NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061622

Metagenome / Metatranscriptome Family F061622

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061622
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 53 residues
Representative Sequence MTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATTNVRLP
Number of Associated Samples 101
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.28 %
% of genes near scaffold ends (potentially truncated) 32.82 %
% of genes from short scaffolds (< 2000 bps) 95.42 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.947 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.374 % of family members)
Environment Ontology (ENVO) Unclassified
(37.405 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.359 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.46%    β-sheet: 0.00%    Coil/Unstructured: 58.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF06224HTH_42 39.69
PF01965DJ-1_PfpI 18.32
PF13278Obsolete Pfam Family 9.16
PF12833HTH_18 6.11
PF13419HAD_2 4.58
PF07992Pyr_redox_2 0.76
PF01977UbiD 0.76
PF00581Rhodanese 0.76
PF08031BBE 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 39.69
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.76
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.95 %
UnclassifiedrootN/A3.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2383706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia683Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105181312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia561Open in IMG/M
3300002568|C688J35102_117696258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia500Open in IMG/M
3300002568|C688J35102_120680941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391343Open in IMG/M
3300004081|Ga0063454_100866708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia708Open in IMG/M
3300004153|Ga0063455_100808740All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300004463|Ga0063356_101113157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1139Open in IMG/M
3300004463|Ga0063356_102712534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp.762Open in IMG/M
3300005169|Ga0066810_10194219Not Available507Open in IMG/M
3300005329|Ga0070683_101687621All Organisms → cellular organisms → Bacteria → Terrabacteria group609Open in IMG/M
3300005334|Ga0068869_100186014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391631Open in IMG/M
3300005334|Ga0068869_100931559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia753Open in IMG/M
3300005337|Ga0070682_100056664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia2466Open in IMG/M
3300005337|Ga0070682_101192948All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300005345|Ga0070692_10500471All Organisms → cellular organisms → Bacteria → Terrabacteria group787Open in IMG/M
3300005347|Ga0070668_101628564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia592Open in IMG/M
3300005356|Ga0070674_100311713All Organisms → cellular organisms → Bacteria → Terrabacteria group1258Open in IMG/M
3300005356|Ga0070674_101032172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia723Open in IMG/M
3300005365|Ga0070688_100174006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1488Open in IMG/M
3300005435|Ga0070714_100716335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia966Open in IMG/M
3300005438|Ga0070701_11154928All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300005441|Ga0070700_100817689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia752Open in IMG/M
3300005455|Ga0070663_100448685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1063Open in IMG/M
3300005455|Ga0070663_100730863All Organisms → cellular organisms → Bacteria → Terrabacteria group844Open in IMG/M
3300005455|Ga0070663_101372424All Organisms → cellular organisms → Bacteria → Terrabacteria group625Open in IMG/M
3300005456|Ga0070678_101472822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp.637Open in IMG/M
3300005456|Ga0070678_101804411All Organisms → cellular organisms → Bacteria → Terrabacteria group577Open in IMG/M
