Basic Information | |
---|---|
Family ID | F062226 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 41 residues |
Representative Sequence | MADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.83 % |
% of genes near scaffold ends (potentially truncated) | 9.92 % |
% of genes from short scaffolds (< 2000 bps) | 77.86 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.863 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.267 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.298 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.855 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF00816 | Histone_HNS | 6.11 |
PF04355 | SmpA_OmlA | 3.82 |
PF04392 | ABC_sub_bind | 2.29 |
PF01435 | Peptidase_M48 | 2.29 |
PF03992 | ABM | 2.29 |
PF13410 | GST_C_2 | 1.53 |
PF00903 | Glyoxalase | 1.53 |
PF12681 | Glyoxalase_2 | 1.53 |
PF13417 | GST_N_3 | 1.53 |
PF00072 | Response_reg | 0.76 |
PF04199 | Cyclase | 0.76 |
PF13379 | NMT1_2 | 0.76 |
PF01734 | Patatin | 0.76 |
PF02384 | N6_Mtase | 0.76 |
PF01569 | PAP2 | 0.76 |
PF00400 | WD40 | 0.76 |
PF13586 | DDE_Tnp_1_2 | 0.76 |
PF08483 | Obsolete Pfam Family | 0.76 |
PF00043 | GST_C | 0.76 |
PF02566 | OsmC | 0.76 |
PF05199 | GMC_oxred_C | 0.76 |
PF08327 | AHSA1 | 0.76 |
PF11799 | IMS_C | 0.76 |
PF05656 | DUF805 | 0.76 |
PF02743 | dCache_1 | 0.76 |
PF07286 | D-Glu_cyclase | 0.76 |
PF02518 | HATPase_c | 0.76 |
PF13531 | SBP_bac_11 | 0.76 |
PF01548 | DEDD_Tnp_IS110 | 0.76 |
PF07690 | MFS_1 | 0.76 |
PF01266 | DAO | 0.76 |
PF13437 | HlyD_3 | 0.76 |
PF08447 | PAS_3 | 0.76 |
PF01810 | LysE | 0.76 |
PF04235 | DUF418 | 0.76 |
PF00300 | His_Phos_1 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG2916 | DNA-binding protein H-NS | Transcription [K] | 6.11 |
COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 3.82 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.29 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.76 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.76 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.76 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.76 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.76 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.76 |
COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 0.76 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.76 |
COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.76 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.76 |
COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 0.76 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.86 % |
Unclassified | root | N/A | 22.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q02FJKD7 | Not Available | 543 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101961498 | Not Available | 590 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101962812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3894 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101963589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4477 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101964554 | Not Available | 754 | Open in IMG/M |
3300000550|F24TB_10108398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1482 | Open in IMG/M |
3300000559|F14TC_104879507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 749 | Open in IMG/M |
3300001431|F14TB_102403617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
3300001431|F14TB_103292975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 819 | Open in IMG/M |
3300003659|JGI25404J52841_10039993 | Not Available | 992 | Open in IMG/M |
3300003911|JGI25405J52794_10159399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2 | 516 | Open in IMG/M |
3300004281|Ga0066397_10000121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4078 | Open in IMG/M |
3300004479|Ga0062595_100099380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
3300004479|Ga0062595_102001345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300005332|Ga0066388_100129837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3062 | Open in IMG/M |
