NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062226

Metagenome / Metatranscriptome Family F062226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062226
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 41 residues
Representative Sequence MADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR
Number of Associated Samples 96
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.83 %
% of genes near scaffold ends (potentially truncated) 9.92 %
% of genes from short scaffolds (< 2000 bps) 77.86 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.863 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.267 % of family members)
Environment Ontology (ENVO) Unclassified
(31.298 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.855 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.71%    β-sheet: 0.00%    Coil/Unstructured: 44.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF00816Histone_HNS 6.11
PF04355SmpA_OmlA 3.82
PF04392ABC_sub_bind 2.29
PF01435Peptidase_M48 2.29
PF03992ABM 2.29
PF13410GST_C_2 1.53
PF00903Glyoxalase 1.53
PF12681Glyoxalase_2 1.53
PF13417GST_N_3 1.53
PF00072Response_reg 0.76
PF04199Cyclase 0.76
PF13379NMT1_2 0.76
PF01734Patatin 0.76
PF02384N6_Mtase 0.76
PF01569PAP2 0.76
PF00400WD40 0.76
PF13586DDE_Tnp_1_2 0.76
PF08483Obsolete Pfam Family 0.76
PF00043GST_C 0.76
PF02566OsmC 0.76
PF05199GMC_oxred_C 0.76
PF08327AHSA1 0.76
PF11799IMS_C 0.76
PF05656DUF805 0.76
PF02743dCache_1 0.76
PF07286D-Glu_cyclase 0.76
PF02518HATPase_c 0.76
PF13531SBP_bac_11 0.76
PF01548DEDD_Tnp_IS110 0.76
PF07690MFS_1 0.76
PF01266DAO 0.76
PF13437HlyD_3 0.76
PF08447PAS_3 0.76
PF01810LysE 0.76
PF04235DUF418 0.76
PF00300His_Phos_1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG2916DNA-binding protein H-NSTranscription [K] 6.11
COG2913Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complexCell wall/membrane/envelope biogenesis [M] 3.82
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.29
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.76
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.76
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.76
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.76
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.76
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.76
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.76
COG2311Uncharacterized membrane protein YeiBFunction unknown [S] 0.76
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.76
COG3152Uncharacterized membrane protein YhaH, DUF805 familyFunction unknown [S] 0.76
COG3547TransposaseMobilome: prophages, transposons [X] 0.76
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.76
COG4336Uncharacterized conserved protein YcsI, UPF0317/DUF1446 familyFunction unknown [S] 0.76
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.86 %
UnclassifiedrootN/A22.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02FJKD7Not Available543Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101961498Not Available590Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101962812All Organisms → cellular organisms → Bacteria → Proteobacteria3894Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101963589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4477Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101964554Not Available754Open in IMG/M
3300000550|F24TB_10108398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1482Open in IMG/M
3300000559|F14TC_104879507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales749Open in IMG/M
3300001431|F14TB_102403617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales636Open in IMG/M
3300001431|F14TB_103292975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales819Open in IMG/M
3300003659|JGI25404J52841_10039993Not Available992Open in IMG/M
3300003911|JGI25405J52794_10159399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2516Open in IMG/M
3300004281|Ga0066397_10000121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4078Open in IMG/M
