NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061629

Metagenome Family F061629

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061629
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 52 residues
Representative Sequence PHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK
Number of Associated Samples 108
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.31 %
% of genes near scaffold ends (potentially truncated) 95.42 %
% of genes from short scaffolds (< 2000 bps) 93.13 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.710 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(13.741 % of family members)
Environment Ontology (ENVO) Unclassified
(26.718 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.489 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 23.68%    Coil/Unstructured: 76.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF00486Trans_reg_C 3.82
PF07690MFS_1 2.29
PF01261AP_endonuc_2 1.53
PF03162Y_phosphatase2 0.76
PF12006DUF3500 0.76
PF12697Abhydrolase_6 0.76
PF07676PD40 0.76
PF00216Bac_DNA_binding 0.76
PF14031D-ser_dehydrat 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.76
COG2365Protein tyrosine/serine phosphatase Oca4Signal transduction mechanisms [T] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.71 %
UnclassifiedrootN/A2.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101D9EZYAll Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium504Open in IMG/M
2228664022|INPgaii200_c0908431All Organisms → cellular organisms → Bacteria → Proteobacteria844Open in IMG/M
3300000891|JGI10214J12806_11084390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1733Open in IMG/M
3300000891|JGI10214J12806_11420657All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.518Open in IMG/M
3300001991|JGI24743J22301_10043632All Organisms → cellular organisms → Bacteria → Proteobacteria904Open in IMG/M
3300004114|Ga0062593_102262899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium610Open in IMG/M
3300004153|Ga0063455_100033133All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300004157|Ga0062590_100652020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales937Open in IMG/M
3300004479|Ga0062595_100119703All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300004480|Ga0062592_101854061All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium591Open in IMG/M
3300004643|Ga0062591_101339303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium706Open in IMG/M
3300004643|Ga0062591_101980529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium600Open in IMG/M
3300005093|Ga0062594_100894746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria837Open in IMG/M
3300005293|Ga0065715_10327345All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300005294|Ga0065705_10525425All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005294|Ga0065705_11126756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium517Open in IMG/M
3300005295|Ga0065707_10594582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium694Open in IMG/M
3300005332|Ga0066388_104605113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium702Open in IMG/M
3300005333|Ga0070677_10418436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium710Open in IMG/M
3300005334|Ga0068869_100319253All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300005340|Ga0070689_100092147All Organisms → cellular organisms → Bacteria2390Open in IMG/M
3300005340|Ga0070689_101353441All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium642Open in IMG/M
3300005347|Ga0070668_101770309All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.568Open in IMG/M
3300005355|Ga0070671_100045960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3630Open in IMG/M
3300005438|Ga0070701_10456508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria821Open in IMG/M
3300005441|Ga0070700_102013731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium501Open in IMG/M
3300005457|Ga0070662_101416007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium599Open in IMG/M
3300005467|Ga0070706_101396569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium641Open in IMG/M
3300005547|Ga0070693_100108034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1706Open in IMG/M
3300005549|Ga0070704_101425228All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium636Open in IMG/M
3300005564|Ga0070664_101283795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium691Open in IMG/M
3300005577|Ga0068857_102363092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium522Open in IMG/M
3300005616|Ga0068852_101275840All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005718|Ga0068866_11021217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium588Open in IMG/M