3300005332|Ga0066388_101303617 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300005332|Ga0066388_102194034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 996 | Open in IMG/M |
3300005332|Ga0066388_102479535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 942 | Open in IMG/M |
3300005332|Ga0066388_102490372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
3300005332|Ga0066388_103286164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
3300005332|Ga0066388_104759179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300005332|Ga0066388_107920719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 531 | Open in IMG/M |
3300005337|Ga0070682_100568500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
3300005347|Ga0070668_100595772 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005441|Ga0070700_100161865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
3300005455|Ga0070663_100165973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1703 | Open in IMG/M |
3300005471|Ga0070698_100976538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300005713|Ga0066905_100014848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3908 | Open in IMG/M |
3300005713|Ga0066905_100161942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1627 | Open in IMG/M |
3300005713|Ga0066905_100802139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 817 | Open in IMG/M |
3300005713|Ga0066905_101537924 | Not Available | 607 | Open in IMG/M |
3300005764|Ga0066903_100118513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3667 | Open in IMG/M |
3300005937|Ga0081455_10006408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12623 | Open in IMG/M |
3300005983|Ga0081540_1000080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 103320 | Open in IMG/M |
3300005983|Ga0081540_1053754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1972 | Open in IMG/M |
3300005983|Ga0081540_1229261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
3300006038|Ga0075365_10256164 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300006042|Ga0075368_10078238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
3300006058|Ga0075432_10332519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 639 | Open in IMG/M |
3300006163|Ga0070715_10126571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1224 | Open in IMG/M |
3300006163|Ga0070715_10154739 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300006603|Ga0074064_11324359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300006844|Ga0075428_100111531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2980 | Open in IMG/M |
3300006844|Ga0075428_100277723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1802 | Open in IMG/M |
3300006852|Ga0075433_10433118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
3300006904|Ga0075424_102659720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2 | 523 | Open in IMG/M |
3300006914|Ga0075436_101227493 | Not Available | 566 | Open in IMG/M |
3300006914|Ga0075436_101485940 | Not Available | 514 | Open in IMG/M |
3300006954|Ga0079219_10010344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3102 | Open in IMG/M |
3300007076|Ga0075435_101247991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
3300007265|Ga0099794_10360837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300009094|Ga0111539_10194147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2368 | Open in IMG/M |
3300009094|Ga0111539_11502067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300009143|Ga0099792_10086008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
3300009143|Ga0099792_10631083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 686 | Open in IMG/M |
3300009147|Ga0114129_10504519 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300009156|Ga0111538_10135574 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
3300009162|Ga0075423_12441024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
3300009553|Ga0105249_10681068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1087 | Open in IMG/M |
3300009553|Ga0105249_11317626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300009792|Ga0126374_11408547 | Not Available | 568 | Open in IMG/M |