3300004479|Ga0062595_100099380All Organisms → cellular organisms → Bacteria → Proteobacteria1541Open in IMG/M
3300004479|Ga0062595_102001345All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300005332|Ga0066388_100129837All Organisms → cellular organisms → Bacteria → Proteobacteria3062Open in IMG/M
3300005332|Ga0066388_101303617All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300005332|Ga0066388_102194034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae996Open in IMG/M
3300005332|Ga0066388_102479535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales942Open in IMG/M
3300005332|Ga0066388_102490372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria940Open in IMG/M
3300005332|Ga0066388_103286164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales826Open in IMG/M
3300005332|Ga0066388_104759179All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300005332|Ga0066388_107920719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans531Open in IMG/M
3300005337|Ga0070682_100568500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales890Open in IMG/M
3300005347|Ga0070668_100595772All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005441|Ga0070700_100161865All Organisms → cellular organisms → Bacteria → Proteobacteria1541Open in IMG/M
3300005455|Ga0070663_100165973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1703Open in IMG/M
3300005471|Ga0070698_100976538All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300005713|Ga0066905_100014848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3908Open in IMG/M
3300005713|Ga0066905_100161942All Organisms → cellular organisms → Bacteria → Proteobacteria1627Open in IMG/M
3300005713|Ga0066905_100802139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae817Open in IMG/M
3300005713|Ga0066905_101537924Not Available607Open in IMG/M
3300005764|Ga0066903_100118513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3667Open in IMG/M
3300005937|Ga0081455_10006408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium12623Open in IMG/M
3300005983|Ga0081540_1000080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria103320Open in IMG/M
3300005983|Ga0081540_1053754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1972Open in IMG/M
3300005983|Ga0081540_1229261All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300006038|Ga0075365_10256164All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300006042|Ga0075368_10078238All Organisms → cellular organisms → Bacteria → Proteobacteria1343Open in IMG/M
3300006058|Ga0075432_10332519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae639Open in IMG/M
3300006163|Ga0070715_10126571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1224Open in IMG/M
3300006163|Ga0070715_10154739All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300006603|Ga0074064_11324359All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300006844|Ga0075428_100111531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2980Open in IMG/M
3300006844|Ga0075428_100277723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1802Open in IMG/M
3300006852|Ga0075433_10433118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1159Open in IMG/M
3300006904|Ga0075424_102659720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. 1NLS2523Open in IMG/M
3300006914|Ga0075436_101227493Not Available566Open in IMG/M
3300006914|Ga0075436_101485940Not Available514Open in IMG/M
3300006954|Ga0079219_10010344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3102Open in IMG/M
3300007076|Ga0075435_101247991All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300007265|Ga0099794_10360837All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300009094|Ga0111539_10194147All Organisms → cellular organisms → Bacteria → Proteobacteria2368Open in IMG/M
3300009094|Ga0111539_11502067All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300009143|Ga0099792_10086008All Organisms → cellular organisms → Bacteria → Proteobacteria1621Open in IMG/M