3300005457|Ga0070662_101594339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales563Open in IMG/M
3300005458|Ga0070681_11148801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales698Open in IMG/M
3300005543|Ga0070672_101491613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp.606Open in IMG/M
3300005617|Ga0068859_102550454All Organisms → cellular organisms → Bacteria → Terrabacteria group563Open in IMG/M
3300005844|Ga0068862_100876151All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300006846|Ga0075430_101250639All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300006881|Ga0068865_101032501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia721Open in IMG/M
3300006953|Ga0074063_11961887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp.567Open in IMG/M
3300006954|Ga0079219_12014112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia550Open in IMG/M
3300007790|Ga0105679_10209669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1228Open in IMG/M
3300009156|Ga0111538_11532535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia840Open in IMG/M
3300009156|Ga0111538_12707095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia622Open in IMG/M
3300009551|Ga0105238_11204735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia782Open in IMG/M
3300009840|Ga0126313_10195352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1551Open in IMG/M
3300010044|Ga0126310_10090235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans1830Open in IMG/M
3300010044|Ga0126310_10589514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia827Open in IMG/M
3300010045|Ga0126311_10562297Not Available899Open in IMG/M
3300010166|Ga0126306_10247701Not Available1359Open in IMG/M
3300010371|Ga0134125_11437525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia751Open in IMG/M
3300010375|Ga0105239_13066739All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300010401|Ga0134121_11393317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia711Open in IMG/M
3300011107|Ga0151490_1220816All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300012212|Ga0150985_111413097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia916Open in IMG/M
3300012469|Ga0150984_101439441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1460Open in IMG/M
3300012491|Ga0157329_1001771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1151Open in IMG/M
3300012503|Ga0157313_1026213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia632Open in IMG/M
3300012951|Ga0164300_10548341All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300012989|Ga0164305_11713362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia565Open in IMG/M
3300013307|Ga0157372_11079305All Organisms → cellular organisms → Bacteria → Terrabacteria group929Open in IMG/M
3300013308|Ga0157375_12710542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia593Open in IMG/M
3300014497|Ga0182008_10739884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia565Open in IMG/M
3300017792|Ga0163161_10977143All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300018422|Ga0190265_13631230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia514Open in IMG/M
3300018432|Ga0190275_10023871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia4798Open in IMG/M
3300018432|Ga0190275_10487880All Organisms → cellular organisms → Bacteria → Terrabacteria group1263Open in IMG/M
3300018432|Ga0190275_11552240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia740Open in IMG/M
3300018465|Ga0190269_10088178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391497Open in IMG/M
3300018465|Ga0190269_11704683All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300018466|Ga0190268_10000226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia7158Open in IMG/M
3300018466|Ga0190268_10136180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1224Open in IMG/M
3300018466|Ga0190268_10578962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia788Open in IMG/M
3300018466|Ga0190268_11500768All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300018469|Ga0190270_10142844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1929Open in IMG/M