3300009811|Ga0105084_1102585 | Not Available | 541 | Open in IMG/M |
3300009822|Ga0105066_1040523 | Not Available | 964 | Open in IMG/M |
3300009837|Ga0105058_1149686 | Not Available | 567 | Open in IMG/M |
3300010046|Ga0126384_10063102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2604 | Open in IMG/M |
3300010047|Ga0126382_10042634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2594 | Open in IMG/M |
3300010047|Ga0126382_10844673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
3300010047|Ga0126382_11487275 | Not Available | 622 | Open in IMG/M |
3300010159|Ga0099796_10288500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 692 | Open in IMG/M |
3300010358|Ga0126370_12576432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum | 508 | Open in IMG/M |
3300010360|Ga0126372_11872232 | Not Available | 644 | Open in IMG/M |
3300010362|Ga0126377_10012187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6769 | Open in IMG/M |
3300010362|Ga0126377_10055296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3473 | Open in IMG/M |
3300010362|Ga0126377_10203234 | Not Available | 1900 | Open in IMG/M |
3300010362|Ga0126377_10749819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1032 | Open in IMG/M |
3300010362|Ga0126377_12453296 | Not Available | 597 | Open in IMG/M |
3300010400|Ga0134122_10001240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18336 | Open in IMG/M |
3300010401|Ga0134121_13119915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300011444|Ga0137463_1050153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
3300012096|Ga0137389_10211268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1620 | Open in IMG/M |
3300012198|Ga0137364_10178768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1547 | Open in IMG/M |
3300012200|Ga0137382_10155649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
3300012203|Ga0137399_11571595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300012205|Ga0137362_10109378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2335 | Open in IMG/M |
3300012208|Ga0137376_10284307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
3300012359|Ga0137385_10262422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1493 | Open in IMG/M |
3300012685|Ga0137397_10143449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1767 | Open in IMG/M |
3300012918|Ga0137396_10274376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.2 | 1245 | Open in IMG/M |
3300012925|Ga0137419_10447635 | Not Available | 1017 | Open in IMG/M |
3300012927|Ga0137416_11233525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 674 | Open in IMG/M |
3300012948|Ga0126375_10279459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
3300012951|Ga0164300_10761650 | Not Available | 595 | Open in IMG/M |
3300012958|Ga0164299_10817792 | Not Available | 666 | Open in IMG/M |
3300012971|Ga0126369_10628319 | Not Available | 1146 | Open in IMG/M |
3300012988|Ga0164306_11689180 | Not Available | 549 | Open in IMG/M |
3300012989|Ga0164305_11408612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300013297|Ga0157378_11752345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
3300015374|Ga0132255_100998564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
3300018051|Ga0184620_10114509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri | 844 | Open in IMG/M |
3300019360|Ga0187894_10024966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4040 | Open in IMG/M |
3300019789|Ga0137408_1001738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4437 | Open in IMG/M |
3300020583|Ga0210401_10007380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11027 | Open in IMG/M |
3300021560|Ga0126371_13004705 | Not Available | 571 | Open in IMG/M |
3300024288|Ga0179589_10420837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300024347|Ga0179591_1200851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2491 | Open in IMG/M |
3300025905|Ga0207685_10095451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300025927|Ga0207687_10243584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1426 | Open in IMG/M |
