


| Basic Information | |
|---|---|
| Family ID | F062002 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 131 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSTRRDFRAMTREAVQASAGAALILGGLLLLSAP |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 131 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.53 % |
| % of genes near scaffold ends (potentially truncated) | 23.66 % |
| % of genes from short scaffolds (< 2000 bps) | 69.47 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.015 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.39% β-sheet: 0.00% Coil/Unstructured: 51.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 131 Family Scaffolds |
|---|---|---|
| PF00682 | HMGL-like | 44.27 |
| PF03976 | PPK2 | 18.32 |
| PF08502 | LeuA_dimer | 8.40 |
| PF01161 | PBP | 2.29 |
| PF02567 | PhzC-PhzF | 1.53 |
| PF01450 | IlvC | 1.53 |
| PF07813 | LTXXQ | 1.53 |
| PF03401 | TctC | 0.76 |
| PF10077 | DUF2314 | 0.76 |
| PF02775 | TPP_enzyme_C | 0.76 |
| PF01042 | Ribonuc_L-PSP | 0.76 |
| PF05015 | HigB-like_toxin | 0.76 |
| PF01494 | FAD_binding_3 | 0.76 |
| PF00230 | MIP | 0.76 |
| PF01566 | Nramp | 0.76 |
| PF02452 | PemK_toxin | 0.76 |
| PF02082 | Rrf2 | 0.76 |
| PF10369 | ALS_ss_C | 0.76 |
| PF02738 | MoCoBD_1 | 0.76 |
| PF00884 | Sulfatase | 0.76 |
| PF03358 | FMN_red | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
|---|---|---|---|
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 18.32 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 8.40 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 6.11 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 3.05 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 2.29 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.53 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.53 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.76 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.76 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.76 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.76 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.76 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.76 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.76 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.76 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.76 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.76 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.76 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.76 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.76 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.76 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.76 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.76 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.31 % |
| Unclassified | root | N/A | 39.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10018900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4315 | Open in IMG/M |
| 3300000574|JGI1357J11328_10016687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3793 | Open in IMG/M |
| 3300000956|JGI10216J12902_118885829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis | 1333 | Open in IMG/M |
| 3300001169|JGI12661J13543_104794 | Not Available | 536 | Open in IMG/M |
| 3300001661|JGI12053J15887_10141774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101690070 | Not Available | 532 | Open in IMG/M |
| 3300003996|Ga0055467_10265676 | Not Available | 544 | Open in IMG/M |