3300009143|Ga0099792_10631083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales686Open in IMG/M
3300009147|Ga0114129_10504519All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300009156|Ga0111538_10135574All Organisms → cellular organisms → Bacteria3127Open in IMG/M
3300009162|Ga0075423_12441024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300009553|Ga0105249_10681068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1087Open in IMG/M
3300009553|Ga0105249_11317626All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300009792|Ga0126374_11408547Not Available568Open in IMG/M
3300009811|Ga0105084_1102585Not Available541Open in IMG/M
3300009822|Ga0105066_1040523Not Available964Open in IMG/M
3300009837|Ga0105058_1149686Not Available567Open in IMG/M
3300010046|Ga0126384_10063102All Organisms → cellular organisms → Bacteria → Proteobacteria2604Open in IMG/M
3300010047|Ga0126382_10042634All Organisms → cellular organisms → Bacteria → Proteobacteria2594Open in IMG/M
3300010047|Ga0126382_10844673All Organisms → cellular organisms → Bacteria → Proteobacteria786Open in IMG/M
3300010047|Ga0126382_11487275Not Available622Open in IMG/M
3300010159|Ga0099796_10288500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales692Open in IMG/M
3300010358|Ga0126370_12576432All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum508Open in IMG/M
3300010360|Ga0126372_11872232Not Available644Open in IMG/M
3300010362|Ga0126377_10012187All Organisms → cellular organisms → Bacteria → Proteobacteria6769Open in IMG/M
3300010362|Ga0126377_10055296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3473Open in IMG/M
3300010362|Ga0126377_10203234Not Available1900Open in IMG/M
3300010362|Ga0126377_10749819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1032Open in IMG/M
3300010362|Ga0126377_12453296Not Available597Open in IMG/M
3300010400|Ga0134122_10001240All Organisms → cellular organisms → Bacteria → Proteobacteria18336Open in IMG/M
3300010401|Ga0134121_13119915All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300011444|Ga0137463_1050153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1553Open in IMG/M
3300012096|Ga0137389_10211268All Organisms → cellular organisms → Bacteria → Proteobacteria1620Open in IMG/M
3300012198|Ga0137364_10178768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1547Open in IMG/M
3300012200|Ga0137382_10155649All Organisms → cellular organisms → Bacteria → Proteobacteria1552Open in IMG/M
3300012203|Ga0137399_11571595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300012205|Ga0137362_10109378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2335Open in IMG/M
3300012208|Ga0137376_10284307All Organisms → cellular organisms → Bacteria → Proteobacteria1435Open in IMG/M
3300012359|Ga0137385_10262422All Organisms → cellular organisms → Bacteria → Proteobacteria1493Open in IMG/M
3300012685|Ga0137397_10143449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1767Open in IMG/M
3300012918|Ga0137396_10274376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.21245Open in IMG/M
3300012925|Ga0137419_10447635Not Available1017Open in IMG/M
3300012927|Ga0137416_11233525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense674Open in IMG/M
3300012948|Ga0126375_10279459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1147Open in IMG/M
3300012951|Ga0164300_10761650Not Available595Open in IMG/M
3300012958|Ga0164299_10817792Not Available666Open in IMG/M
3300012971|Ga0126369_10628319Not Available1146Open in IMG/M
3300012988|Ga0164306_11689180Not Available549Open in IMG/M
3300012989|Ga0164305_11408612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300013297|Ga0157378_11752345All Organisms → cellular organisms → Bacteria → Proteobacteria669Open in IMG/M
3300015374|Ga0132255_100998564All Organisms → cellular organisms → Bacteria → Proteobacteria1255Open in IMG/M
3300018051|Ga0184620_10114509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri844Open in IMG/M