3300025942|Ga0207689_10251594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1461 | Open in IMG/M |
3300025961|Ga0207712_10137435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1871 | Open in IMG/M |
3300025961|Ga0207712_11583621 | Not Available | 587 | Open in IMG/M |
3300026067|Ga0207678_10141139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2056 | Open in IMG/M |
3300026371|Ga0257179_1024149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
3300026555|Ga0179593_1120308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2841 | Open in IMG/M |
3300027646|Ga0209466_1035663 | Not Available | 1015 | Open in IMG/M |
3300027866|Ga0209813_10001845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4777 | Open in IMG/M |
3300027866|Ga0209813_10005113 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
3300027903|Ga0209488_10327276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1141 | Open in IMG/M |
3300027907|Ga0207428_10056466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3120 | Open in IMG/M |
3300027907|Ga0207428_10113543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2082 | Open in IMG/M |
3300027907|Ga0207428_10464215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
3300027909|Ga0209382_10478588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
3300027961|Ga0209853_1120143 | Not Available | 654 | Open in IMG/M |
3300028802|Ga0307503_10126120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
3300031720|Ga0307469_10435866 | Not Available | 1130 | Open in IMG/M |
3300031720|Ga0307469_11831264 | Not Available | 587 | Open in IMG/M |
3300031740|Ga0307468_100035852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2429 | Open in IMG/M |
3300031740|Ga0307468_100141055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1527 | Open in IMG/M |
3300031903|Ga0307407_10460278 | Not Available | 925 | Open in IMG/M |
3300031908|Ga0310900_11723564 | Not Available | 532 | Open in IMG/M |
3300032205|Ga0307472_102143250 | Not Available | 563 | Open in IMG/M |
3300034817|Ga0373948_0007992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1792 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.45% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.05% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.05% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.05% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.53% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_07094450 | 2170459005 | Grass Soil | MADIALHDSYFVGSWSLGFLFPLVVVVLLLGAPALVKYLFFR |
INPhiseqgaiiFebDRAFT_1019614982 | 3300000364 | Soil | VADRALRDAYMVWNWALASIPALAFIVLTLGAAALIKYLFWR* |
INPhiseqgaiiFebDRAFT_1019628122 | 3300000364 | Soil | MADIVLHDTYFVGXWSLGFFFLLVVVVLILXAXALIKYLFXR* |
INPhiseqgaiiFebDRAFT_1019635892 | 3300000364 | Soil | MADIVLHDTYFVGSWSLGFFFLLVVVVLILNAGALIKYLFSR* |
INPhiseqgaiiFebDRAFT_1019645542 | 3300000364 | Soil | MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR* |
F24TB_101083982 | 3300000550 | Soil | MADIFLQDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR* |
F14TC_1048795072 | 3300000559 | Soil | VADMVFHDTYIVWNWSLSLFLLLALIVLILGAAALIKYLFFR* |
F14TB_1024036171 | 3300001431 | Soil | MNSQMALHDTYIVWNWGLSAIVLLVVVVLILGAAALIKYLFFR* |
F14TB_1032929752 | 3300001431 | Soil | MADIMLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR* |
JGI25404J52841_100399931 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
JGI25405J52794_101593991 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MALHDTYIVWSWELHLMIFLVIVVLILGAAALIKYLLFR* |
Ga0066397_100001214 | 3300004281 | Tropical Forest Soil | MADVVLHDTYIVGNWRLGLLLLLVVVVLILGAAALTKYLFFR* |
Ga0062595_1000993801 | 3300004479 | Soil | MALHDTYFVWSWELHLLVLLLIVVLVLGAAALIKYLFFK* |
Ga0062595_1020013452 | 3300004479 | Soil | MADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR* |
Ga0066388_1001298374 | 3300005332 | Tropical Forest Soil | MADVVLHDTYIVGNSGLGLLLLLVVVVLILGAAALIKYLFFR* |
Ga0066388_1013036173 | 3300005332 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR* |
Ga0066388_1021940342 | 3300005332 | Tropical Forest Soil | MALHDTYFIWSWELHLTVLLVIVVLVLGAAALIKYLLFR* |