| 3300004082|Ga0062384_100773888 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300004082|Ga0062384_101489177 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005533|Ga0070734_10296442 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005538|Ga0070731_10000673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 42123 | Open in IMG/M |
| 3300005538|Ga0070731_10023698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4215 | Open in IMG/M |
| 3300005538|Ga0070731_10117227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1764 | Open in IMG/M |
| 3300005542|Ga0070732_10000417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 27721 | Open in IMG/M |
| 3300005568|Ga0066703_10160446 | Not Available | 1353 | Open in IMG/M |
| 3300005591|Ga0070761_10053956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2264 | Open in IMG/M |
| 3300005602|Ga0070762_10019998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3484 | Open in IMG/M |
| 3300005602|Ga0070762_10122678 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 1528 | Open in IMG/M |
| 3300005610|Ga0070763_10412795 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 761 | Open in IMG/M |
| 3300005712|Ga0070764_10075544 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300005712|Ga0070764_10967114 | Not Available | 536 | Open in IMG/M |
| 3300005712|Ga0070764_11039034 | Not Available | 517 | Open in IMG/M |
| 3300005764|Ga0066903_100398962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2261 | Open in IMG/M |
| 3300005921|Ga0070766_10676145 | Not Available | 697 | Open in IMG/M |
| 3300006028|Ga0070717_11487060 | Not Available | 614 | Open in IMG/M |
| 3300006057|Ga0075026_100851650 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 557 | Open in IMG/M |
| 3300006176|Ga0070765_100878040 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 848 | Open in IMG/M |
| 3300006844|Ga0075428_100123221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2822 | Open in IMG/M |
| 3300006846|Ga0075430_100000254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 37136 | Open in IMG/M |
| 3300006853|Ga0075420_100246478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
| 3300006854|Ga0075425_100927941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
| 3300006893|Ga0073928_10312582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1176 | Open in IMG/M |
| 3300006893|Ga0073928_10439718 | Not Available | 946 | Open in IMG/M |
| 3300006893|Ga0073928_10540315 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006894|Ga0079215_11338445 | Not Available | 555 | Open in IMG/M |
| 3300006904|Ga0075424_100924229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 931 | Open in IMG/M |
| 3300007982|Ga0102924_1001044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 32673 | Open in IMG/M |
| 3300007982|Ga0102924_1007029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10419 | Open in IMG/M |
| 3300009147|Ga0114129_10289144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2188 | Open in IMG/M |
| 3300009147|Ga0114129_11011871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300009162|Ga0075423_12074237 | Not Available | 616 | Open in IMG/M |
| 3300009521|Ga0116222_1009838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4527 | Open in IMG/M |
| 3300009523|Ga0116221_1263645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 745 | Open in IMG/M |
| 3300009623|Ga0116133_1136107 | Not Available | 638 | Open in IMG/M |