3300005764|Ga0066903_103595144All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005843|Ga0068860_102415045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium546Open in IMG/M
3300005937|Ga0081455_11033606Not Available508Open in IMG/M
3300005985|Ga0081539_10462287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium525Open in IMG/M
3300006845|Ga0075421_100003758All Organisms → cellular organisms → Bacteria18233Open in IMG/M
3300006845|Ga0075421_101409184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium766Open in IMG/M
3300006853|Ga0075420_100023882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5478Open in IMG/M
3300006854|Ga0075425_102603371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium559Open in IMG/M
3300006871|Ga0075434_100127868All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300006881|Ga0068865_100305423All Organisms → cellular organisms → Bacteria → Proteobacteria1275Open in IMG/M
3300006881|Ga0068865_102137654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium509Open in IMG/M
3300006903|Ga0075426_10836847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300009094|Ga0111539_12242207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium634Open in IMG/M
3300009094|Ga0111539_12382980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium614Open in IMG/M
3300009156|Ga0111538_11486055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium854Open in IMG/M
3300009162|Ga0075423_13073937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium511Open in IMG/M
3300009177|Ga0105248_11444949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium778Open in IMG/M
3300010359|Ga0126376_11454618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium712Open in IMG/M
3300010362|Ga0126377_10029339All Organisms → cellular organisms → Bacteria4634Open in IMG/M
3300010362|Ga0126377_13567593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium503Open in IMG/M
3300010371|Ga0134125_11523269All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300010397|Ga0134124_11564407All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium689Open in IMG/M
3300010399|Ga0134127_11228420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium817Open in IMG/M
3300010403|Ga0134123_12514965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium581Open in IMG/M
3300011119|Ga0105246_10061535All Organisms → cellular organisms → Bacteria → Acidobacteria2613Open in IMG/M
3300012212|Ga0150985_100492328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1032Open in IMG/M
3300012212|Ga0150985_116542115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria806Open in IMG/M
3300012469|Ga0150984_102268951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300012469|Ga0150984_103513240All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300012469|Ga0150984_111721318All Organisms → cellular organisms → Bacteria → Proteobacteria894Open in IMG/M
3300012469|Ga0150984_117555858All Organisms → cellular organisms → Bacteria → Proteobacteria858Open in IMG/M
3300012469|Ga0150984_119352917All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300012893|Ga0157284_10276569All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.540Open in IMG/M
3300012898|Ga0157293_10069074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria837Open in IMG/M
3300012948|Ga0126375_11509258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium575Open in IMG/M
3300012951|Ga0164300_10251680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300012955|Ga0164298_10744379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium694Open in IMG/M
3300012985|Ga0164308_10387358All Organisms → cellular organisms → Bacteria → Acidobacteria1139Open in IMG/M
3300012985|Ga0164308_11663561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium591Open in IMG/M
3300012989|Ga0164305_11793572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium554Open in IMG/M
3300013297|Ga0157378_11505623All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium717Open in IMG/M
3300014326|Ga0157380_10876852All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300014745|Ga0157377_11207651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium586Open in IMG/M
3300015200|Ga0173480_10350711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria841Open in IMG/M
3300015372|Ga0132256_100388806All Organisms → cellular organisms → Bacteria → Proteobacteria1495Open in IMG/M
3300015372|Ga0132256_101192332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria875Open in IMG/M
3300015372|Ga0132256_103673080All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium516Open in IMG/M
3300015373|Ga0132257_100456494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1561Open in IMG/M
3300015374|Ga0132255_104047505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium622Open in IMG/M
3300015374|Ga0132255_104359504All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium600Open in IMG/M
