available682Open in IMG/M
3300030986|Ga0308154_119250All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5501Open in IMG/M
3300030993|Ga0308190_1014778Not Available1202Open in IMG/M
3300031059|Ga0315840_1021515Not Available731Open in IMG/M
3300031083|Ga0315842_106691Not Available760Open in IMG/M
3300031098|Ga0308191_1024074All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5621Open in IMG/M
3300031123|Ga0308195_1001580All Organisms → cellular organisms → Eukaryota2048Open in IMG/M
3300031123|Ga0308195_1002319All Organisms → cellular organisms → Eukaryota → Opisthokonta1764Open in IMG/M
3300031422|Ga0308186_1001976All Organisms → cellular organisms → Eukaryota → Opisthokonta1412Open in IMG/M
3300031708|Ga0310686_116120268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata828Open in IMG/M
3300031956|Ga0316032_103924Not Available704Open in IMG/M
3300032159|Ga0268251_10122875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata951Open in IMG/M
3300032514|Ga0214502_1244709Not Available685Open in IMG/M
3300032514|Ga0214502_1259623Not Available662Open in IMG/M
3300032515|Ga0348332_12795702Not Available830Open in IMG/M
3300032515|Ga0348332_13738055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata996Open in IMG/M
3300032592|Ga0214504_1067910Not Available698Open in IMG/M
3300032593|Ga0321338_1174159All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis772Open in IMG/M
3300032697|Ga0214499_1148447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5726Open in IMG/M
3300032781|Ga0314742_1061075Not Available657Open in IMG/M
3300032812|Ga0314745_1035416All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis1063Open in IMG/M
3300032812|Ga0314745_1041106All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312992Open in IMG/M
3300032822|Ga0314740_1054303Not Available599Open in IMG/M
3300032824|Ga0314735_1026427Not Available1067Open in IMG/M
3300032966|Ga0314722_1008756Not Available1437Open in IMG/M
3300032970|Ga0314716_118598Not Available821Open in IMG/M
3300032976|Ga0314752_1107309Not Available537Open in IMG/M
3300033168|Ga0272423_1190552Not Available897Open in IMG/M
3300033523|Ga0314768_1087951Not Available1073Open in IMG/M
3300033524|Ga0316592_1001250All Organisms → cellular organisms → Eukaryota → Opisthokonta4025Open in IMG/M
3300033525|Ga0314758_1039082Not Available1319Open in IMG/M
3300033525|Ga0314758_1114345Not Available748Open in IMG/M
3300033525|Ga0314758_1158511Not Available619Open in IMG/M
3300033525|Ga0314758_1176193Not Available582Open in IMG/M
3300033525|Ga0314758_1207482Not Available529Open in IMG/M
3300033530|Ga0314760_1058193Not Available957Open in IMG/M
3300033530|Ga0314760_1074800Not Available840Open in IMG/M
3300033531|Ga0314756_1098066Not Available509Open in IMG/M
3300033532|Ga0314767_1010161Not Available1871Open in IMG/M
3300033535|Ga0314759_1114567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5851Open in IMG/M
3300033535|Ga0314759_1292640Not Available514Open in IMG/M
3300033537|Ga0314766_1034928Not Available1626Open in IMG/M
3300033537|Ga0314766_1290955Not Available588Open in IMG/M