| 3300009632|Ga0116102_1036048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1625 | Open in IMG/M |
| 3300009633|Ga0116129_1203728 | Not Available | 561 | Open in IMG/M |
| 3300009698|Ga0116216_10695866 | Not Available | 611 | Open in IMG/M |
| 3300009764|Ga0116134_1033974 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300009789|Ga0126307_10023615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4675 | Open in IMG/M |
| 3300009792|Ga0126374_11489609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300009824|Ga0116219_10068974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
| 3300009840|Ga0126313_10334065 | Not Available | 1191 | Open in IMG/M |
| 3300010044|Ga0126310_10011221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4180 | Open in IMG/M |
| 3300010045|Ga0126311_10120205 | Not Available | 1832 | Open in IMG/M |
| 3300010050|Ga0133945_100004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1221605 | Open in IMG/M |
| 3300010371|Ga0134125_10350812 | Not Available | 1637 | Open in IMG/M |
| 3300010379|Ga0136449_100036579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11604 | Open in IMG/M |
| 3300010379|Ga0136449_100432676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2317 | Open in IMG/M |
| 3300010379|Ga0136449_100658680 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 1768 | Open in IMG/M |
| 3300010379|Ga0136449_100876862 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300010876|Ga0126361_10478576 | Not Available | 618 | Open in IMG/M |
| 3300010938|Ga0137716_10372403 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 704 | Open in IMG/M |
| 3300011083|Ga0138560_1124892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 604 | Open in IMG/M |
| 3300011411|Ga0153933_1021815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1535 | Open in IMG/M |
| 3300012363|Ga0137390_11018963 | Not Available | 779 | Open in IMG/M |
| 3300014151|Ga0181539_1000938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 33807 | Open in IMG/M |
| 3300014168|Ga0181534_10773669 | Not Available | 566 | Open in IMG/M |
| 3300014168|Ga0181534_10860421 | Not Available | 540 | Open in IMG/M |
| 3300014169|Ga0181531_10169980 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 1320 | Open in IMG/M |
| 3300014201|Ga0181537_10011421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 6577 | Open in IMG/M |
| 3300014201|Ga0181537_10212447 | Not Available | 1329 | Open in IMG/M |
| 3300014489|Ga0182018_10000138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 91014 | Open in IMG/M |
| 3300014493|Ga0182016_10054472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3084 | Open in IMG/M |
| 3300014495|Ga0182015_10518360 | Not Available | 761 | Open in IMG/M |
| 3300014501|Ga0182024_10117090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 3824 | Open in IMG/M |
| 3300014501|Ga0182024_10173636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2987 | Open in IMG/M |
| 3300014501|Ga0182024_10343796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1952 | Open in IMG/M |
| 3300014501|Ga0182024_10390133 | Not Available | 1805 | Open in IMG/M |
| 3300014501|Ga0182024_11322914 | Not Available | 834 | Open in IMG/M |
| 3300014638|Ga0181536_10092706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1744 | Open in IMG/M |
| 3300014638|Ga0181536_10142968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1271 | Open in IMG/M |