3300018476|Ga0190274_12663638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia597Open in IMG/M
3300018481|Ga0190271_10853123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1035Open in IMG/M
3300018481|Ga0190271_12549688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia613Open in IMG/M
3300018920|Ga0190273_10086636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1711Open in IMG/M
3300018920|Ga0190273_10236189Not Available1174Open in IMG/M
3300018920|Ga0190273_11350804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia619Open in IMG/M
3300018920|Ga0190273_12104815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia526Open in IMG/M
3300019229|Ga0180116_1263069All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300019257|Ga0180115_1123259All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300019377|Ga0190264_10020209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium2222Open in IMG/M
3300019767|Ga0190267_10766107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia635Open in IMG/M
3300019767|Ga0190267_11399432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia531Open in IMG/M
3300020081|Ga0206354_10236202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391248Open in IMG/M
3300021951|Ga0222624_1521589All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300025901|Ga0207688_10222616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1137Open in IMG/M
3300025904|Ga0207647_10773561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia518Open in IMG/M
3300025907|Ga0207645_10248071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1177Open in IMG/M
3300025908|Ga0207643_11003740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia540Open in IMG/M
3300025918|Ga0207662_10862011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia640Open in IMG/M
3300025919|Ga0207657_10332824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391199Open in IMG/M
3300025932|Ga0207690_10397532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391098Open in IMG/M
3300025935|Ga0207709_10205288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-1391410Open in IMG/M
3300025938|Ga0207704_10763064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia805Open in IMG/M
3300025938|Ga0207704_11156793All Organisms → cellular organisms → Bacteria → Terrabacteria group659Open in IMG/M
3300025942|Ga0207689_10139692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1995Open in IMG/M
3300025942|Ga0207689_10226857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1544Open in IMG/M
3300025942|Ga0207689_11657909All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300025945|Ga0207679_12103900All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300025972|Ga0207668_10769263All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300025972|Ga0207668_10962659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia762Open in IMG/M
3300025972|Ga0207668_11306561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia653Open in IMG/M
3300025981|Ga0207640_10651847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia897Open in IMG/M
3300026035|Ga0207703_10075843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia2788Open in IMG/M
3300026118|Ga0207675_102517217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia525Open in IMG/M
3300027880|Ga0209481_10498868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia628Open in IMG/M
3300028381|Ga0268264_12114616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia571Open in IMG/M
3300028587|Ga0247828_10289044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia899Open in IMG/M
3300028587|Ga0247828_10952125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia557Open in IMG/M
3300028589|Ga0247818_11325644All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300028596|Ga0247821_10251622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1061Open in IMG/M
3300028596|Ga0247821_10837382All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300028754|Ga0307297_10028666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1623Open in IMG/M