3300033537|Ga0314766_1378069Not Available508Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere22.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil13.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.92%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter3.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.08%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave3.08%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.31%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.31%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.54%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.54%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave1.54%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.54%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.77%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.77%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.77%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.77%
Enriched Soil AggregateEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.77%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.77%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.77%
Passalidae Beetle GutHost-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut0.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.77%
Processed Fermented Consumer ProductEngineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Fermented Consumer Product0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000036Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU)Host-AssociatedOpen in IMG/M
3300000305Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined AssemblyHost-AssociatedOpen in IMG/M
3300003576Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003735Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004186Groundwater microbial communities from aquifer - Crystal Geyser CG18_big_fil_WC_8/21/14_2.50EnvironmentalOpen in IMG/M
3300004213Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NAEnvironmentalOpen in IMG/M
3300004557Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004612Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004768Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005661Agave microbial communities from Guanajuato, Mexico - As.Sf.eHost-AssociatedOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300009325Processed tobacco microbial communities from USA domestic dry snuff from retail store in Atlanta, GA, USA - Dry Snuff D1 2x mi-seq runs combinedEngineeredOpen in IMG/M
3300010062Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010064Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010067Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010075Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010088Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010094Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010096Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010110Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010111Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010127Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010128Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010139Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010874Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012372Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300018760Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000920EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019251Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021854Metatranscriptome of extremophilic microbial mat communities from Yellowstone National Park, Wyoming, USA - OCTB_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300023700Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023703Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026864Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028187Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0689-MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030766Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T25 