NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061315

Metagenome / Metatranscriptome Family F061315

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061315
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 43 residues
Representative Sequence DAPSAELRARVRDPISLALSYGSGLLLVAVLALMIWKPGA
Number of Associated Samples 115
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 3.03 %
% of genes from short scaffolds (< 2000 bps) 2.27 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (98.485 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.788 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00120Gln-synt_C 12.12
PF10027DUF2269 2.27
PF16363GDP_Man_Dehyd 0.76
PF03951Gln-synt_N 0.76
PF14693Ribosomal_TL5_C 0.76
PF06271RDD 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.76
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A98.48 %
All OrganismsrootAll Organisms1.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100616042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300012951|Ga0164300_11148592Not Available511Open in IMG/M
3300012960|Ga0164301_11169041Not Available616Open in IMG/M
3300012989|Ga0164305_10054956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2352Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.52%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.76%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10061604213300000364SoilGDAPSPELQARVRDPISLALSYGSGLVLVAVLALMVWKPGA*
JGI10214J12806_1021629233300000891SoilAGDAPSAELRARVHDPISLALSYGSGLLLVAVLALMIWKPGA*
JGI10214J12806_1077325733300000891SoilLAAAGDTPSQELTARLRDPVWLALSWGSGIVVLAILALMIWKPGA*
JGI10216J12902_10699722613300000956SoilPSAELRARLRDPVTLFLSYGSALVIVAMVAIMVWKPGA*
JGI10216J12902_11090728613300000956SoilLVASGDAPSPELRRRVRDPVSLALSYGSGLVLVALLAIMIWKPGA*
JGI10216J12902_11586130333300000956SoilRELAAAGDAPSPELRARVRDPVSLALSYGSGLLLVTILALMIWKPGA*
A15PFW1_1098702733300001534PermafrostMAQGDAPSPELRARVRDPITLACNYGSGLILVALLAIMIWKPGA*
C688J35102_11827471823300002568SoilAGQGDSPSLELRARLRDPLSLALSYGSGAVVIAILALMIWKPGS*
Ga0055455_1028698213300003990Natural And Restored WetlandsERLAAEGGRPSTELQARLRDPTSLVLSYGSGVAVLAILVLMIWKPGS*
Ga0062591_10075298633300004643SoilLAAEGDQPSPELRASLRDPITLAMSWGSGAIVIVILVLMIWKPGH*
Ga0062591_10211601423300004643SoilLARELAAAGDAPSAELRARVHDPISLALSYGSGLLLVAVLALMIWKPGA*
Ga0062594_10057510733300005093SoilRLAAQGDQPSPELRARLRDPLTLALSYGSGLAVLAILALMIWKPGS*
Ga0062594_10303670013300005093SoilSEGDAPSPELRARLRDPKGLALVWTSFLLTLAILVLMIWKPGA*
Ga0066685_1078549913300005180SoilRFLAERLAAEGDEPSRELRRRLRDPLTLALSWSSGALTLAILGLMIWKPGA*
Ga0066676_1043082213300005186SoilKQVRELAERLAAEGDVPSAELSKRLRDPVWLALSWGSGLVVIAILALMIWKPGH*
Ga0070713_10063948513300005436Corn, Switchgrass And Miscanthus RhizosphereEGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH*
Ga0070711_10187759323300005439Corn, Switchgrass And Miscanthus RhizosphereRELAASGDAPNAELKARVRDPVSLALSYGSGLVLVVILALMVWKPGA*
Ga0070694_10052995413300005444Corn, Switchgrass And Miscanthus RhizosphereASGDAPSAELQARLRDPVSLALSYGSGLVLVIVLALMVWKPGA*
Ga0070707_10120287213300005468Corn, Switchgrass And Miscanthus RhizosphereAAEGDAPSTELRARMRDPVTLALSWGSGLVVVAILAIMIWKPGH*