Ga0066388_1024795352 | 3300005332 | Tropical Forest Soil | MALHDTYIVWNWELSALLLLVVVVLILGAAALVKYLFFR* |
Ga0066388_1024903723 | 3300005332 | Tropical Forest Soil | MPDLVFHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR* |
Ga0066388_1032861641 | 3300005332 | Tropical Forest Soil | MGDVVLHDTYIVWSWGLGFLLLLVVVVLILGAAALIKYLFF |
Ga0066388_1047591791 | 3300005332 | Tropical Forest Soil | MPDLVMHDTYFVWGWALNAIILLVIIVLLLAAAALIKYLFFR* |
Ga0066388_1079207191 | 3300005332 | Tropical Forest Soil | MPDLVMHDTYFVWSWALNAIFVLVTIVLLLAAAALIKYLFFR* |
Ga0070682_1005685002 | 3300005337 | Corn Rhizosphere | MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR* |
Ga0070668_1005957722 | 3300005347 | Switchgrass Rhizosphere | MADIALHDTYFVGSWTLGFFFLLVVVVLLLGTAALVQYLFFR* |
Ga0070700_1001618654 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR* |
Ga0070663_1001659733 | 3300005455 | Corn Rhizosphere | MALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR* |
Ga0070698_1009765382 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR* |
Ga0066905_1000148483 | 3300005713 | Tropical Forest Soil | MADVVLHDTYIVGNWGLGLLLLLVVVVLILGAAALTKYLFFR* |
Ga0066905_1001619423 | 3300005713 | Tropical Forest Soil | MALHDTYIVWNWELSAILLLVVVVLILGTAALIKYLFFR* |
Ga0066905_1008021391 | 3300005713 | Tropical Forest Soil | MALHDTYFVWSWELHLIVLLVLVVLVLSAAALVKYLFFR* |
Ga0066905_1015379242 | 3300005713 | Tropical Forest Soil | MPDLVMHDTYFAWSWALNAIFVLVIIVLLLTAAALIKYLFFR* |
Ga0066903_1001185132 | 3300005764 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALIKYLFFR* |
Ga0081455_1000640812 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VPDIVLHDIYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR* |
Ga0081540_100008042 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MALHDTYIVWNWELSALLLLVIVVLILAAAALVKYLFFR* |
Ga0081540_10537542 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VADMAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0081540_12292611 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VPDIVLHDTYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR* |
Ga0075365_102561643 | 3300006038 | Populus Endosphere | MPDMALHDTYFVGGWSLGFLFLLVVVVLILGAAALVKYLFFR* |
Ga0075368_100782382 | 3300006042 | Populus Endosphere | MPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR* |
Ga0075432_103325192 | 3300006058 | Populus Rhizosphere | MALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK* |
Ga0070715_101265712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MALHETYIVWNWEVPIILLLVIIVLILGAAALIKFLLFR* |
Ga0070715_101547392 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR* |
Ga0074064_113243591 | 3300006603 | Soil | VADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR* |
Ga0075428_1001115312 | 3300006844 | Populus Rhizosphere | MPDLVIHDTYFVWSWPLNALLALVTIVLLLAAAALIKYLFFR* |
Ga0075428_1002777232 | 3300006844 | Populus Rhizosphere | MNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR* |
Ga0075433_104331181 | 3300006852 | Populus Rhizosphere | MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR* |
Ga0075424_1026597201 | 3300006904 | Populus Rhizosphere | DTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR* |
Ga0075436_1012274931 | 3300006914 | Populus Rhizosphere | MALHDTYIVWNWELGLLVLLVIVALILGIAALIKYLLFR* |
Ga0075436_1014859402 | 3300006914 | Populus Rhizosphere | MADIALHDTYIVWNWALASIPPLAVFVLVLGAGALIKYLFWR* |
Ga0079219_100103441 | 3300006954 | Agricultural Soil | MIAQMALHDTCIAWTWELSAFLLLVVIVLILAAAALIKYLFFR* |
Ga0075435_1012479912 | 3300007076 | Populus Rhizosphere | VAADIVLHETYIVWNWALGLVLLLVLIVLILGAAALVKYLFFR* |
Ga0099794_103608372 | 3300007265 | Vadose Zone Soil | MADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLLFR* |
Ga0111539_101941472 | 3300009094 | Populus Rhizosphere | MIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR* |
Ga0111539_115020672 | 3300009094 | Populus Rhizosphere | MNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR* |
Ga0099792_100860084 | 3300009143 | Vadose Zone Soil | MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR* |
Ga0099792_106310831 | 3300009143 | Vadose Zone Soil | MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW* |