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030789Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030986Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031059Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T17 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031083Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031956Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032592Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032966Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032970Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033524Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033537Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
IMNBGM34_00150413300000036Passalidae Beetle GutMAASKPISLSTYIKTFSISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIFAIPSLHTHR*
bgg_mtDRAFT_103851723300000305Host-AssociatedMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSRFIVTISSLHTHR*
Ga0007413J51701_103784813300003576Avena Fatua RhizosphereMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSMSDNS
Ga0006780_103007513300003735Avena Fatua RhizosphereMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIFVIP
Ga0062385_1048713013300004080Bog Forest SoilMAASKPISWPNRRNTTLFSLKNNLGTLLTLVLGCFPLDIQPYRT
Ga0066647_1017845613300004186GroundwaterMAASKPIPWTYFIITSLISLNNNFGTLLLLVLGCFPLDIQPYRTMSDYS
Ga0066648_1042398713300004213GroundwaterMAASKPISWSYSIKTSFISLNNNFGTLLTLVLGCFPLDIQPYRT
Ga0068935_100018713300004557Peatlands SoilMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNS
Ga0068961_100158013300004612Peatlands SoilMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDN
Ga0007762_103140123300004768Freshwater LakeMAASKPISLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSKSIFAISSLQTRR*
Ga0058863_1194708713300004799Host-AssociatedMAASKPIFLSTYIKTSFISLNNNFGTLTLVLGCFPFDIQPYHSMSD
Ga0058862_1010384313300004803Host-AssociatedSLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSRYIVTISSLHTHR*
Ga0070741_1147570813300005529Surface SoilMAASKPIFLSSYIKTFLFSLNNNFGTLTLALGCFPFDIQPY
Ga0058697_1019897023300005562AgaveMAASKPISWLYLKKTSLFSLNNNFGTLTLVLGCFPLDIQPYRTMSDYSI
Ga0068852_10154232523300005616Corn RhizosphereMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSRFIFAILSLQARR*
Ga0058698_1005625423300005661AgaveMAASKPISWLYLKKTSLFSLNNNFGTLTLVLGCFPLDIQPYRTMSDYSISQIK*
Ga0074478_178347413300005827Sediment (Intertidal)MAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSL*
Ga0068858_10121300523300005842Switchgrass RhizosphereMAAPKPIS*ANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRTM
Ga0066652_10141256413300006046SoilMAASKPISWSYTIKTSFISLNNNFGTLLTLVQGCFPLDIQPYRTMSDY
Ga0116603_11343513300009325Processed Fermented Consumer ProductMAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYH
Ga0127426_10158313300010062Grasslands SoilMAASKPISWLYTIKTSFISLNNNFGTLLTLVLGCFPLDIQPYRTMSDYSIFI
Ga0127433_11283713300010064Grasslands SoilMAASKPIFLSSYIKTFLFSLNNNFGTLTLALGCFPFDIQPYHSMSDNSR
Ga0127432_14152513300010067Grasslands SoilMAASKPISWLYTIKTSFISLNNNFGTLLTLVLGCFPLDIQPYRT
Ga0127434_10661913300010075Grasslands SoilMAASKPIILSTYIKTFLISLNNNFGTLTTFVLGCFPFDIQPYHSMSDNSRSIFVIPSLHTHR*
Ga0127476_107070513300010088Grasslands SoilMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSMSDNLRYIFAIPSLH
Ga0127480_101109713300010094Grasslands SoilMAASKPISWSYTIKTSFISLNNNFGTLLTLVQGCFPLDIQPYRTMSD
Ga0127473_109797413300010096Grasslands SoilMAASKPIILSTYIKTFLISLNNNFGTLTTFVLGCFPFDIQPYHSMSDNSRSIFVIPSLH
Ga0126316_101581013300010110SoilMAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSM
Ga0127491_107881313300010111Grasslands SoilMAASKPISWLYTIKTSFISLNNNFGTLLTLVLGCFPLDIQPYRTM
Ga0127489_100430813300010127Grasslands SoilMAASKPISLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQP
Ga0127486_105182213300010128Grasslands SoilMAASKPIILSTYIKTFLISLNNNFGTLTTFVLGCFPFDIQPYHSMSDNSRSIFVIPSLHTHR
Ga0127464_104860613300010139Grasslands SoilMAASKPIFLSSYIKTFLFSLNNNFGTLTLALGCFPFDIQPYHSMSDNSRF
Ga0105239_1042180913300010375Corn RhizosphereMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMS
Ga0126352_122606913300010859Boreal Forest SoilMAASKPISWLYLKKTTLISLNNNFGTLTLVLGCFPLDIQPYR
Ga0136264_1028639213300010874SoilMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSD
Ga0126350_1057375613300010880Boreal Forest SoilMAASKPIPWPIRINTALISLNKNFGTLLTLVLGYFPLDIQPYRTMSDYSIYISS
Ga0138592_109830913300011069Peatlands SoilMAASKPIILSTYIKTFLLSLNNNFGTLTLVLGCFPLDIQPYR
Ga0150983_1374456113300011120Forest SoilMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDDSRSIFAIPSLHTHR*
Ga0134037_116777713300012372Grasslands SoilMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIF
Ga0134034_125444513300012375Grasslands SoilMAASKPIFLSSYIKTFLFSLNNNFGTLTLALGCFPFDIQPYHSMSDNSRFIL
Ga0134030_129354813300012387Grasslands SoilMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIFAIPSLHTH
Ga0134044_102178913300012395Grasslands SoilMAASKPISWSYYINTSFISLNNNFGTLLTLVKGCFPLDIQPYRTMSDYSI
Ga0134044_112337913300012395Grasslands SoilMAASKPISWSYTIKTSFISLNNNFGTLLTLVQGCFPLDIQPYRTMSDYSIFI
Ga0134050_100704813300012407Grasslands SoilMAASKPISLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYH
Ga0157310_1008962813300012916SoilMAASKPISLSTYIKTFLISLDNNFGTLTFVLGCFPFDIQPYHSMSDNSR
Ga0182041_1103634513300016294SoilMAASKPISLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNLR
Ga0182199_108575013300017412Switchgrass PhyllosphereMAASKPTSWSDLTITTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSN
Ga0187806_136147813300017928Freshwater SedimentMAASKPISLSTYIKTLFNSLNNNFGTLNFVLGCFPFDIQPDRSMSDNSRSIFAISSPHT
Ga0103504_1000073513300018760MarineMAASKPISWLYTKKTSLISLNNNFGTFNSCSGRFPLDIQPYRTMSP
Ga0180112_102993513300019238Groundwater SedimentMAASKPIFLSTYIKTFFASLNNNFGTLTLALGCFPFDIQPYHSMSDN
Ga0187795_131175113300019251PeatlandMAASKPIFLSTYIKTFFFSLNNNFGTLTLVLGCFPFDIQPYHSMSDNPRLILTIPSIQTH
Ga0184641_109187413300019254Groundwater SedimentMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSMS
Ga0184641_119409913300019254Groundwater SedimentAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQP
Ga0184641_123092013300019254Groundwater SedimentMAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDHSRSI
Ga0181508_126486513300019256PeatlandMAASKPIFLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSR
Ga0206356_1002070113300020070Corn, Switchgrass And Miscanthus RhizosphereMAASKPISXLFKKKTSLISLNNNFGTLTFVLGCFPLDIQPYRNMSDYSTYIFAIPS
Ga0206356_1048047413300020070Corn, Switchgrass And Miscanthus RhizosphereMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYH
Ga0206352_1123361213300020078Corn, Switchgrass And Miscanthus RhizosphereMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPY
Ga0206350_1123061613300020080Corn, Switchgrass And Miscanthus RhizosphereMAASKPISXLFKKKTSLISLNNNFGTLTFVLGCFPLDIQPYRNMSDY