3300019360|Ga0187894_10024966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4040Open in IMG/M
3300019789|Ga0137408_1001738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4437Open in IMG/M
3300020583|Ga0210401_10007380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium11027Open in IMG/M
3300021560|Ga0126371_13004705Not Available571Open in IMG/M
3300024288|Ga0179589_10420837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300024347|Ga0179591_1200851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2491Open in IMG/M
3300025905|Ga0207685_10095451All Organisms → cellular organisms → Bacteria → Acidobacteria1261Open in IMG/M
3300025927|Ga0207687_10243584All Organisms → cellular organisms → Bacteria → Proteobacteria1426Open in IMG/M
3300025942|Ga0207689_10251594All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1461Open in IMG/M
3300025961|Ga0207712_10137435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1871Open in IMG/M
3300025961|Ga0207712_11583621Not Available587Open in IMG/M
3300026067|Ga0207678_10141139All Organisms → cellular organisms → Bacteria → Proteobacteria2056Open in IMG/M
3300026371|Ga0257179_1024149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300026555|Ga0179593_1120308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2841Open in IMG/M
3300027646|Ga0209466_1035663Not Available1015Open in IMG/M
3300027866|Ga0209813_10001845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4777Open in IMG/M
3300027866|Ga0209813_10005113All Organisms → cellular organisms → Bacteria3171Open in IMG/M
3300027903|Ga0209488_10327276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1141Open in IMG/M
3300027907|Ga0207428_10056466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3120Open in IMG/M
3300027907|Ga0207428_10113543All Organisms → cellular organisms → Bacteria → Proteobacteria2082Open in IMG/M
3300027907|Ga0207428_10464215All Organisms → cellular organisms → Bacteria → Proteobacteria922Open in IMG/M
3300027909|Ga0209382_10478588All Organisms → cellular organisms → Bacteria → Proteobacteria1375Open in IMG/M
3300027961|Ga0209853_1120143Not Available654Open in IMG/M
3300028802|Ga0307503_10126120All Organisms → cellular organisms → Bacteria → Proteobacteria1130Open in IMG/M
3300031720|Ga0307469_10435866Not Available1130Open in IMG/M
3300031720|Ga0307469_11831264Not Available587Open in IMG/M
3300031740|Ga0307468_100035852All Organisms → cellular organisms → Bacteria → Proteobacteria2429Open in IMG/M
3300031740|Ga0307468_100141055All Organisms → cellular organisms → Bacteria → Proteobacteria1527Open in IMG/M
3300031903|Ga0307407_10460278Not Available925Open in IMG/M
3300031908|Ga0310900_11723564Not Available532Open in IMG/M
3300032205|Ga0307472_102143250Not Available563Open in IMG/M
3300034817|Ga0373948_0007992All Organisms → cellular organisms → Bacteria → Proteobacteria1792Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.45%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere4.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.05%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand3.05%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.05%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.53%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_070944502170459005Grass SoilMADIALHDSYFVGSWSLGFLFPLVVVVLLLGAPALVKYLFFR
INPhiseqgaiiFebDRAFT_10196149823300000364SoilVADRALRDAYMVWNWALASIPALAFIVLTLGAAALIKYLFWR*
INPhiseqgaiiFebDRAFT_10196281223300000364SoilMADIVLHDTYFVGXWSLGFFFLLVVVVLILXAXALIKYLFXR*
INPhiseqgaiiFebDRAFT_10196358923300000364SoilMADIVLHDTYFVGSWSLGFFFLLVVVVLILNAGALIKYLFSR*
INPhiseqgaiiFebDRAFT_10196455423300000364SoilMADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR*
F24TB_1010839823300000550SoilMADIFLQDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
F14TC_10487950723300000559SoilVADMVFHDTYIVWNWSLSLFLLLALIVLILGAAALIKYLFFR*
F14TB_10240361713300001431SoilMNSQMALHDTYIVWNWGLSAIVLLVVVVLILGAAALIKYLFFR*