Ga0073909_1032865813300005526Surface SoilQELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA*
Ga0070741_1127866113300005529Surface SoilAREGDAPSEELRSTLRDPLSYALNFGSGLVVFAVLALMIWKPGS*
Ga0068856_10059739613300005614Corn RhizosphereQGDAPSAELHARVRDPISLAGSYGSGLILVALLAIMIWKPGA*
Ga0066905_10032655143300005713Tropical Forest SoilELAEQLAAQGDQPSPELRARLRDPVTLALSWGSGVVVVVILILMIWKPGH*
Ga0068863_10228711413300005841Switchgrass RhizosphereETRVLAERLASEGDAPSTELRARMRDPLTLALSWGSGVVVIAILALMIWKPGH*
Ga0068858_10116374833300005842Switchgrass RhizosphereASGDAPSAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA*
Ga0081539_1037143723300005985Tabebuia Heterophylla RhizosphereRPSDELRARLHDPVALALNAASTLALVILLALMVWKPGA*
Ga0070717_1063694213300006028Corn, Switchgrass And Miscanthus RhizosphereAAEGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH*
Ga0075432_1020627813300006058Populus RhizosphereGDQPSPELRASLRDPITLAMSWGSGAIVVVILVLMIWKPGH*
Ga0070715_1033854233300006163Corn, Switchgrass And Miscanthus RhizosphereRALAAAGDEPSAELRARVRDPISLALSYGSGLLLVLVLALMIWKPGA*
Ga0075367_1082936823300006178Populus EndosphereRLAAEGDQPSPELRASLRDPITLAMSWGSGAIVVVILVLMIWKPGH*
Ga0074048_1249885513300006581SoilAGDAPSAELLERVRDPVALVLNYGSGLLLVAILAIMIWKPGA*
Ga0074057_1004507513300006605SoilDRHTRALAEQLAASGDQPSTELASRLHERGTLLLSYGSGAAVIAILVLMIWKPGS*
Ga0075421_10151041423300006845Populus RhizosphereSPELRRRLRDPVWLALSYGSGLVLVAILAIMIWKPGA*
Ga0075433_1160052423300006852Populus RhizosphereGGDEPSADLKRRLRDPVSLALSYGSGLVLVAILAIMIWKPGA*
Ga0068865_10075790613300006881Miscanthus RhizosphereAPSQELSARLRDPMWLALSWGSGVVVIAILALMVWKPGA*
Ga0066710_10328046623300009012Grasslands SoilELAERLAAEGDVPSAELSKRLRDPVWLALSWGSGLVVIAILALMIWKPGH
Ga0066709_10173834413300009137Grasslands SoilDAPSPELEARLPDPLTLALSYGGGVAILAILVIMIWKPGA*
Ga0111538_1226471333300009156Populus RhizosphereAEELAAKGDAPSVALKERLRDPISLILSYFGGAAVIAALVLMVWKPGA*
Ga0105242_1057225013300009176Miscanthus RhizosphereDTPSQELTARLRDPVWLALSWGSGIAIIAILALMIWKPGA*
Ga0105248_1205588913300009177Switchgrass RhizosphereELRARVRDPISLMLSYGSGLVLVAVLALMVWKPGA*
Ga0105238_1023470613300009551Corn RhizosphereGDAPSAELTARLRDPVWLALSWGSGIVVLVILALMIWKPGT*
Ga0126374_1046823913300009792Tropical Forest SoilARRLAAEGDAPSDELRARVHHPISLALSYGSGLLLVAVLALMIWKPGA*
Ga0126374_1134663113300009792Tropical Forest SoilDAPSAELRARVRDPISLALSYGSGLLLVAVLALMIWKPGA*
Ga0105058_101881813300009837Groundwater SandAERLAADGDQPSAELSERLRDPVALAMNWSSGLVAVAILGLMIWKPGA*
Ga0126305_1084115123300010036Serpentine SoilELHAHLRDPLSLGLSWGSGVVVVVILALMIWKPGT*
Ga0126304_1023548013300010037Serpentine SoilREKETRRLAERLAAEGDAPSDELHARLRDPLSLGLSWGSGVVVVVILALMIWKPGT*
Ga0126312_1086059623300010041Serpentine SoilDTGLRVRLRDPVTLALEYSSGLAILVILVLMIWKPGQ*
Ga0126314_1117942313300010042Serpentine SoilHELAEEGDAPSAVIRRRVRDPLSLALSYGAGILMVAVLALMVWKPGA*
Ga0126310_1009523233300010044Serpentine SoilAELRARVHDPISLALSYGSGLILIVILALMTWKPGA*
Ga0134071_1035385533300010336Grasslands SoilATGGDQPSPELQARLRDPVTLALSWGSGAVVIVILALMIWKPGA*
Ga0126377_1134461913300010362Tropical Forest SoilLRARVRDPISLTLSYGSGLLLVLVLALMIWKPGA*