Ga0187839_110106313300021854SedimentMAASKPISXLFLKKTSLISLNNNFGTLTLVLGCFPLDIQPYRNMSDSLI
Ga0213856_106547213300021947WatershedsMAASKPISWLYLKKTTLISLNNNFGTLTLVLGCFPLDIQPY
Ga0242646_100011813300022502SoilMAASKPISLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSIFIFAIPSPHTH
Ga0242651_102245613300022511SoilMAASKPISXANIMKTSLISLNNNLGTLLTLVLGCFPLDIQPYRTMSDN
Ga0242677_103071813300022713SoilMAASKPIPLLTYIETFLISLNNNFGTLTFVLGCFPFDIQPYHSMSD
Ga0242675_106915913300022718SoilMADSKPISLSTDIETFLFSLNNNFGTLTFVLGCFPFDIQPY
Ga0247778_100070213300022894Plant LitterMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSM
Ga0247772_110623713300023264Plant LitterMAASKPIFLSTYIKTFFISLNKNFGTLTLVLGCFP
Ga0228707_102745313300023700FreshwaterMAASKPIPLSTYIKTFFISLNNYFGTLTLVLGCFPFDIQPYHSMSDNSIF
Ga0228708_103647713300023703FreshwaterMAASKPIPLSTYIKTFFISLNNYFGTLTLVLGCFPFDIQPYHS
Ga0207647_1032683013300025904Corn RhizosphereMAASKPITXLFLKKTSLISLNNNFGTLTLVLGCFPLDIQPYRTM
Ga0207671_1062790913300025914Corn RhizosphereMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDI
Ga0207663_1166451413300025916Corn, Switchgrass And Miscanthus RhizosphereMAASKPIFLSTYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIFVIPSL
Ga0207652_1129369213300025921Corn RhizosphereMAASKPIILSTYIKTFLISLNNNFGTLTTFVLGCFPFDIQPYHSMSDN
Ga0207703_1103557013300026035Switchgrass RhizosphereMAAPKPISXANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRTMSDNL
Ga0209621_101778613300026864Forest SoilMAASKPISWPNKINTTLISLNNNLGTLLTLVLGCFPFDIQPYRTMSDN
Ga0256412_124462513300028137SeawaterMAASKPISWLYLKKTTLISLNNNFGTLTLVLGCFPLDIQPYRTMSDYLT
Ga0256901_112660113300028187Enriched Soil AggregateMAASKPISLSTYIKTFLISLDNNFGTLTFVLGCFPFDIQPYHSMSDNS
Ga0268266_1057068613300028379Switchgrass RhizosphereMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIHRNLA
Ga0268246_1000945333300030495AgaveMAASKPISWLYLKKTSLFSLNNNFGTLTLVLGCFPLDIQPYRTMSDYSISQIK
Ga0268244_1017709113300030501AgaveMAASKPIPWTYLIITSLISLNNNFGTLLALVLGCFPLDIQPYRTM
Ga0268244_1026439913300030501AgaveMAASKPISWLYSKKTSLLSLNINFGTLTLVLGCFPLDIQPYRTMSDYSIS
Ga0247639_129284313300030585SoilVAASKPIFLLPYIKTFLISLNNNFGTLTLVLGCFPFDIQPYHSMSDN
Ga0247636_1009442813300030634SoilMAASKPIFLSTYIKTSFISLNNNFGTLTLVLGCFPFDIQPYHS
Ga0315863_11318413300030766Plant LitterMAASKPTSWSYSIDTTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSNFIKV
Ga0102766_1100663813300030789SoilMAASKPIPLSTYIQTFLFSLNNNFGTLTFVLGCFPFDIQPYRYMSDNSRFIFALPSLHPH
Ga0075404_1006479613300030842SoilMAASKPIPLLTYIETFLISLNNNFGTLTFVLGCFPFDIQPYHSM
Ga0308206_108670323300030903SoilMAASKPIILSTYIKTFLISLNNNFGTLTTFVLGCFPFDIQPYHSMSDNSRSIFVIPSLHT
Ga0308154_11925013300030986SoilMAASKPIPLSTYIKTFFISLNNDFGTLTLVLGCFPFDIQPYHSMSDNSR
Ga0308190_101477813300030993SoilMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDN
Ga0315840_102151513300031059Plant LitterMAAPKPISXSGGVNTTLISLNNNLGTLFTLVLGCFPLDIQPYRTMSDNLIN
Ga0315842_10669113300031083Plant LitterMAASKPIPWTYLIITSLISLNNNFGTLLALVLGCFPLDIQPYRT
Ga0308191_102407413300031098SoilMAASKPIPLSTYIKTFFISLNNDFGTLTLVLGCFPFDIQPY
Ga0308195_100158013300031123SoilMAASKPIPWTYLIITSLISLNNNFGTLLALVLGCFPLDIQPYRTMSDYS
Ga0308195_100231913300031123SoilMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSM
Ga0308186_100197613300031422SoilMAASKPIFLSTYIKTFFISLNNNFGTLTLVLGCFPFDIQPYHSMSDNSRFIF
Ga0310686_11612026813300031708SoilMAASKPIPWPFWINTALISLNNNFGTLLTLVLGCFPLDIQPYRTMSDYS
Ga0316032_10392413300031956SoilMAASKPISWPNRRNTTLFSLNNNLGTLLTLVLGCFPLDIQPYRT
Ga0268251_1012287513300032159AgaveMAASKPISWLYLKKTSLFSLNNNFGTLTLVLGCFPLDIQPYRTMSDYSIYC