F14TB_10329297523300001431SoilMADIMLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
JGI25404J52841_1003999313300003659Tabebuia Heterophylla RhizosphereMAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR*
JGI25405J52794_1015939913300003911Tabebuia Heterophylla RhizosphereMALHDTYIVWSWELHLMIFLVIVVLILGAAALIKYLLFR*
Ga0066397_1000012143300004281Tropical Forest SoilMADVVLHDTYIVGNWRLGLLLLLVVVVLILGAAALTKYLFFR*
Ga0062595_10009938013300004479SoilMALHDTYFVWSWELHLLVLLLIVVLVLGAAALIKYLFFK*
Ga0062595_10200134523300004479SoilMADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0066388_10012983743300005332Tropical Forest SoilMADVVLHDTYIVGNSGLGLLLLLVVVVLILGAAALIKYLFFR*
Ga0066388_10130361733300005332Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR*
Ga0066388_10219403423300005332Tropical Forest SoilMALHDTYFIWSWELHLTVLLVIVVLVLGAAALIKYLLFR*
Ga0066388_10247953523300005332Tropical Forest SoilMALHDTYIVWNWELSALLLLVVVVLILGAAALVKYLFFR*
Ga0066388_10249037233300005332Tropical Forest SoilMPDLVFHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR*
Ga0066388_10328616413300005332Tropical Forest SoilMGDVVLHDTYIVWSWGLGFLLLLVVVVLILGAAALIKYLFF
Ga0066388_10475917913300005332Tropical Forest SoilMPDLVMHDTYFVWGWALNAIILLVIIVLLLAAAALIKYLFFR*
Ga0066388_10792071913300005332Tropical Forest SoilMPDLVMHDTYFVWSWALNAIFVLVTIVLLLAAAALIKYLFFR*
Ga0070682_10056850023300005337Corn RhizosphereMIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR*
Ga0070668_10059577223300005347Switchgrass RhizosphereMADIALHDTYFVGSWTLGFFFLLVVVVLLLGTAALVQYLFFR*
Ga0070700_10016186543300005441Corn, Switchgrass And Miscanthus RhizosphereMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR*
Ga0070663_10016597333300005455Corn RhizosphereMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR*
Ga0070698_10097653823300005471Corn, Switchgrass And Miscanthus RhizosphereMADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR*
Ga0066905_10001484833300005713Tropical Forest SoilMADVVLHDTYIVGNWGLGLLLLLVVVVLILGAAALTKYLFFR*
Ga0066905_10016194233300005713Tropical Forest SoilMALHDTYIVWNWELSAILLLVVVVLILGTAALIKYLFFR*
Ga0066905_10080213913300005713Tropical Forest SoilMALHDTYFVWSWELHLIVLLVLVVLVLSAAALVKYLFFR*
Ga0066905_10153792423300005713Tropical Forest SoilMPDLVMHDTYFAWSWALNAIFVLVIIVLLLTAAALIKYLFFR*
Ga0066903_10011851323300005764Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALIKYLFFR*
Ga0081455_10006408123300005937Tabebuia Heterophylla RhizosphereVPDIVLHDIYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR*
Ga0081540_1000080423300005983Tabebuia Heterophylla RhizosphereMALHDTYIVWNWELSALLLLVIVVLILAAAALVKYLFFR*
Ga0081540_105375423300005983Tabebuia Heterophylla RhizosphereVADMAFHDTYFVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0081540_122926113300005983Tabebuia Heterophylla RhizosphereVPDIVLHDTYIVWNWTLSLFLLLALIVLVLGAAALVKYLFFR*
Ga0075365_1025616433300006038Populus EndosphereMPDMALHDTYFVGGWSLGFLFLLVVVVLILGAAALVKYLFFR*
Ga0075368_1007823823300006042Populus EndosphereMPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR*
Ga0075432_1033251923300006058Populus RhizosphereMALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK*
Ga0070715_1012657123300006163Corn, Switchgrass And Miscanthus RhizosphereMALHETYIVWNWEVPIILLLVIIVLILGAAALIKFLLFR*
Ga0070715_1015473923300006163Corn, Switchgrass And Miscanthus RhizosphereMADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR*
Ga0074064_1132435913300006603SoilVADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR*
Ga0075428_10011153123300006844Populus RhizosphereMPDLVIHDTYFVWSWPLNALLALVTIVLLLAAAALIKYLFFR*
Ga0075428_10027772323300006844Populus RhizosphereMNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR*
Ga0075433_1043311813300006852Populus RhizosphereMADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR*
Ga0075424_10265972013300006904Populus RhizosphereDTYFVGSWSLGFFFLLVVVVLILSAGASIKYLLFR*
Ga0075436_10122749313300006914Populus RhizosphereMALHDTYIVWNWELGLLVLLVIVALILGIAALIKYLLFR*