Ga0114129_105045192 | 3300009147 | Populus Rhizosphere | MADVVLHDTYIVWNWALASIPPLAVIVLVLGAAALIKFLFWR* |
Ga0111538_101355742 | 3300009156 | Populus Rhizosphere | MPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR* |
Ga0075423_124410241 | 3300009162 | Populus Rhizosphere | MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAAALIKYLFFR* |
Ga0105249_106810682 | 3300009553 | Switchgrass Rhizosphere | QMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR* |
Ga0105249_113176262 | 3300009553 | Switchgrass Rhizosphere | MADIALHDTYFVGSWAFGFFFLLVVVVLVLGAAALVKCLFFR* |
Ga0126374_114085472 | 3300009792 | Tropical Forest Soil | MPDIALHDTYYIVGHWGVLGFIMIMLVIIVLVLGAAALVKYLFFR* |
Ga0105084_11025852 | 3300009811 | Groundwater Sand | MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR* |
Ga0105066_10405233 | 3300009822 | Groundwater Sand | AGMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR* |
Ga0105058_11496862 | 3300009837 | Groundwater Sand | MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALTKFLFFR* |
Ga0126384_100631023 | 3300010046 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLSALLVLVTIVLLLAAAALIKYLFFR* |
Ga0126382_100426344 | 3300010047 | Tropical Forest Soil | MALHDTYFVWSWELHLIVLLVIVVLVLGVAALIKYLLFR* |
Ga0126382_108446732 | 3300010047 | Tropical Forest Soil | MVLHDTYIVWQWEVPIILLLVIVVLVLAAAALIKYLFFR* |
Ga0126382_114872751 | 3300010047 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLGLVTIVLLLAAAALIKYLFFR* |
Ga0099796_102885002 | 3300010159 | Vadose Zone Soil | MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0126370_125764322 | 3300010358 | Tropical Forest Soil | MPDLVMHDTYFVWGWALNAILLLVIIVLLLAAAALIKYLFFR* |
Ga0126372_118722322 | 3300010360 | Tropical Forest Soil | MPDLVMHDTYFVWGWALNAILLLVIVVLLLAAAALIKYLFFR* |
Ga0126377_100121876 | 3300010362 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYRFFR* |
Ga0126377_100552961 | 3300010362 | Tropical Forest Soil | MALHDTYIVWNWELSALLLLVVVVLILGAAALIKYLFFR* |
Ga0126377_102032341 | 3300010362 | Tropical Forest Soil | TYIVWNWELSALLLLVVVVLILGAAALIKYLFFR* |
Ga0126377_107498192 | 3300010362 | Tropical Forest Soil | MALHDTYIVWNWELSAILLLVVIVLILGAAALIKYLFFR* |
Ga0126377_124532961 | 3300010362 | Tropical Forest Soil | MALHDTYFVWSWELHLIVLLVIVVLVLSAAALVKYLFFR* |
Ga0134122_1000124020 | 3300010400 | Terrestrial Soil | MTAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR* |
Ga0134121_131199151 | 3300010401 | Terrestrial Soil | MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFF |
Ga0137463_10501532 | 3300011444 | Soil | MADIMLHDTYIVWNWALSLTVPLAVIVLILGAAALIKYLFFR* |
Ga0137389_102112683 | 3300012096 | Vadose Zone Soil | MADIMLHDTYIVSNWALSLIVLLAVIVLVLGAAALIKYLFFR* |
Ga0137364_101787682 | 3300012198 | Vadose Zone Soil | MVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0137382_101556491 | 3300012200 | Vadose Zone Soil | VADMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0137399_115715951 | 3300012203 | Vadose Zone Soil | MADITLHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR* |
Ga0137362_101093782 | 3300012205 | Vadose Zone Soil | MVFHDTYIAWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0137376_102843071 | 3300012208 | Vadose Zone Soil | VADMVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR* |
Ga0137385_102624222 | 3300012359 | Vadose Zone Soil | VADMVFHDTYVVWNWALSLFLLLALIMLILGAAALVKYLFFR* |
Ga0137397_101434492 | 3300012685 | Vadose Zone Soil | VIADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR* |
Ga0137396_102743761 | 3300012918 | Vadose Zone Soil | MADITLHDTDFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR* |
Ga0137419_104476351 | 3300012925 | Vadose Zone Soil | MADITIHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR* |
Ga0137416_112335252 | 3300012927 | Vadose Zone Soil | MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLF |
Ga0126375_102794591 | 3300012948 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALLKYLFFR* |
Ga0164300_107616502 | 3300012951 | Soil | MSDIVLHDTYIVWNWGFGLVLLLIVFVLILGAAALIKYLLFR* |
Ga0164299_108177923 | 3300012958 | Soil | AMADIALHDTYFVGSWTLGFFFLLVVVVLVLGAAALVKYLVFR* |