Ga0214502_124470913300032514Switchgrass PhyllosphereMAASKPTSWPDLIVTTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSNFIKA
Ga0214502_125962313300032514Switchgrass PhyllosphereMAASKPTFWSNLTITTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSNFIK
Ga0348332_1279570213300032515Plant LitterVAASKPISWPFGINTALISLNNNFGTLLTLVLGCFPLDIQPFRTMSDYSISIS
Ga0348332_1373805513300032515Plant LitterMAASKPIPWPFWINTALISLNNNFGTLLTLVLGCFPLDIQPFRTMSDYSISIS
Ga0214504_106791013300032592Switchgrass PhyllosphereMAASKPTSWPDLIVTTLISLNNNFGTLLTLVLGCFPFDIQP
Ga0321338_117415913300032593Switchgrass PhyllosphereSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDHSRSI
Ga0214499_114844713300032697Switchgrass PhyllosphereMAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSD
Ga0314742_106107513300032781Switchgrass PhyllosphereMTASKPTSWPYSLDTTLISLNNNFGTLLTFVLGCFPFDIQPYRTMSDSSNFIK
Ga0314745_103541613300032812Switchgrass PhyllosphereSALLRDLQKMAASKPIPWLYQIITPLYSLNNNFGTLLTLVLGCFPFDIQPYHSMSDHSRS
Ga0314745_104110613300032812Switchgrass PhyllosphereSTYIETFLISLNNYFGTLILVLGCFPFDIQPYHSMSDHSIIIFAISSPDTHR
Ga0314740_105430313300032822Switchgrass PhyllosphereMAASKPISLSTYIKTFLISLDNNFGTLTFVLGCFPF
Ga0314735_102642713300032824Switchgrass PhyllosphereMAASKPISWLYMIKTSLISLNINFGTLTLVLGCFPLDIQ
Ga0314722_100875613300032966Switchgrass PhyllosphereMAAPKPISXANRINTTLISLNNNFGTLTLVLGCFPLDIQPYRTMSDYSIHF
Ga0314716_11859813300032970Switchgrass PhyllosphereMAAPKPISXANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRTMSDNLINI
Ga0314752_110730913300032976Switchgrass PhyllosphereMAASKPISLSTYIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSRY
Ga0272423_119055213300033168RockVAASKPISWTNRTNTTFLSLNNNFGTLLTLVLGCFPFDIQPYRTMSDYS
Ga0314768_108795113300033523Switchgrass PhyllosphereMAASKPTYLSYSIDTALISLNNNFGTLFTFVLGCFPFDIQPYRTMSDSSNFIKALSSANT
Ga0316592_100125013300033524RhizosphereMAASKPIFLSTYIKTFFVSLNNNFGTLTLALGCFPFDIQPYHSMSDN
Ga0314758_103908213300033525Switchgrass PhyllosphereMAAPKPISXANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRT
Ga0314758_111434513300033525Switchgrass PhyllosphereMAASKPTSWPYSIDTTLISLNNNFGTLLTLVLGCFPFDIQPYR
Ga0314758_115851113300033525Switchgrass PhyllosphereMAASKPTYWTDSMFTTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSNFIKA
Ga0314758_117619313300033525Switchgrass PhyllosphereMAASKPTYLSYSIDTALISLNNNFGTLFTFVLGCFPFDIQPYRTMS
Ga0314758_120748213300033525Switchgrass PhyllosphereMAASKPTFWSNLTITTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDSSNFIKA
Ga0314760_105819313300033530Switchgrass PhyllosphereMAASKPTFWSNLTITTLISLNNNFGTLLTLVLGCFPFDIQPYRTMSDS
Ga0314760_107480013300033530Switchgrass PhyllosphereMAAPKPISXSYKINTALISLNNNFGTLLTLVLGCFPFDIQPY
Ga0314756_109806613300033531Switchgrass PhyllosphereMAASKPTSWPDLIVTTLISLNNNFGTLLTLVLGCFPFDIQPYRTM
Ga0314767_101016113300033532Switchgrass PhyllosphereMAASKPTYLSYSIDTALISLNNNFGTLFTFVLGCFPFDIQPYRTMSDSSNFIKALSSTNT
Ga0314759_111456713300033535Switchgrass PhyllosphereMAASKPISLSTQIKTFLISLNNNFGTLTFVLGCFPFDIQPYHSMSDNSIFIFAIPSLH
Ga0314759_129264013300033535Switchgrass PhyllosphereMAASKPTYWTDSMFTTLISLNNNFGTLLTLVLGCFPFDIQPYRTM
Ga0314766_103492813300033537Switchgrass PhyllosphereMAAPKPISXANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRTMSDY
Ga0314766_129095513300033537Switchgrass PhyllosphereMAASKPTYWTDSMFTTLISLNNNFGTLLTLVLGCFP
Ga0314766_137806913300033537Switchgrass PhyllosphereMAASKPTYLSYSIDTALISLNNNFGTLFTFVLGCFPFDIQP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.