Ga0075436_10148594023300006914Populus RhizosphereMADIALHDTYIVWNWALASIPPLAVFVLVLGAGALIKYLFWR*
Ga0079219_1001034413300006954Agricultural SoilMIAQMALHDTCIAWTWELSAFLLLVVIVLILAAAALIKYLFFR*
Ga0075435_10124799123300007076Populus RhizosphereVAADIVLHETYIVWNWALGLVLLLVLIVLILGAAALVKYLFFR*
Ga0099794_1036083723300007265Vadose Zone SoilMADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLLFR*
Ga0111539_1019414723300009094Populus RhizosphereMIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR*
Ga0111539_1150206723300009094Populus RhizosphereMNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR*
Ga0099792_1008600843300009143Vadose Zone SoilMADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0099792_1063108313300009143Vadose Zone SoilMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW*
Ga0114129_1050451923300009147Populus RhizosphereMADVVLHDTYIVWNWALASIPPLAVIVLVLGAAALIKFLFWR*
Ga0111538_1013557423300009156Populus RhizosphereMPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR*
Ga0075423_1244102413300009162Populus RhizosphereMADIVLHDTYFVGSWSLGFFFLLVVVVLILSAAALIKYLFFR*
Ga0105249_1068106823300009553Switchgrass RhizosphereQMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR*
Ga0105249_1131762623300009553Switchgrass RhizosphereMADIALHDTYFVGSWAFGFFFLLVVVVLVLGAAALVKCLFFR*
Ga0126374_1140854723300009792Tropical Forest SoilMPDIALHDTYYIVGHWGVLGFIMIMLVIIVLVLGAAALVKYLFFR*
Ga0105084_110258523300009811Groundwater SandMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR*
Ga0105066_104052333300009822Groundwater SandAGMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR*
Ga0105058_114968623300009837Groundwater SandMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALTKFLFFR*
Ga0126384_1006310233300010046Tropical Forest SoilMPDLVMHDTYFVWSWPLSALLVLVTIVLLLAAAALIKYLFFR*
Ga0126382_1004263443300010047Tropical Forest SoilMALHDTYFVWSWELHLIVLLVIVVLVLGVAALIKYLLFR*
Ga0126382_1084467323300010047Tropical Forest SoilMVLHDTYIVWQWEVPIILLLVIVVLVLAAAALIKYLFFR*
Ga0126382_1148727513300010047Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLGLVTIVLLLAAAALIKYLFFR*
Ga0099796_1028850023300010159Vadose Zone SoilMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0126370_1257643223300010358Tropical Forest SoilMPDLVMHDTYFVWGWALNAILLLVIIVLLLAAAALIKYLFFR*
Ga0126372_1187223223300010360Tropical Forest SoilMPDLVMHDTYFVWGWALNAILLLVIVVLLLAAAALIKYLFFR*
Ga0126377_1001218763300010362Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYRFFR*
Ga0126377_1005529613300010362Tropical Forest SoilMALHDTYIVWNWELSALLLLVVVVLILGAAALIKYLFFR*
Ga0126377_1020323413300010362Tropical Forest SoilTYIVWNWELSALLLLVVVVLILGAAALIKYLFFR*
Ga0126377_1074981923300010362Tropical Forest SoilMALHDTYIVWNWELSAILLLVVIVLILGAAALIKYLFFR*
Ga0126377_1245329613300010362Tropical Forest SoilMALHDTYFVWSWELHLIVLLVIVVLVLSAAALVKYLFFR*
Ga0134122_10001240203300010400Terrestrial SoilMTAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR*
Ga0134121_1311991513300010401Terrestrial SoilMIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFF
Ga0137463_105015323300011444SoilMADIMLHDTYIVWNWALSLTVPLAVIVLILGAAALIKYLFFR*
Ga0137389_1021126833300012096Vadose Zone SoilMADIMLHDTYIVSNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0137364_1017876823300012198Vadose Zone SoilMVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137382_1015564913300012200Vadose Zone SoilVADMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137399_1157159513300012203Vadose Zone SoilMADITLHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137362_1010937823300012205Vadose Zone SoilMVFHDTYIAWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137376_1028430713300012208Vadose Zone SoilVADMVFHDTYIVWNWALSLFLLLALIVLILGAAALVKYLFFR*
Ga0137385_1026242223300012359Vadose Zone SoilVADMVFHDTYVVWNWALSLFLLLALIMLILGAAALVKYLFFR*
Ga0137397_1014344923300012685Vadose Zone SoilVIADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR*
Ga0137396_1027437613300012918Vadose Zone SoilMADITLHDTDFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137419_1044763513300012925Vadose Zone SoilMADITIHDTYFVWNWVLSLILLLAVIVLVLGAAALIKYLFFR*