3300028790|Ga0307283_10148958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia645Open in IMG/M
3300028810|Ga0307294_10140584All Organisms → cellular organisms → Bacteria → Terrabacteria group797Open in IMG/M
3300028812|Ga0247825_10634677All Organisms → cellular organisms → Bacteria → Terrabacteria group766Open in IMG/M
3300028889|Ga0247827_11060391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia554Open in IMG/M
3300030514|Ga0268253_10338591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia531Open in IMG/M
3300031908|Ga0310900_10131474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1663Open in IMG/M
3300031938|Ga0308175_101190321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia847Open in IMG/M
3300031938|Ga0308175_101777094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia690Open in IMG/M
3300032002|Ga0307416_103488058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia526Open in IMG/M
3300032075|Ga0310890_11288255All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300032080|Ga0326721_10036760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia2033Open in IMG/M
3300032080|Ga0326721_10711181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia622Open in IMG/M
3300033551|Ga0247830_10686476All Organisms → cellular organisms → Bacteria → Terrabacteria group813Open in IMG/M
3300034005|Ga0334930_005599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1845Open in IMG/M
3300034007|Ga0334936_015297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1662Open in IMG/M
3300034134|Ga0334928_133783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia512Open in IMG/M
3300034145|Ga0334963_085249All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300034173|Ga0334925_028742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1227Open in IMG/M
3300034221|Ga0334937_144241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia660Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.34%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.05%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.05%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.05%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.29%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.53%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.53%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust1.53%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust1.53%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.53%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.76%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.76%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034005Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNSEnvironmentalOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M
3300034134Biocrust microbial communities from Mojave Desert, California, United States - 24HNCEnvironmentalOpen in IMG/M
3300034145Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 59SNSEnvironmentalOpen in IMG/M
3300034173Biocrust microbial communities from Mojave Desert, California, United States - 21HNCEnvironmentalOpen in IMG/M
3300034221Biocrust microbial communities from Mojave Desert, California, United States - 33SMCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_238370623300000033SoilMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRGLVSATTNVRLP*
INPhiseqgaiiFebDRAFT_10518131223300000364SoilMTAWILLLALAALFALAVRHGRSAEPRMPSGFDGERQLAELRALVSSSTNIRLP*
C688J35102_11769625813300002568SoilMTSWILLIALVALFALAARRDRRSDPPLPCGYDGERQLAELRALVPSTTTLRL
C688J35102_12068094123300002568SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSATTNIRLP*
Ga0063454_10086670813300004081SoilMISAMTSWIVLLALIALFTLAVRHGRATDPPLPRGYDGERQIAELRGITAACTNLRLP*
Ga0063455_10080874023300004153SoilVLLALIALFTLAVRHGRATDPPLPRGYDGERQIAELRGITAACTNLRLP*
Ga0063356_10111315723300004463Arabidopsis Thaliana RhizosphereMSAWIVLLALIVLFTLAVRWGRTAEPTLPRGYDRERQLAELRAMTAATTHRRLLP*
Ga0063356_10271253423300004463Arabidopsis Thaliana RhizosphereMSAWIVLLALIVLFTLAVRWGRTSEPTLPRGYDGERQLAELRAMTAAATRGLLP*
Ga0066810_1019421913300005169SoilMTAWILLLALAALFALAVRHGRPAEPRMPSGFDGERQLAELRALVS*