| 3300014657|Ga0181522_10107957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1611 | Open in IMG/M |
| 3300014657|Ga0181522_10400741 | Not Available | 820 | Open in IMG/M |
| 3300014838|Ga0182030_11133330 | Not Available | 675 | Open in IMG/M |
| 3300015206|Ga0167644_1004533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 7952 | Open in IMG/M |
| 3300017925|Ga0187856_1012415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 4779 | Open in IMG/M |
| 3300017941|Ga0187850_10242110 | Not Available | 813 | Open in IMG/M |
| 3300017948|Ga0187847_10019749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4181 | Open in IMG/M |
| 3300017948|Ga0187847_10240061 | Not Available | 987 | Open in IMG/M |
| 3300018020|Ga0187861_10108248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1330 | Open in IMG/M |
| 3300018085|Ga0187772_10278773 | Not Available | 1141 | Open in IMG/M |
| 3300018085|Ga0187772_11149644 | Not Available | 571 | Open in IMG/M |
| 3300018429|Ga0190272_11541933 | Not Available | 678 | Open in IMG/M |
| 3300018468|Ga0066662_12365149 | Not Available | 559 | Open in IMG/M |
| 3300019876|Ga0193703_1005632 | Not Available | 1825 | Open in IMG/M |
| 3300020582|Ga0210395_10839294 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 684 | Open in IMG/M |
| 3300021081|Ga0210379_10214709 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 831 | Open in IMG/M |
| 3300021171|Ga0210405_10202380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1574 | Open in IMG/M |
| 3300021178|Ga0210408_10000008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 328608 | Open in IMG/M |
| 3300021401|Ga0210393_10237792 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300021402|Ga0210385_10318953 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300021404|Ga0210389_11370433 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021405|Ga0210387_11663432 | Not Available | 541 | Open in IMG/M |
| 3300021420|Ga0210394_10062427 | Not Available | 3236 | Open in IMG/M |
| 3300021432|Ga0210384_10878926 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 796 | Open in IMG/M |
| 3300021433|Ga0210391_10664749 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300021474|Ga0210390_11153508 | Not Available | 627 | Open in IMG/M |
| 3300027652|Ga0209007_1022434 | Not Available | 1628 | Open in IMG/M |
| 3300027678|Ga0209011_1023266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2000 | Open in IMG/M |
| 3300027826|Ga0209060_10290197 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027842|Ga0209580_10000045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 138351 | Open in IMG/M |
| 3300027869|Ga0209579_10035807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2690 | Open in IMG/M |
| 3300027909|Ga0209382_10866905 | Not Available | 954 | Open in IMG/M |
| 3300027909|Ga0209382_10905985 | Not Available | 928 | Open in IMG/M |
| 3300028746|Ga0302233_10115359 | Not Available | 1051 | Open in IMG/M |
| 3300028808|Ga0302228_10265434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 772 | Open in IMG/M |
| 3300029999|Ga0311339_11218874 | Not Available | 688 | Open in IMG/M |
| 3300030977|Ga0265721_1020642 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 502 | Open in IMG/M |
| 3300031236|Ga0302324_102781515 | Not Available | 589 | Open in IMG/M |
| 3300031525|Ga0302326_11803318 | Not Available | 801 | Open in IMG/M |
| 3300031708|Ga0310686_101384218 | Not Available | 2077 | Open in IMG/M |