Ga0137416_1123352523300012927Vadose Zone SoilMADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLF
Ga0126375_1027945913300012948Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLLLVTIVLLLAAAALLKYLFFR*
Ga0164300_1076165023300012951SoilMSDIVLHDTYIVWNWGFGLVLLLIVFVLILGAAALIKYLLFR*
Ga0164299_1081779233300012958SoilAMADIALHDTYFVGSWTLGFFFLLVVVVLVLGAAALVKYLVFR*
Ga0126369_1062831923300012971Tropical Forest SoilMPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR*
Ga0164306_1168918013300012988SoilMADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAAL
Ga0164305_1140861223300012989SoilMADIVLHDTYFVGSWSLGFFFLLVVVVLILSAGALIKYLFSR*
Ga0157378_1175234523300013297Miscanthus RhizosphereMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFF
Ga0132255_10099856423300015374Arabidopsis RhizosphereMIAQMALHGTYIVWNWELSAILLLVVVVLILRAAALIKYLFF*
Ga0184620_1011450923300018051Groundwater SedimentMADIMLHDTYIVWNWALSLILLLAVIVLILGAAALIKYLFFR
Ga0187894_1002496633300019360Microbial Mat On RocksMTNLALHDTYIVWNWALGSIVLLVVLVLILSAAALIKYLFWR
Ga0137408_100173843300019789Vadose Zone SoilMADIMLHDTYIVWNWALSLIVLLAVIVLVLGAAALIKYLFFR
Ga0210401_1000738093300020583SoilMVFHDTYIVWNWAPSLFLLLALIVLILGAAALVKYLFFR
Ga0126371_1300470523300021560Tropical Forest SoilMPDLALHDTYYVVWHGGISLILLLLVIVLILGAAALIKYLFFR
Ga0179589_1042083723300024288Vadose Zone SoilMADIALHDTYFVGSWSLGFLLLLVVVVLVLGAAALVKYLFFR
Ga0179591_120085133300024347Vadose Zone SoilMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFR
Ga0207685_1009545123300025905Corn, Switchgrass And Miscanthus RhizosphereMADITLHDTYFVLSWSLGFFFLLVVVVLVLGAAALVKYLVFR
Ga0207687_1024358433300025927Miscanthus RhizosphereMADIFLHDTYIVWSWTLSLILLLAVIVLVLGAAALIKYLFFR
Ga0207689_1025159423300025942Miscanthus RhizosphereMADIFLHDTYIVWNWALSLILLLAVIVLVLGAAALIKYLFFR
Ga0207712_1013743533300025961Switchgrass RhizosphereMADIFLHDTYIVWSWTLSLILQLAVIVLVLGAAALIKYLFFR
Ga0207712_1158362113300025961Switchgrass RhizosphereQMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR
Ga0207678_1014113923300026067Corn RhizosphereMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR
Ga0257179_102414923300026371SoilMADIMLHDTYIVWNWAFSLIVLLAVIVLVLGAAALIKYLFFR
Ga0179593_112030853300026555Vadose Zone SoilMRGAMAGMMLHDTYIVWSWALSLILLLVVVVLILGAAALIKYLFFR
Ga0209466_103566313300027646Tropical Forest SoilMPDLVMHDTYFVWSWPLNALLVLVTIVLLLAAAALIKYLFFR
Ga0209813_1000184523300027866Populus EndosphereMPDIALHDTYFVWSWSVGFLFLLVVVVLLLGAAALVKYLFFR
Ga0209813_1000511323300027866Populus EndosphereMLPDTYIVWNWALASIPPLAVIVLVLGAAALVKFLIWR
Ga0209488_1032727623300027903Vadose Zone SoilMVFHDTYVVWNWALSLFLLLALIVLILGAAALVKYLFFW
Ga0207428_1005646643300027907Populus RhizosphereMPDLVMHDTYFVWSWALNAIVVLVIIVLLLAAAALIKYLFFR
Ga0207428_1011354323300027907Populus RhizosphereMALHDTYFVWQWELHLLVLLLIVVLVLGAAALIKYLFFK
Ga0207428_1046421523300027907Populus RhizosphereMIAQMALHDTYIVWTWELSAILLLMVIVLILGAAALIKYLFFR
Ga0209382_1047858823300027909Populus RhizosphereMNAQMALHDTYIVWNWGLSAILLLVVVVLILGAAALIKYLFFR
Ga0209853_112014323300027961Groundwater SandMPDLVMHDTYFVWSWALNAILVLVIVVLLLGAAALIKFLFFR
Ga0307503_1012612033300028802SoilVADLVLHDTYIVWNWALDLILLLALIVLILGAAALVKYLFFR
Ga0307469_1043586613300031720Hardwood Forest SoilMNAQMALHDTYIVWNWELSAILLLVVVVLILGAAALIKYLFFR
Ga0307469_1183126413300031720Hardwood Forest SoilRCLVPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR
Ga0307468_10003585223300031740Hardwood Forest SoilMALHDTYIVWNWELSALLLLVIVVLILGAAALIKYLFFR
Ga0307468_10014105513300031740Hardwood Forest SoilMNAQMALHDTYIVWSWELSAILLLVVVVLILGAAALIKYLFFR
Ga0307407_1046027823300031903RhizosphereMPDLVVHDTYVAWNWALGATLLLFITVLLLGAAALVKYLFFR
Ga0310900_1172356423300031908SoilMSDIVLHDTYIVWNWGFGLVLLLIVLVLILGAAALIKYLLFR
Ga0307472_10214325013300032205Hardwood Forest SoilVPDIVLHDTYIVWNWTLSLFLLLALIVLILGAAALVKYLFFR
Ga0373948_0007992_757_8883300034817Rhizosphere SoilMIAQMALHDTYIVWTWELSAILLLVVIVLILSAAALIKYLFFR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.