Ga0070683_10168762113300005329Corn RhizosphereAMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRLP*
Ga0068869_10018601423300005334Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGATTNVRLP*
Ga0068869_10093155923300005334Miscanthus RhizosphereMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSTTSNVRLP*
Ga0070682_10005666423300005337Corn RhizosphereMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVSATTNVRLP*
Ga0070682_10119294823300005337Corn RhizosphereMTAWILLFALAALFALAIRHGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP*
Ga0070692_1050047113300005345Corn, Switchgrass And Miscanthus RhizosphereMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGTTNVRLP*
Ga0070668_10162856413300005347Switchgrass RhizosphereMTAWILLFALAALFALAVRHGRTTEPPMPSGYDGERQIAELRGLVSACTN
Ga0070674_10031171313300005356Miscanthus RhizosphereSAMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATTNVRLP*
Ga0070674_10103217223300005356Miscanthus RhizosphereMSAWIVLLALIALFILALRWGRTAEPTLPHGYDRERQLAELRAMTAANTHGLLP*
Ga0070688_10017400613300005365Switchgrass RhizosphereMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGATTNVRLP*
Ga0070714_10071633523300005435Agricultural SoilMSAWIVLLALIVLFTLAVRRGHTSEPTLPRGYDGERQLAELRAMTAAATRGLLP*
Ga0070701_1115492823300005438Corn, Switchgrass And Miscanthus RhizosphereMSAWIVLLALIVLFTLAVRRGRTSEPTLPRGYDGERQLAELRAMTAAATRGLLP*
Ga0070700_10081768913300005441Corn, Switchgrass And Miscanthus RhizosphereMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATTNVRLP*
Ga0070663_10044868523300005455Corn RhizosphereMTAWILLLALAALFALAVRHGRPAEPRMPSGFDGERQLAELRALVSSSTNIRLP*
Ga0070663_10073086323300005455Corn RhizosphereVERRLSAMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVSATTNVRLP*
Ga0070663_10137242413300005455Corn RhizosphereAMSAWIVLLALIALFILALRWGRTAEPTLPHGYDRERQLAELRAMTAANTHGLLP*
Ga0070678_10147282223300005456Miscanthus RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRLP*
Ga0070678_10180441123300005456Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP*
Ga0070662_10159433923300005457Corn RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAELRALVSSTTNIRLP*
Ga0070681_1114880123300005458Corn RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRMP*
Ga0070672_10149161323300005543Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVSATTNVRLP*
Ga0068859_10255045423300005617Switchgrass RhizosphereMTAWIVLAALVVLFTLAARYAPPSNPPMPSGYDGERQLAELRALVGTTNVRLP*
Ga0068862_10087615113300005844Switchgrass RhizosphereWIVLAALITLFTLATRYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP*
Ga0075430_10125063913300006846Populus RhizosphereMTAWIVLLALVALFTLAVRHGRPAEPSVPPGYDGERQLAELRALVASTTNVRLP*
Ga0068865_10103250123300006881Miscanthus RhizosphereMTAWILLFALAALFALAIRQGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP*
Ga0074063_1196188723300006953SoilMTAWILLLVLAALFTLAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRLP*
Ga0079219_1201411223300006954Agricultural SoilMTAWIVLLALVALFTLAVRLGRSAEPRLPHGYERERQLAELRALTAANTHGLLP*
Ga0105679_1020966923300007790SoilMTAWIVLLALTALFVLAVRHGRSTDPPLPCGYDGERQLAELRALIGTTNVRLP*
Ga0111538_1153253513300009156Populus RhizosphereMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALV
Ga0111538_1270709513300009156Populus RhizosphereMTAWIVLLALVALFTLAVRHGRPAEPSVPPGYDGERQLAELR
Ga0105238_1120473513300009551Corn RhizosphereRLSAMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGATTNVRLP*
Ga0126313_1019535223300009840Serpentine SoilMTAWILLFALAALFALAVRHGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP*
Ga0126310_1009023533300010044Serpentine SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSACTNVRLP*
Ga0126310_1058951423300010044Serpentine SoilMTSWLLLLALIALFTLAVRHGRATDPPLPRGYDGERQIAELRGITAACANVRLP*
Ga0126311_1056229713300010045Serpentine SoilMTAWIVLLALTVAFALAARRVHPNEPPLPPGYDGQRQLAELRALVATDTNAPALTAQ*
Ga0126306_1024770113300010166Serpentine SoilMTAWIVLLALTVAFTLAARGGHPNEPPLPPGYDGQRQLAELRALVATDTNARRP*
Ga0134125_1143752523300010371Terrestrial SoilMSAWIVLLALIALFTLAVRRGRTSEPTLPRGYDGERQLAELRAMTAAATRGLLP*
Ga0105239_1306673923300010375Corn RhizosphereVERRLSAMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0134121_1139331723300010401Terrestrial SoilMSAWIVLLALIVLFTLAVRRGRTSEPTLPRGYDGERQLAELRAMTAVTTRGLLP*