| 3300031708|Ga0310686_102485147 | Not Available | 527 | Open in IMG/M |
| 3300031708|Ga0310686_105873251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1338 | Open in IMG/M |
| 3300031719|Ga0306917_10519468 | Not Available | 935 | Open in IMG/M |
| 3300032000|Ga0310903_10244974 | Not Available | 860 | Open in IMG/M |
| 3300032783|Ga0335079_11449158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 680 | Open in IMG/M |
| 3300032895|Ga0335074_10061435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5122 | Open in IMG/M |
| 3300034163|Ga0370515_0237007 | Not Available | 775 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.40% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.82% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.29% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.53% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.53% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.53% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.53% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.76% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Xenic Strain | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain | 0.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001169 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010050 | Microbial community associated with xenic strain of Nostoc sp. EX-5-1 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030977 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100189005 | 3300000567 | Peatlands Soil | MSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP* |
| JGI1357J11328_100166871 | 3300000574 | Groundwater | MSTRRDFRAMTRGAIKARPGAALILGGLLLLIVP* |
| JGI10216J12902_1188858291 | 3300000956 | Soil | MPICRDRRAINRGAEQARSGAALILGGLLLLSVPW |
| JGI12661J13543_1047942 | 3300001169 | Forest Soil | MSTRRDFRAKTREAVQASAGAALILGGLLLLSAP* |
| JGI12053J15887_101417742 | 3300001661 | Forest Soil | MANVMLTRCDFRAITRRAQARPGAALILRGLLLLTVP* |
| JGIcombinedJ26739_1016900701 | 3300002245 | Forest Soil | MSTRCDFRAMTREAVLAAPDAALMDFQLHSQLLGGLLLLIAP* |
| Ga0055467_102656762 | 3300003996 | Natural And Restored Wetlands | RNEGRAMSTRRDFRAITRGALTARPDAVRILDGLLLLSVP* |
| Ga0062384_1007738882 | 3300004082 | Bog Forest Soil | MSFRRELRAMTREAQAAEPVAALSGAALGCCQILGGLLLLSVP* |
| Ga0062384_1014891771 | 3300004082 | Bog Forest Soil | MSTRSDFRAMTGEAVSASSDAALMHFQPHSQFLGGLLLLIAP* |
| Ga0070734_102964422 | 3300005533 | Surface Soil | MSTRRDIRAMTREAAQAAPGAALMPELLGGLLLLIAP* |
| Ga0070731_1000067343 | 3300005538 | Surface Soil | MSTRRGFRAMTREAAQAIPGAALILGGLLLLIAP* |
| Ga0070731_100236982 | 3300005538 | Surface Soil | MSNRSDFRAMTREAQAACSGAALMPCQILGGLLLLSAP* |
| Ga0070731_101172272 | 3300005538 | Surface Soil | MSTRRDFRAMTREAVQASAGAALILGGLLLLSAP* |
| Ga0070732_1000041719 | 3300005542 | Surface Soil | MSTRRDLFRAMTREAVQASAGAALILGGFLLLSAP* |
| Ga0066703_101604461 | 3300005568 | Soil | VMPTRRDIRAITRRGTTPSGAALILGGLLLLSVP* |
| Ga0070761_100539561 | 3300005591 | Soil | MSTRRDFRAMTREALQASAGAALILGGLLLLSAP* |
| Ga0070762_100199982 | 3300005602 | Soil | MSDRRDIRAMTRGASKASSGAALLSLLGGLLLLSTP* |
| Ga0070762_101226781 | 3300005602 | Soil | IHLDPRPLDRNEGLAMSTRRDFRAMTREAVQASAGATLILGGLLLLSAP* |
| Ga0070763_104127952 | 3300005610 | Soil | MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLGGLLLLIAP* |
| Ga0070764_100755443 | 3300005712 | Soil | MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLDGLLLLIAP* |
| Ga0070764_109671142 | 3300005712 | Soil | MSTRRDFRAMTRGAVSAAPDAALMHFPLHSQLLGGLLLLIAP* |