3300019362|Ga0173479_10328911All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium709Open in IMG/M
3300022889|Ga0247785_1042940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium557Open in IMG/M
3300023102|Ga0247754_1183336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium526Open in IMG/M
3300023261|Ga0247796_1035499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria827Open in IMG/M
3300025899|Ga0207642_10638802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium666Open in IMG/M
3300025901|Ga0207688_10250869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1072Open in IMG/M
3300025901|Ga0207688_11031132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium520Open in IMG/M
3300025908|Ga0207643_10895799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium575Open in IMG/M
3300025930|Ga0207701_10987502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium702Open in IMG/M
3300025932|Ga0207690_10917157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium727Open in IMG/M
3300025936|Ga0207670_10923696All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium732Open in IMG/M
3300025936|Ga0207670_11037157All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium691Open in IMG/M
3300025937|Ga0207669_10845200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium762Open in IMG/M
3300025938|Ga0207704_10663987All Organisms → cellular organisms → Bacteria → Proteobacteria860Open in IMG/M
3300025940|Ga0207691_10086573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2811Open in IMG/M
3300025981|Ga0207640_11191711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium677Open in IMG/M
3300026023|Ga0207677_11284445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium672Open in IMG/M
3300026067|Ga0207678_11599565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium574Open in IMG/M
3300026075|Ga0207708_10237978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1463Open in IMG/M
3300026075|Ga0207708_11359826All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium623Open in IMG/M
3300026088|Ga0207641_10470795All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300026089|Ga0207648_10448587Not Available1174Open in IMG/M
3300027857|Ga0209166_10671225All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium523Open in IMG/M
3300028381|Ga0268264_12548098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium516Open in IMG/M
3300028592|Ga0247822_11419396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium585Open in IMG/M
3300028597|Ga0247820_10832976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium650Open in IMG/M
3300028799|Ga0307284_10049831All Organisms → cellular organisms → Bacteria → Proteobacteria1468Open in IMG/M
3300028889|Ga0247827_11242871All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.518Open in IMG/M
3300031538|Ga0310888_10410631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium796Open in IMG/M
3300031547|Ga0310887_10225941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1032Open in IMG/M
3300031547|Ga0310887_10520406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium719Open in IMG/M
3300031562|Ga0310886_10069002All Organisms → cellular organisms → Bacteria → Proteobacteria1668Open in IMG/M
3300031562|Ga0310886_10526318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium717Open in IMG/M
3300031854|Ga0310904_10228550All Organisms → cellular organisms → Bacteria → Proteobacteria1139Open in IMG/M
3300031892|Ga0310893_10119604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria990Open in IMG/M
3300031901|Ga0307406_10400466All Organisms → cellular organisms → Bacteria → Proteobacteria1088Open in IMG/M
3300031908|Ga0310900_10085867All Organisms → cellular organisms → Bacteria → Proteobacteria1975Open in IMG/M
3300031943|Ga0310885_10109465All Organisms → cellular organisms → Bacteria → Acidobacteria1267Open in IMG/M
3300032000|Ga0310903_10279230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium814Open in IMG/M
3300032017|Ga0310899_10244873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium812Open in IMG/M
3300032075|Ga0310890_11706404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium522Open in IMG/M
3300032122|Ga0310895_10135175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1048Open in IMG/M
3300032421|Ga0310812_10353456All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium658Open in IMG/M
3300033550|Ga0247829_10964464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium709Open in IMG/M
3300033551|Ga0247830_11419325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium555Open in IMG/M