Ga0126377_1343299123300010362Tropical Forest SoilLLARLRDPRTLALDYGSGVVLVVVLALMVWKPGS*
Ga0126379_1229850923300010366Tropical Forest SoilLAAEGDQPSSELRGRLRDPVTLAMSWGSGLAVIGILALMIWKPGH*
Ga0134128_1298559723300010373Terrestrial SoilSRTAELAARIASEGDEPTTELRRRLRDPLSLAYNFGSGLVVLAILGLMIWKPGS*
Ga0134126_1160509313300010396Terrestrial SoilELTARLRDPVWLALSWCSGIVIIVILALMIWKPGA*
Ga0134121_1106185333300010401Terrestrial SoilDEPIAELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA*
Ga0138514_10007195623300011003SoilDQPSAELRARMRDPLSLALSYGSGLAILAMLAIMIWKPGE*
Ga0137388_1044320913300012189Vadose Zone SoilDAPSRELKARLRDPATLVLSYGAGVAILGILALMIWKPGA*
Ga0137364_1010989913300012198Vadose Zone SoilLQARLRDPLTLALSWGSGTVVIVILALMIWKPGA*
Ga0150985_10538180113300012212Avena Fatua RhizosphereSPELRSSLRDPITLAMSWGSGAVVVVILVLMIWKPGH*
Ga0150985_10962101613300012212Avena Fatua RhizosphereELQARVRDPISLAGSYGSGLILVALLAIMIWKPGA*
Ga0137387_1013682713300012349Vadose Zone SoilAAEGDAPSRELTARLRDPVWLALSWGSGIVIVAILALMIWKPGA*
Ga0137366_1052094323300012354Vadose Zone SoilMQQETRILAERLAAEGDAPSQELRARLHDRVALALSWSSGFAALAILALMIWKPGA*
Ga0137375_1112990713300012360Vadose Zone SoilRLAAQGDAPSPELRARLRDPVALALSWSSGLAALAILAMMIWKPGA*
Ga0137361_1171530213300012362Vadose Zone SoilERKVRELAERLTAEGDLPSPELSARLRDPIWLAVSWSSGIAAIAILALMIWKPGA*
Ga0150984_11353882013300012469Avena Fatua RhizospherePELRARVHDPVSLALSYGSGLVLVIVLALMIWKPGA*
Ga0137373_1016169243300012532Vadose Zone SoilSELAARVRDPVALSLNIASSLLGFAILAVMIWKPGAGG*
Ga0137404_1062999333300012929Vadose Zone SoilGREKQTRELAERLAAEGDAPSKELSSRLRDPVWLALSWGSGVVIIAILALMIWKPGT*
Ga0164300_1049752413300012951SoilASGDAPSAELRARVHDPISLALSYGSGLVLIAVLALMVWKPGA*
Ga0164300_1114859213300012951SoilLAGSGDAPSPELRARVHDPISLALSYGSGLVLIVVLALMIWKPGA*
Ga0164298_1044812433300012955SoilVRQPPRQELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA*
Ga0164303_1009462213300012957SoilQLAERLAAEGDAPSQELSARLRDPTWLALSWGSGVVVIAILALMIWKPGA*
Ga0164303_1079206623300012957SoilLASSLDELAASGDAPSAELRARVHDPISLALSYGSGLVLIAVLALMVWRPGA*
Ga0164299_1005854813300012958SoilELTARLRDPVWLGLSWGSGIVILVILALMIWKPGT*
Ga0164301_1116904113300012960SoilRQARVRDPISLALSYGSGLVLIAGLALMVWKPGA*
Ga0134077_1048404623300012972Grasslands SoilAELRARVRDPVALSLNIVSSLLGLAILVVMIWKPGAPG*
Ga0164309_1015223543300012984SoilLAAEGDTLSQELTARLRDPVWLALSWASGIVIVAILALMIWKPGA*
Ga0164308_1014622613300012985SoilLSARLRDPMWLALSWGSGIVVIAILALMIWKPGA*
Ga0164307_1012433013300012987SoilAPSAELTARLHDPVWLALSWGSGIVILVILALMIWKPGT*
Ga0164307_1111982113300012987SoilEELAAGSNVATPELRARMRDTRTLALSYGSGLMLVAVLALMVWKPGA*
Ga0164305_1005495613300012989SoilSPELKARVHDPISLALSYGSGLVLIAVLALMVWKPGA*
Ga0157379_1143847323300014968Switchgrass RhizosphereSAELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA*
Ga0132256_10365081523300015372Arabidopsis RhizosphereAERLAVEGDAPSPELHAGLRDPVTLALSWGSGLLFVVVLALMIWKPGH*
Ga0132257_10202220213300015373Arabidopsis RhizosphereAPSAELGARLRDPTTLALEYSSGLAVLVILVLMVWKPGA*
Ga0187779_1041612333300017959Tropical PeatlandGDVASEDLRARLRDPATLALSFGSGVIVFVILVLMIWKPGS
Ga0184610_127384613300017997Groundwater SedimentRLASEGDAPSQELSARLRDPVWLALSWGSGIVIVAILALMIWKPGA