Ga0126369_106283192 | 3300012971 | Tropical Forest Soil | MPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR* |
Ga0164306_116891801 | 3300012988 | Soil | MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAAL |
Ga0164305_114086122 | 3300012989 | Soil | MADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGALIKYLFSR* |
Ga0157378_117523452 | 3300013297 | Miscanthus Rhizosphere | MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFF |
Ga0132255_1009985642 | 3300015374 | Arabidopsis Rhizosphere | MIAQMALHGTYIVWNWELSAILLLVVVVLILRAAALIKYLFF* |
Ga0184620_101145092 | 3300018051 | Groundwater Sediment | MADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR |
Ga0187894_100249663 | 3300019360 | Microbial Mat On Rocks | MTNLALHDTYIVWNWALGSIVLLVVLVLILSAAALIKYLFWR |
Ga0137408_10017384 | 3300019789 | Vadose Zone Soil | MADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR |
Ga0210401_100073809 | 3300020583 | Soil | MVFHDTYIVWNWAPSLFLLLALIVLILGAAALVKYLFFR |
Ga0126371_130047052 | 3300021560 | Tropical Forest Soil | MPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR |
Ga0179589_104208372 | 3300024288 | Vadose Zone Soil | MADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR |
Ga0179591_12008513 | 3300024347 | Vadose Zone Soil | MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR |
Ga0207685_100954512 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR |
Ga0207687_102435843 | 3300025927 | Miscanthus Rhizosphere | MADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR |
Ga0207689_102515942 | 3300025942 | Miscanthus Rhizosphere | MADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR |
Ga0207712_101374353 | 3300025961 | Switchgrass Rhizosphere | MADIFLHDTYIVWSWTLSLILQLAVIVLVLGAAALIKYLFFR |
Ga0207712_115836211 | 3300025961 | Switchgrass Rhizosphere | QMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR |
Ga0207678_101411392 | 3300026067 | Corn Rhizosphere | MALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR |
Ga0257179_10241492 | 3300026371 | Soil | MADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLFFR |
Ga0179593_11203085 | 3300026555 | Vadose Zone Soil | MRGAMAGMMLHDTYIVWSWALSLILLLVVVVLILGAAALIKYLFFR |
Ga0209466_10356631 | 3300027646 | Tropical Forest Soil | MPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR |
Ga0209813_100018452 | 3300027866 | Populus Endosphere | MPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR |
Ga0209813_100051132 | 3300027866 | Populus Endosphere | MLPDTYIVWNWALASIPPLAVIVLVLGAAALVKFLIWR |
Ga0209488_103272762 | 3300027903 | Vadose Zone Soil | MVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW |
Ga0207428_100564664 | 3300027907 | Populus Rhizosphere | MPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR |
Ga0207428_101135432 | 3300027907 | Populus Rhizosphere | MALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK |
Ga0207428_104642152 | 3300027907 | Populus Rhizosphere | MIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR |
Ga0209382_104785882 | 3300027909 | Populus Rhizosphere | MNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR |
Ga0209853_11201432 | 3300027961 | Groundwater Sand | MPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR |
Ga0307503_101261203 | 3300028802 | Soil | VADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR |
Ga0307469_104358661 | 3300031720 | Hardwood Forest Soil | MNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR |
Ga0307469_118312641 | 3300031720 | Hardwood Forest Soil | RCLVPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR |
Ga0307468_1000358522 | 3300031740 | Hardwood Forest Soil | MALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR |
Ga0307468_1001410551 | 3300031740 | Hardwood Forest Soil | MNAQMALHDTYIVWSWELSAILLLVVVVLILGAAALIKYLFFR |
Ga0307407_104602782 | 3300031903 | Rhizosphere | MPDLVVHDTYVAWNWALGATLLLFITVLLLGAAALVKYLFFR |
Ga0310900_117235642 | 3300031908 | Soil | MSDIVLHDTYIVWNWGFGLVLLLIVLVLILGAAALIKYLLFR |
Ga0307472_1021432501 | 3300032205 | Hardwood Forest Soil | VPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR |
Ga0373948_0007992_757_888 | 3300034817 | Rhizosphere Soil | MIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR |
⦗Top⦘ |