3300034150|Ga0364933_192114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium535Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil13.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.34%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere3.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.05%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.05%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.29%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.29%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.29%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.53%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_070585702189573001Grass SoilYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK
INPgaii200_090843132228664022SoilFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
JGI10214J12806_1108439013300000891SoilTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
JGI10214J12806_1142065723300000891SoilTGNYTWEAPAIYEQPHTYRYIFDRAPGDPPYALEEWCDASDPIEKQSIVPPKQIKG*
JGI24743J22301_1004363233300001991Corn, Switchgrass And Miscanthus RhizosphereRAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0062593_10226289913300004114SoilPKVYQKPHVYRYYFERAPTVESKGTKVSYALEEWCDAGDPIEKQSIIPPKQIIK*
Ga0063455_10003313343300004153SoilPTIYEAPHVYRYYFERAPTVSSGGSAISYALEEWCDAGDPVEKQSIVPPKQIIKKK*
Ga0062590_10065202013300004157SoilIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0062595_10011970313300004479SoilYTWDDPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIKRRP*
Ga0062592_10185406123300004480SoilTYRYIFDRSPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0062591_10133930323300004643SoilVYRYYFERAPSMNSGGKPVSYALEEWCDAGDPVEKQSIIPPKQTIKK*
Ga0062591_10198052923300004643SoilYQKPHQYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0062594_10089474633300005093SoilQRLTITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0065715_1032734533300005293Miscanthus RhizosphereYRYYFDRAPAVESRGTRISYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0065705_1052542513300005294Switchgrass RhizosphereYYFERAPSMNSGGKPVSYALEEWCDAGDPVEKQSIIPPKQTIKK*
Ga0065705_1112675623300005294Switchgrass RhizosphereHVYRYYFDRSPTLDSGGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0065707_1059458213300005295Switchgrass RhizosphereRLTVTYTWDDPKVYQKPHVYRYYFERAPAIESRGTKVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0066388_10460511323300005332Tropical Forest SoilYRYYFDRAPTMNSGGTPVSYALEEWCDAGDPIEKQSIIPPKQIIK*
Ga0070677_1041843613300005333Miscanthus RhizosphereTITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0068869_10031925333300005334Miscanthus RhizosphereKKLTITYTWEDSKIYQQPHTYSYVFDRVPNAYAFEDWCDASDPIEKQSIVPPPQR*
Ga0070689_10009214753300005340Switchgrass RhizosphereQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN*
Ga0070689_10135344113300005340Switchgrass RhizosphereDGKTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0070668_10177030923300005347Switchgrass RhizosphereDGKTMTVNYTWEDPAIYEQPHTYRYIFDRAPGDPPYALEEWCDASDPIEKQSIVPPKQIKG*
Ga0070671_10004596013300005355Switchgrass RhizosphereLTVTYTWNDPKVYQKPHEYRYYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0070701_1045650813300005438Corn, Switchgrass And Miscanthus RhizosphereLTITYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0070700_10201373113300005441Corn, Switchgrass And Miscanthus RhizosphereQKPHVYRYYFDRAPMVESRGTKVSYALEEWCDAGDPVEKQSIIPPKQIIK*
Ga0070662_10141600713300005457Corn RhizosphereTVTYTWNDPKIYAAPHVYRYYFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0070706_10139656913300005467Corn, Switchgrass And Miscanthus RhizosphereHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0070693_10010803443300005547Corn, Switchgrass And Miscanthus RhizosphereTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0070704_10142522823300005549Corn, Switchgrass And Miscanthus RhizosphereMTITYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0070664_10128379533300005564Corn RhizosphereAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0068857_10236309223300005577Corn RhizosphereKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0068852_10127584033300005616Corn RhizosphereYYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0068866_1102121713300005718Miscanthus RhizosphereYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0066903_10359514433300005764Tropical Forest SoilYQKPHVYKYFFDRAPTIDVAGKAVSYALEEWCDAGDPIEKQSIIPPKQIDIK*
Ga0068860_10241504513300005843Switchgrass RhizosphereRFTIVYTWDDPKIYQKPHVYRLYFERAPSVTSNGAPVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0081455_1103360613300005937Tabebuia Heterophylla RhizosphereALSQETSPDGKTMTVTYTWDDAALYEQPHTYRYFFDRAPGNPPYAMEEWCDASDPVEKQSIVPPKQIIK*
Ga0081539_1046228723300005985Tabebuia Heterophylla RhizosphereDPKIYQKPHVYRLYFERAPAVSSKGVPVSYALEEWCDAGDPIEKQSIVPPKQTIRK*
Ga0075421_100003758203300006845Populus RhizosphereYRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0075421_10140918433300006845Populus RhizosphereKLYQKPHVYRYYFDRSPMLESAGTRVSYALEEWCDAGDPIEKQSIVPPKQTIK*