| Ga0070764_110390342 | 3300005712 | Soil | MSTRRDFRAMTREAVSAAPDAALMRFQLHSKLHSQLLGGLLLLIAP* |
| Ga0066903_1003989622 | 3300005764 | Tropical Forest Soil | VISTRSDFRAIRRRAEARPGAALILGGLLLLTVP* |
| Ga0070766_106761452 | 3300005921 | Soil | DPRPLDRNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP* |
| Ga0070717_114870602 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IAVEEGFLAMSIRRDDRAIARGANPGAALILGTLLLLTRP* |
| Ga0075026_1008516501 | 3300006057 | Watersheds | MSTRRDFRAITRGAEKAQPGAAFILGGLLLLSVP* |
| Ga0070765_1008780402 | 3300006176 | Soil | MSTRRDFRAMTWEAVSAAPGAALMRFQLLGGLLLLIAP* |
| Ga0075428_1001232215 | 3300006844 | Populus Rhizosphere | MPICRDSRTINRGAAQARPGAALILGGLLLLSVPWGP* |
| Ga0075430_1000002549 | 3300006846 | Populus Rhizosphere | MPICRDIRAINRGAFEARSGAAFILGGLLLLSVPWGP* |
| Ga0075420_1002464781 | 3300006853 | Populus Rhizosphere | MPICRDNRAINRGASKARSGAAFILGGLLLLSVPWGP* |
| Ga0075425_1009279412 | 3300006854 | Populus Rhizosphere | MRTDVSTRFDIRATDRRASARSDAVLILGGLLLLSVP* |
| Ga0073928_103125822 | 3300006893 | Iron-Sulfur Acid Spring | MSTRRDFRAMTREAVQASAGAGLILGGLLLLSAP* |
| Ga0073928_104397183 | 3300006893 | Iron-Sulfur Acid Spring | MSARRDFRAMTREALQASAGAALILGGLLLLSAP* |
| Ga0073928_105403152 | 3300006893 | Iron-Sulfur Acid Spring | MSPRRDIRAMTRTAVQAWSGAALILGGLLLLSAP* |
| Ga0079215_113384452 | 3300006894 | Agricultural Soil | MPICRDIRAINRGAKPARPGAALILGGLLLLSVP* |
| Ga0075424_1009242291 | 3300006904 | Populus Rhizosphere | MSIGRDLRAINRGATKARPGAALILGGFLLLSVP* |
| Ga0102924_100104415 | 3300007982 | Iron-Sulfur Acid Spring | MSSRRDFRAMTREAQAASPGAALILSGLLLLSTP* |
| Ga0102924_10070296 | 3300007982 | Iron-Sulfur Acid Spring | MSTRRDFRAMTRTAALAASGAALILGGLLLLIAP* |
| Ga0114129_102891442 | 3300009147 | Populus Rhizosphere | MSTRRDLRAITRGADAARPGAALILGGLLLLSVP* |
| Ga0114129_110118712 | 3300009147 | Populus Rhizosphere | MSTRSEIRAITRGADAARPGAALILGGLLLLSVP* |
| Ga0075423_120742372 | 3300009162 | Populus Rhizosphere | MSIGRDLRAINRGAANARPGAALILGGLLLLSVP* |
| Ga0116222_10098382 | 3300009521 | Peatlands Soil | MSFRRDLRAMTRGALAVSSGAALILGGLLLLSAP* |
| Ga0116221_12636452 | 3300009523 | Peatlands Soil | LDGNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP* |
| Ga0116133_11361072 | 3300009623 | Peatland | MSTRSDFRAMTREAVSAAPDAALMPLLGGLLLLIAP* |
| Ga0116102_10360483 | 3300009632 | Peatland | LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSA |
| Ga0116129_12037282 | 3300009633 | Peatland | MSTRRDFRAMTGEAVSAAPDAALMHFPLHFQLLGGLLLLIAP* |
| Ga0116216_106958661 | 3300009698 | Peatlands Soil | MSTRRDFRAMTREALQVSAGAALILGGLLLLSAP* |
| Ga0116134_10339743 | 3300009764 | Peatland | LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSAP* |
| Ga0126307_100236152 | 3300009789 | Serpentine Soil | MPICRDFRAITGRAVQARPGAALILGGLLLLSLP* |
| Ga0126374_114896091 | 3300009792 | Tropical Forest Soil | AVTSVQSDIRAINRGAAAARPGAVRIGGLLLLSVP* |
| Ga0116219_100689742 | 3300009824 | Peatlands Soil | LDGNEGLAMSTRRDFRAMTREAVQASAGATFILGGLLLLSAP* |
| Ga0126313_103340652 | 3300009840 | Serpentine Soil | RVAMPICRDFRAITGRAVQARPGAALILGGLLLLSLP* |
| Ga0126310_100112211 | 3300010044 | Serpentine Soil | MPICRDFRAINRGAAQAQPGAALILGGLLLLIVP* |
| Ga0126311_101202052 | 3300010045 | Serpentine Soil | MPICRDFRAINRGAVQARPGAALILGGLLLLSVP* |
| Ga0133945_100004412 | 3300010050 | Xenic Strain | MSAQEFHRATKRGAVDARPGAALILGGILLLTRP* |
| Ga0074044_100028993 | 3300010343 | Bog Forest Soil | MSPRRDSRAMTRGAVQAKPGAALSGAVLILGGLLLLTAP* |