Ga0151490_122081613300011107SoilMTAWILLLALAALFALAVRHGRPTGPRVPSGFDGERQLAELRALVSSSTNIRLP*
Ga0150985_11141309723300012212Avena Fatua RhizosphereMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIA*
Ga0150984_10143944123300012469Avena Fatua RhizosphereMTSWLILLALIALFTLAVRRGRATDPPLPRGYDGERQIAELRGITAACTNLRLP*
Ga0157329_100177123300012491Arabidopsis RhizosphereMTAWILLLALAALFALAVRHGRSAEPRMPSGFDGERQLAELRALVSSSTNICLP*
Ga0157313_102621313300012503Arabidopsis RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAELR
Ga0164300_1054834123300012951SoilMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAELRALVSSSTNIRLP*
Ga0164305_1171336223300012989SoilMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGER
Ga0157372_1107930523300013307Corn RhizosphereVERRLSAMTAWIVLAALITLFTLAARYAPPGDPPMPSGYDGERQLAELRALVSATTNVRLP*
Ga0157375_1271054213300013308Miscanthus RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAEL
Ga0182008_1073988423300014497RhizosphereMIPAMTSWIVLLALIALFALAVRHGRSSDPPLPRGYDGERQIAELRGLTAACANVRLP*
Ga0163161_1097714313300017792Switchgrass RhizosphereAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0190265_1363123023300018422SoilMTAWIVLFALAALFVLAVRHGRPTEPHLPPGYDGERQLAELRALVSACTNVRLP
Ga0190275_1002387153300018432SoilMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATTNVRLP
Ga0190275_1048788013300018432SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSACTNVRLP
Ga0190275_1155224023300018432SoilMTAWILLFALAALFALAVRHGRSAEPPMPSGYDGERQIAELRGLVSATTNIRLP
Ga0190269_1008817833300018465SoilMITAMTSWLLLLALITLFALAVRHGRATDPPLPRGYDGERQIAELRGITAACANVRLP
Ga0190269_1170468313300018465SoilLVVLFTLAVRHGRSPDLPLPPGYDGERQLAELRGIVNASTNVRLP
Ga0190268_1000022653300018466SoilMTAWILLTALVILFALAVRRGRPSDPPFPSGYDGERQLAELRALVARCAPAPRP
Ga0190268_1013618023300018466SoilMTAWILLLALAALFTLAVRHGRSTDPPVPSGYDGERQLAELRALVSSRTNVRLP
Ga0190268_1057896223300018466SoilMTEWIVLLALVVLFTLAVRHGRSTNPPLPQGYDGERQLAELRGLVNACTNVRLP
Ga0190268_1150076823300018466SoilMTAWIVLLALIVLFTLAVRHGRSTDPRVPSGYDGERQLAELRALVGTTNIRLP
Ga0190270_1014284423300018469SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSATTNVRLP
Ga0190274_1266363823300018476SoilMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATSKVRLP
Ga0190271_1085312323300018481SoilMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSATSNVRLP
Ga0190271_1254968813300018481SoilMTAWILLTALVILFALAVRRGRPSDPPFPSGYDGERQLAELRALVARC
Ga0190273_1008663633300018920SoilMTAWIVLLALTALFILALRHGSPGDPAPPPGYERERQLAELRAMTSVLNHGRLP
Ga0190273_1023618923300018920SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSATTNIRLP
Ga0190273_1135080423300018920SoilMTEWIVLLALVVLFTLAVRHGRSPNPPLPQGYDGERQLAELRGLVNACTNVRLP
Ga0190273_1210481523300018920SoilMTSWIVLLALVALFTLAARRARVPDPPLPQGYDGERQLAELRALVACRTNVRLP
Ga0180116_126306923300019229Groundwater SedimentILLLALAALFALAVRHGRPAEPRLPSGFDGERQLAELRALVSSTTNIRLP
Ga0180115_112325913300019257Groundwater SedimentIVLLALAALFALAVRHGRPADPPMPSGYDGERQLAELRALVSSTTNIRLP
Ga0190264_1002020923300019377SoilMIPAMASWILLLALIALFTLAVRHGRAVDPPLPRGYDGERQIAELRGITAACANVRLP
Ga0190267_1076610723300019767SoilMTSWIVLLALIALFALAVRHGRSSDPPLPRGYDGERQIAELRGLTAACTNLRLP
Ga0190267_1139943213300019767SoilMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRG
Ga0206354_1023620223300020081Corn, Switchgrass And Miscanthus RhizosphereMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVSATTNVRLP
Ga0222624_152158913300021951Groundwater SedimentAWILLLALAALFTLAVRHGRSAEPRVPSGFDGERQLAELRALVSSTTNIRLP
Ga0207688_1022261623300025901Corn, Switchgrass And Miscanthus RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRMP
Ga0207647_1077356113300025904Corn RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVSATTNVRLP
Ga0207645_1024807123300025907Miscanthus RhizosphereMTPWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0207643_1100374023300025908Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPGDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0207662_1086201113300025918Switchgrass RhizosphereMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSTTSNVRLP
Ga0207657_1033282413300025919Corn RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGT
Ga0207690_1039753223300025932Corn RhizosphereMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0207709_1020528823300025935Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGATTNVRLS
Ga0207704_1076306413300025938Miscanthus RhizosphereMTAWILLFALAALFALAIRHGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP
Ga0207704_1115679313300025938Miscanthus RhizosphereERRLSAMTAWIVLAALITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0207689_1013969223300025942Miscanthus RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGATTNVRLP
Ga0207689_1022685733300025942Miscanthus RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNIRLP
Ga0207689_1165790923300025942Miscanthus RhizosphereAWIVLLALIALFILALRWGRTAEPTLPHGYDRERQLAELRAMTAANTHGLLP
Ga0207679_1210390023300025945Corn RhizosphereMTAWIVLAALVVLFTLAARYAPPSNPPMPSGYDGERQLAELRALVGATTNVRLP
Ga0207668_1076926313300025972Switchgrass RhizospherePAMSAWIVLLALIVLFTLAVRRGHTSEPTLPRGYDGERQLAELRAMTAAATRGLLP
Ga0207668_1096265923300025972Switchgrass RhizosphereMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAELRALVSSSTNIRLP
Ga0207668_1130656113300025972Switchgrass RhizosphereMTAWILLFALAALFALAVRHGRTTEPPMPSGYDGERQIAELRGLVSACTNV
Ga0207640_1065184723300025981Corn RhizosphereMTAWIVLAAFITLFTLAVRYAPPGDPPMPSGYDGERQLAELRALVGATTNVRLP
Ga0207703_1007584343300026035Switchgrass RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVG
Ga0207675_10251721723300026118Switchgrass RhizosphereMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSSTTNIRMP
Ga0209481_1049886823300027880Populus RhizosphereMTAWIVLLALVALFTLAVRHGRPAEPSVPPGYDGERQLAELRALVASTTNVRLP
Ga0268264_1211461623300028381Switchgrass RhizosphereMTAWIVLAALITLFTLAARYAPPSDPPMPSGYDGERQLAELRALVGTTNVRLP
Ga0247828_1028904423300028587SoilMSAWIVLLALIVLFTLAVRRGHTSEPTLPRGYDGERQLAELRAMTAAATRGLLP
Ga0247828_1095212513300028587SoilMTAWILLLALAALFALAVRHGRPAEPRMPSGFDGERQLAELRALVSSTTNIRLP
Ga0247818_1132564423300028589SoilELVQRRISAMTAWIVLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSTTSNVRLP
Ga0247821_1025162223300028596SoilMTAWIVLLALVALFTLAVRHGRPAEPSVPSGYDGERQLAELRALVASTTNVRLP
Ga0247821_1083738223300028596SoilAALFALAVRHGRPAEPRVPSGFDGERQLAELRALVSSSTNIRLP
Ga0307297_1002866623300028754SoilMTAWILLFALAALFALAVRHGRTAEPPIPSGYDGERQIAELRALVSATTNVRLP
Ga0307283_1014895823300028790SoilMTAWILLFALAALFALAVRHGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP
Ga0307294_1014058413300028810SoilLPAMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAELRGLVSATTNVRLP
Ga0247825_1063467723300028812SoilMTAWILLLALAALFALAVRHGRPAEPRVPSGYDGERQLAELRALVSSTTNVRLP
Ga0247827_1106039123300028889SoilMTAWILLLALAALFALAVRHGRSAEPRMPSGFDGERQLAELRALVSSSTNIRLP
Ga0268253_1033859113300030514AgaveMTSWIVLLALVALFTLAARRARVPDPPLPQGYDGERQLSELRALVACRTN
Ga0310900_1013147433300031908SoilMTAWILLLALAALFALAVRHGRSAEPRMPSGFDGERQLAELRALVSSS
Ga0308175_10119032113300031938SoilMTAWIVLIALTALFVLALRHGGSSDPRLPSGYDGERQLAELRGLTNACTNARLP
Ga0308175_10177709423300031938SoilMTAWILLLALAALFALAVRHGRPAEPRVPSGFDGERQLAELRALVSSTTNIRLP
Ga0307416_10348805813300032002RhizosphereMTAWILLFALAALFALAVRHGRTAEPPMPSGYDGERQIAEL
Ga0310890_1128825513300032075SoilTERILSAMTAWILLLALAALFALAVRHGRSAEPRMPSGFDGERQLAELRALVSSSTNIRL
Ga0326721_1003676013300032080SoilAERRLSAMTAWIVLLALVALFTLAVRHGRPGYPPVPSGYEGERQLAELRGLVNACTNVRL
Ga0326721_1071118113300032080SoilMTAWILLLALAALFTLAVRHGRSTDPPVPSGYDGERQLAELRALV
Ga0247830_1068647613300033551SoilLLALVALFTLAARHGRPADPPVPSGYDGERQLAELRALVSTTSNVRLP
Ga0334930_005599_961_11253300034005Sub-Biocrust SoilMTAWIVILALVALFAVAAWRRGPAEPPLPPGHDGERQLAELRGLINSCTNVRLP
Ga0334936_015297_685_8493300034007BiocrustMTAWIVLLALVALFAVAAWRRGPAEPPLPPGHDGERQLAELRGLINSCTNVRLP
Ga0334928_133783_1_1593300034134Hypolithic BiocrustMTSWLLLLALITLFALAVRHGRTTDPPLPRGYDGERQIAELRGITAACANVRL
Ga0334963_085249_381_5273300034145Sub-Biocrust SoilLFALAALFALAVRHGRTAEPRMPSGYDGERQIAELRGLVSATTNIRLP
Ga0334925_028742_618_7793300034173Hypolithic BiocrustMTAWIVLLALVTLFAWAVRRGPHEPPLPCGYDGERQLAELRGLARAETPLRRS
Ga0334937_144241_518_6583300034221BiocrustMTSWIVLLALAGVFVWAVRRGPARPPFPYGYEGERQLAELRGLVDAC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.