Ga0075420_10002388293300006853Populus RhizosphereYTWDDPKVYQKPHVYRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0075425_10260337123300006854Populus RhizospherePHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0075434_10012786813300006871Populus RhizosphereSPATRLIERFQVAPDGRTMTLTYTWDDPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN*
Ga0068865_10030542343300006881Miscanthus RhizosphereFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0068865_10213765413300006881Miscanthus RhizosphereTYTWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0075426_1083684713300006903Populus RhizosphereTSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIRK*
Ga0111539_1224220723300009094Populus RhizospherePTVTSGGLPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0111539_1238298023300009094Populus RhizosphereIYQKPHVYRYYFERAPTVSSHGAEVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0111538_1148605513300009156Populus RhizosphereVYQKPHVYRYYFERAPTVESKGTKVSYALEEWCDAGDPIEKQSIIPPKQIIK*
Ga0075423_1307393723300009162Populus RhizosphereYFERSPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0105248_1144494913300009177Switchgrass RhizosphereTWEDPKIYQKPHAYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0126376_1145461823300010359Tropical Forest SoilVYRLYFERAPAVSSKGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0126377_1002933913300010362Tropical Forest SoilIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0126377_1356759313300010362Tropical Forest SoilAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0134125_1152326913300010371Terrestrial SoilPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0134124_1156440713300010397Terrestrial SoilMTLTYTWDDPALYEQPHTYHYIFDRAPGNPPYAMEEWCDASDPIEKQSIVPPKQIVK*
Ga0134127_1122842033300010399Terrestrial SoilYRYYFERAPTVSAGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0134123_1251496523300010403Terrestrial SoilYRYYCERAPTVSSAGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0105246_1006153513300011119Miscanthus RhizosphereTQLVERFQVAPDGQTMTVTYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0150985_10049232833300012212Avena Fatua RhizosphereVDSGGAPVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0150985_11054324813300012212Avena Fatua RhizosphereKPHSYHYVFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGK*
Ga0150985_11654211533300012212Avena Fatua RhizosphereVNSGGKPVSYALEEWCDAGDPIEKQSIVPPKQIIK*
Ga0150984_10226895113300012469Avena Fatua RhizosphereKIYQKPHVYQYFFDRAPTVDVAGKSISYALEEWCDAGDPIEKQSIVPPKQVEIK*
Ga0150984_10351324013300012469Avena Fatua RhizosphereGQRLTVTYTWNDPKVYQKPHEYRYYFERAPTVNSGGQPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0150984_11172131833300012469Avena Fatua RhizosphereHVYSYYFERAPTVSSGGSPVSYALEEWCDSGDPVEKQSIVPPKQIIK*
Ga0150984_11755585833300012469Avena Fatua RhizosphereTYTWNDPKIYEAPHVYRYYFERAPTVSSGGSAISYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0150984_11935291743300012469Avena Fatua RhizosphereIYQKPHEYRYYFERAPKIESKAGKFSYALEEWCDAGDPIEQQSIVPPKQIIK*
Ga0157284_1027656923300012893SoilLTYTWDDSAIYEQAHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0157293_1006907433300012898SoilITYTWNDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVERQSIVPPKQIIK*
Ga0126375_1150925813300012948Tropical Forest SoilQKPHVYRLYFERSPAVKSNGALVSYAMEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0164300_1025168033300012951SoilITYTWNDPKIYQTPHVYRYYFERAPTVNSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0164298_1074437913300012955SoilNDPKIYEAPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0164308_1038735843300012985SoilAPTVTSHGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0164308_1166356113300012985SoilVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIKKK*
Ga0164305_1179357223300012989SoilYTWNDPKIYEAPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0157378_1150562313300013297Miscanthus RhizosphereEHFQVAPDGKTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0157380_1087685213300014326Switchgrass RhizosphereQVAADGKTMTLTYTWDDSAIYEQAHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0157377_1120765113300014745Miscanthus RhizosphereRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0173480_1035071113300015200SoilERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK*
Ga0132256_10038880613300015372Arabidopsis RhizosphereWEDPKLYQKPHVYRYYFDRSPMLDSAGAKVSYALEEWCDAGDPIEKQSIIPPKQIIK*
Ga0132256_10119233213300015372Arabidopsis RhizosphereTYTWDDPKIYQTPHVYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0132256_10367308013300015372Arabidopsis RhizosphereDPAIYEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN*
Ga0132257_10045649413300015373Arabidopsis RhizospherePAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK*
Ga0132255_10404750523300015374Arabidopsis RhizosphereFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK*
Ga0132255_10435950423300015374Arabidopsis RhizosphereLVERFQVAPDGQSMTISDTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK*