| Ga0134125_103508122 | 3300010371 | Terrestrial Soil | VMPTRSDFRAMTRGAQPRPGAALILGGLLLLTLP* |
| Ga0136449_1000365795 | 3300010379 | Peatlands Soil | MSFRRDFRAMTREALSASSGADLILAGLLLLNAP* |
| Ga0136449_1004326762 | 3300010379 | Peatlands Soil | MPIRDDSDAIERGARKARPGMALILGGLLLLSAP* |
| Ga0136449_1006586802 | 3300010379 | Peatlands Soil | MSTRRDFRAMTREAVQVSAGAALILGGLLLLSAP* |
| Ga0136449_1008768622 | 3300010379 | Peatlands Soil | MSTRRDFRAMTREAVPASAGAALILGGLLLLSAP* |
| Ga0126361_104785762 | 3300010876 | Boreal Forest Soil | LDGNEGLAMSTRRDFRAMTREALQASAGAALILGGLLLLSAP* |
| Ga0137716_103724032 | 3300010938 | Hot Spring Fe-Si Sediment | MPTRRDIRAIERGADEARPGAAFILGGLLLLSVP* |
| Ga0138560_11248921 | 3300011083 | Peatlands Soil | GIHLDPRPSDRNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP* |
| Ga0153933_10218152 | 3300011411 | Attine Ant Fungus Gardens | MSDRSDIRAMTREAKLAAAGAVLIGKGLLLLSAP* |
| Ga0137390_110189631 | 3300012363 | Vadose Zone Soil | MSTRRDFFRAMTREGCQARPDAALILGGLLLLLSAP* |
| Ga0181539_100093818 | 3300014151 | Bog | MSDRGDFRAMTRGALPARSGAAPMLHGILGGLLLLSVP* |
| Ga0181534_107736691 | 3300014168 | Bog | MSTRRDFRAMTREALKAGPAAVLSGAAFAQRKILGGLLLLSAP* |
| Ga0181534_108604212 | 3300014168 | Bog | DFRAMTREAVLAAPDAALTHSQLHSQLLGGLLLLIAP* |
| Ga0181531_101699801 | 3300014169 | Bog | MSTRRDFRAMTREAVLAAPGAAFMPLLGGLLLLIAP* |
| Ga0181537_100114215 | 3300014201 | Bog | MSTRRDFRAMTRGADAARPGAALVLGGLLLLSAP* |
| Ga0181537_102124472 | 3300014201 | Bog | MSTRSDFRAMTREAVLAAPDAALTHSQLHSQLLGGLLLLIAP* |
| Ga0182018_1000013880 | 3300014489 | Palsa | MSTRRNFRAMTRGADQAKPVAALAGAALILGGLLLLSAP* |
| Ga0182016_100544721 | 3300014493 | Bog | MSTRRDFRAMTRGAEQANPVAAVSGAALALSGIVGAILG |
| Ga0182015_105183603 | 3300014495 | Palsa | LDRDEGLAMSTRRDFRAMTREAVQAAPGVALIVGGLLLLIAP* |
| Ga0182024_101170902 | 3300014501 | Permafrost | MSFRRDFRAMTRGAKAAGPGAALILGGLLLLIAP* |
| Ga0182024_101736363 | 3300014501 | Permafrost | MLNRGDFRAIGRSGAVAASSAALILGGLLLLSAP* |
| Ga0182024_103437962 | 3300014501 | Permafrost | MSTRRDFRAMTREALQASAGAARILGGLLLLSAP* |
| Ga0182024_103901332 | 3300014501 | Permafrost | AMSARRDFRAMTREAVQAAPGAALIVDGLLLLIAP* |
| Ga0182024_113229142 | 3300014501 | Permafrost | MSTRRDFRAMTREAVQAVPGAALILGGLLLLIAP* |
| Ga0181536_100927063 | 3300014638 | Bog | LDGNEGLAMSTRRDFRAMTREAVQASAGATFILGG |
| Ga0181536_101429681 | 3300014638 | Bog | MSARRDFRAMNRTADAARSGAALILGGLLLLIAP* |
| Ga0181522_101079572 | 3300014657 | Bog | MSTRRDFRAMTREALGASAGAALILGGLLLLSAP* |
| Ga0181522_104007412 | 3300014657 | Bog | VQRVNAEFTSIRDLLDHNEGKAMSTRSDFRAMTGEAVSAAPDAALMPLLGGLLLLIAP* |
| Ga0182030_111333302 | 3300014838 | Bog | MTRALAMSTRRDFRAMTRGAVSAAPDAALMHFPLHSQFLGGLLLLIAP* |
| Ga0167644_10045335 | 3300015206 | Glacier Forefield Soil | MSTRRDFRAMTRTAFQATSGAAPMRSKLLGELLLLSAP* |
| Ga0187856_10124158 | 3300017925 | Peatland | MSTRRDFFRAMTRGALQACSGAALILGGLLLLSAP |
| Ga0187850_102421102 | 3300017941 | Peatland | LDGNEGLAMSTRRDFRAMIREAVQASAGAAFILGGLLLLSAP |
| Ga0187847_100197492 | 3300017948 | Peatland | MSTRREFRAMTREAVLAVPVAAFMPLLGGLLLLIAP |
| Ga0187847_102400611 | 3300017948 | Peatland | MSTRRDFRAMTRGAEQANPVAGVCGAALAVSGILDAILGGL |
| Ga0187778_105648962 | 3300017961 | Tropical Peatland | VFHDLVRSQDEGEVMSMCRDFRAITRGADEARPGAALILAGLLLLSTP |
| Ga0187861_101082482 | 3300018020 | Peatland | LDGNEGLAMSTRRDFRAMTREAVQASAGAAFILGGLLLLSAP |
| Ga0187772_102787732 | 3300018085 | Tropical Peatland | LAGVKRADAMSVRGDIRAMTRTASTAGAGAALILGGLLLLIAP |