Ga0173479_1032891113300019362SoilAATHLVERFQVAPDGKTMTVTYTWNDPAIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK
Ga0247785_104294013300022889SoilERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0247754_118333613300023102SoilYQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0247796_103549933300023261SoilVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0207642_1063880213300025899Miscanthus RhizosphereDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0207688_1025086933300025901Corn, Switchgrass And Miscanthus RhizosphereTWDDPKVYQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0207688_1103113223300025901Corn, Switchgrass And Miscanthus RhizosphereQKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0207643_1089579923300025908Miscanthus RhizosphereVYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIIPPKQTIK
Ga0207701_1098750213300025930Corn, Switchgrass And Miscanthus RhizosphereRSPTLDSGGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK
Ga0207690_1091715723300025932Corn RhizosphereVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0207670_1092369613300025936Switchgrass RhizosphereEQPHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIKGGGN
Ga0207670_1103715723300025936Switchgrass RhizosphereKTMTLTYTWNDPVIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK
Ga0207669_1084520033300025937Miscanthus RhizosphereFERAPTVSSGGSSVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0207704_1066398713300025938Miscanthus RhizosphereHFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0207691_1008657363300025940Miscanthus RhizosphereYRYYFERAPTVNSGGKPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0207640_1119171113300025981Corn RhizospherePKLYQKPHVYRYYFDRSPMLESAGAKVSYALEEWCDAGDPIEKQSIIPPKQVIK
Ga0207677_1128444513300026023Miscanthus RhizosphereGRRLTIVYTWEDPKIYQKPHVYRLYFERAPVVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0207678_1159956523300026067Corn RhizosphereKSNGALVSYALEEWCDAGDPIEKQSIVPPKQIIKKK
Ga0207708_1023797813300026075Corn, Switchgrass And Miscanthus RhizosphereYTWDDPKIYQKPHVYRLYFERAPSVTSNGAPVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0207708_1135982623300026075Corn, Switchgrass And Miscanthus RhizosphereMTLTYTWNDPAIYEQPHTYRYIFDRSPGDPPYALEEWCDASDPIEKQSIVPPKQIIK
Ga0207641_1047079523300026088Switchgrass RhizosphereVEDPKIYQKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0207648_1044858713300026089Miscanthus RhizosphereQRLTIVYTWEDPKIYQKPHVYRLYFERAPAVKSNGALVSYALEEWCDAGDPIEKQSIVPPKQTIKK
Ga0209166_1067122513300027857Surface SoilITYTWNDPKIYQAPHVYRYYFERAPTVSSGGAQVSYALEEWCDAGDPIEKQSIVPPKQII
Ga0268264_1254809823300028381Switchgrass RhizosphereRLTVTYTWDDPKVYQKPHVYRYYFERAPMVESRGAKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0247822_1141939613300028592SoilYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTIK
Ga0247820_1083297623300028597SoilYTWTDPKVYQKPHQYRYYFERAPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0307284_1004983113300028799SoilPTVSSGGSPVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0247827_1124287123300028889SoilAHTYRYIFDRAPGDPAYALEEWCDASDPIEKQSIVPPKQIIK
Ga0310888_1041063133300031538SoilVYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK
Ga0310887_1022594113300031547SoilDDPKVYQKPHVYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK
Ga0310887_1052040613300031547SoilLAITYTWNDPKLYQTPHVYRYYFERAPTVSAGGSPVSYALEEWCDAGDPLEKQSIVPPKQIIK
Ga0310886_1006900243300031562SoilLTITYTWNDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0310886_1052631813300031562SoilAGAKISYALEEWCDAGDPVEKQSIVPPKQIKQQPR
Ga0310904_1022855033300031854SoilDPKLYQKPHVYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTIK
Ga0310893_1011960413300031892SoilKIYQKPHVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPLEKQSIVPPKQIIK
Ga0307406_1040046633300031901RhizosphereERSPTIDSAGTPVSYALEEWCDAGDPVEKQSIVPPRQIIK
Ga0310900_1008586713300031908SoilITYTWDDPKLYQKPHVYRYYFDRSPMLESAGTPVSYALEEWCDAGDPIEKQSIVPPKQTI
Ga0310885_1010946543300031943SoilWTDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0310903_1027923013300032000SoilWNDPKIYQAPHVYRYQFERAPTVSSGGAPVSYALEEWCDAGDPLEKQSIVPPKQIIK
Ga0310899_1024487333300032017SoilKPHVYRYYFDRAPTVNSGGTAMSYALEEWCDAGDPIEKQSIVPPKQIIK
Ga0310890_1170640423300032075SoilRLTVTYTWEDPKVYQKPHVYRYYFDRAPMVESKGTKVSYALEEWCDAGDPVEKQSIIPPKQIIK
Ga0310895_1013517533300032122SoilDPKIYQKPHVYRYYFERAPTVNSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK
Ga0310812_1035345623300032421SoilGQSMTISYTWDDPAIYEQPHTYRYLFDRAPGNPPYALEEWCDASDPIEKQSIVPPKQIIK
Ga0247829_1096446413300033550SoilTYTWDDPKIYQKPHVYRYYFERSPLIESRGAKISYALEEWCDAGDPVEKQSIVPPKQIK
Ga0247830_1141932513300033551SoilHVYRYYFDRSPMLDSAGTPVSYALEEWCDAGDPIEKQSIVPPKQIIK
Ga0364933_192114_383_5233300034150SedimentVYRYYFERAPTVSSGGAAVSYALEEWCDAGDPVEKQSIVPPKQIIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.