| Ga0187772_111496442 | 3300018085 | Tropical Peatland | MSMRRDLCRAITREAKKPAARGAALILGGLLLLIAP |
| Ga0190272_115419331 | 3300018429 | Soil | MPIRRDNRAINRGVELAQPGAALILGGLLLLSVPWGP |
| Ga0066662_123651491 | 3300018468 | Grasslands Soil | VMATRRDFRATTRRALAARPGAALILGGLLLLSVP |
| Ga0193703_10056321 | 3300019876 | Soil | NVMPTRRDFRAMTRGAQPRPGAALIFGGLLLLILP |
| Ga0210395_108392942 | 3300020582 | Soil | MSTRRDFRAMTWEAVSAAPGAALMRFQLLGGLLLLIAP |
| Ga0210378_101422951 | 3300021073 | Groundwater Sediment | HDEGEVMSTRRDFRAITRGADAARPGAALILGGLLLLTVP |
| Ga0210379_102147091 | 3300021081 | Groundwater Sediment | VTRANVMPTRRDFRAMIRGAQARPGAALILGGLLLLTIP |
| Ga0210405_102023802 | 3300021171 | Soil | LDGNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP |
| Ga0210408_10000008290 | 3300021178 | Soil | MSTRRDFFRAMTREAVQVRPGAALILGGLLLLSAP |
| Ga0210393_102377922 | 3300021401 | Soil | LDRNEGKAMSTRRDFRAMTGEAVSASSDAALMHFQPHSQFLGGLLLLIAP |
| Ga0210385_103189532 | 3300021402 | Soil | MSTRRDFRAMTREAVSAAPDAALMRFQLHSQLHSKLLGGLLLLIAP |
| Ga0210389_113704332 | 3300021404 | Soil | MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLGGLLLLIAP |
| Ga0210387_116634322 | 3300021405 | Soil | MSTRRDFRAMTREAVSAAPGAALMHVQLRSQLLDGLLLLIAP |
| Ga0210394_100624273 | 3300021420 | Soil | MPFRRDFRAMTREALSASSGAALMHCQMHCKMHCKILGGLLLLSVP |
| Ga0210384_108789262 | 3300021432 | Soil | LDPRPLDRNEGLAMSTRRDFRAMTREAVQASAGAALILGGLLLLSAP |
| Ga0210391_106647492 | 3300021433 | Soil | MSTRCDFRAMTREAVLAAPDAALMDFQLHSQFLGGLLLLIAP |
| Ga0210390_111535081 | 3300021474 | Soil | MSTRRDFRAMTREAVQASAGAALILGGLLLLSAPCGPAGR |
| Ga0209007_10224342 | 3300027652 | Forest Soil | MSTRCDFRAMTREAVLAAPDAALMDFQLHSQLLGGLLLLIAP |
| Ga0209011_10232662 | 3300027678 | Forest Soil | MSTRREFFRAMTREAVQASAGAALILGGLLLLSAP |
| Ga0209060_102901972 | 3300027826 | Surface Soil | MSTRRDIRAMTREAAQAAPGAALMPELLGGLLLLIAP |
| Ga0209580_1000004596 | 3300027842 | Surface Soil | MSTRRDLFRAMTREAVQASAGAALILGGFLLLSAP |
| Ga0209579_100358072 | 3300027869 | Surface Soil | MSNRSDFRAMTREAQAACSGAALMPCQILGGLLLLSAP |
| Ga0209382_108669052 | 3300027909 | Populus Rhizosphere | PICRDSRTINRGAAQARPGAALILGGLLLLSVPWGP |
| Ga0209382_109059851 | 3300027909 | Populus Rhizosphere | MPICRDSRTINRGPERARPGAALILGGLLLLSVPWG |
| Ga0302233_101153592 | 3300028746 | Palsa | MSTRSDFRAMTREAVLATPDAAFMPLLGGLLLLIAP |
| Ga0302228_102654342 | 3300028808 | Palsa | NEGNAMSTRSDFRAMTREAVLATPDAAFMPLLGGLLLLIAP |
| Ga0311339_112188742 | 3300029999 | Palsa | MSTRRDFRAMTGEAVPASTDAALMHFQLLGGLLLL |
| Ga0265721_10206422 | 3300030977 | Soil | LAMSTRREFRAMTREVVQASAGAALILGGLLLLSAP |
| Ga0302324_1027815152 | 3300031236 | Palsa | STRREFRAMTREAVLAVPVAAFMPLLGGLLLLIAP |
| Ga0302326_118033182 | 3300031525 | Palsa | MSTRFDFRAMTREAVLAAPDAVLMHFQLHTQLHSQFLGGLLLLIAP |
| Ga0310686_1013842184 | 3300031708 | Soil | MSTRRDFRAMTREAVSAAPGAALMPLLGGLLLLIAP |
| Ga0310686_1024851472 | 3300031708 | Soil | MSARRDFRAMTREAAKASPAAVLSGCKILGGLLLLSAP |
| Ga0310686_1058732512 | 3300031708 | Soil | MSTRRDFRAMTRGAVSAAPDAALMHFPLHSQLLGGLLLLIAP |
| Ga0306917_105194682 | 3300031719 | Soil | GEMPTRRDIRAITRGAQARPGAALILGGLLLLMVP |
| Ga0310903_102449741 | 3300032000 | Soil | AMPICRDSRTINRGAEQARSGAALILGGLLLLSVPWGP |
| Ga0335079_114491582 | 3300032783 | Soil | SVMSKRRDDRATTRGAETARPGAALILGGLLLLSTP |
| Ga0335074_100614352 | 3300032895 | Soil | MSTRRDPFRAMTREAELALSGACLVICKILGGLLLLSTP |
| Ga0370515_0237007_379_495 | 3300034163 | Untreated Peat Soil | MSTRRDFRAMTGEAVPASTDAALVHFQLLGGLLLLIAP |
| ⦗Top⦘ |