Ga0184621_1018935623300018054Groundwater SedimentAPSAELQARVRDPITLACNYGSGLILVALLALMIWKPGA
Ga0184619_1001116813300018061Groundwater SedimentLAAEGDQPSTELHARLRDPLTLALSWGSGAVVIVILALMIWKPGA
Ga0193730_117489513300020002SoilSPELRARVRDPISLTLSYGSGLLLIAVLALMIWKPGA
Ga0213880_1015355823300021953Exposed RockGGDAPSGELKARLRDPVSLALSYGGGLAVLAIFVLMLSKPGS
Ga0207645_1103205413300025907Miscanthus RhizospherePELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA
Ga0207643_1106670223300025908Miscanthus RhizosphereELRARVHDPISLALSYGSGLLLVLVLALMIWKPGA
Ga0207663_1082894213300025916Corn, Switchgrass And Miscanthus RhizosphereTLSTELRARMRDPLTLALSWGSGVVVIAILALMIWKPGH
Ga0207687_1105690313300025927Miscanthus RhizosphereLAAGSNEATPELRARMRDPRTLALSYGSGLMLVAILALMVWRPGS
Ga0207700_1064216213300025928Corn, Switchgrass And Miscanthus RhizosphereRLAAEGDQPSPELRASLRDPVTLAMSWGSGLVVVAILVVMIWKPGH
Ga0207686_1060414933300025934Miscanthus RhizosphereQELTARLRDPVWLALSWGSGIAIIAILALMIWKPGA
Ga0207704_1070741833300025938Miscanthus RhizosphereAPSQELSARLRDPMWLALSWGSGVVVIAILALMVWKPGA
Ga0207704_1097473223300025938Miscanthus RhizosphereQGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA
Ga0207711_1135440323300025941Switchgrass RhizosphereASGDAPSAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA
Ga0207679_1105581623300025945Corn RhizosphereSGDAPSAELQARLRDPVSLALSYGSGLVLVIVLALMVWKPGA
Ga0207668_1121308333300025972Switchgrass RhizosphereDAPSAELTARLRDPVWLALSWGSGIVVLVILALMIWKPGT
Ga0207640_1104294123300025981Corn RhizosphereELKARVHDPISLALSYGSGLVLIAVLALMVWKPGA
Ga0207683_1057883113300026121Miscanthus RhizosphereVLAERLASEGDAPSTELRPRMRDPLTLALSWGSGVVVIAILALMIWKPGH
Ga0209160_128975413300026532SoilPELKARLRDPATLVLSYGAGVAILGILALMIWKPGA
Ga0209577_1082581623300026552SoilQGDQPSAELRTRLRDPVSLALSWGSGLAVVAILALMIWKPGG
Ga0209842_106062423300027379Groundwater SandRLAADGDQPSAELSERVRDPVALAMSWSSGLVAVAILGLMIWKPGA
Ga0209811_1031411423300027821Surface SoilPTQELSARLRDPMWLALSWGSGIVVIAILALMIWKPGA
Ga0268266_1158535013300028379Switchgrass RhizosphereSAELKARVRDPISLMLSYGSGLVLVAVLALMVWKPGA
Ga0307291_108434423300028707SoilELRARVHDPVSLALSYGSGLVLIAILALMIWKPGA
Ga0307293_1011930933300028711SoilLAAQGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA
Ga0307309_1009512333300028714SoilLALEGDAPSQELSARLRDPMWLALSWGSGVVVIAILALMIWKPGA
Ga0307313_1002372133300028715SoilDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA
Ga0307311_1009957333300028716SoilFAEELATQGDAPSAELRSRVRDPITLACNYGSGLILIALLAIMIWKPGA
Ga0307319_1001364143300028722SoilAASGDAPSAELRGRVRDPISLALSYGSGLVLVALLAIMIWKPGA
Ga0307280_1021750413300028768SoilEDETRKLAERLAAEGDVSSGELRARLRDPVTLALEYSSGLAVVVILVLMIWKPGG
Ga0307306_1003556413300028782SoilSGDAPSQELKARVRDPISLTLSYGSGLVLIAVLALMVWKPGA
Ga0307323_1010701533300028787SoilGDAPSVALKQRLRDPISLILSYFGGVAVIAALVLMVWKPGA
Ga0307323_1017350913300028787SoilELVAQGDAPSAELRARVRDPITLICNYGSGLILVALLAIMIWKPGA
Ga0265338_1021740543300028800RhizosphereDVATAELRSRLRDPVALLLSWGSGGATLAVLALMIWKPGA
Ga0307294_1028906113300028810SoilGDAPSAELQARVRDPITLACNYGSGLILVALLALMIWKPGA
Ga0307294_1036974923300028810SoilTPSQELTARLRDPVWLALSWGSGIVIVAILALMIWKPGA
Ga0307312_1018946513300028828SoilPSPELKARVRDPISLTLSYGSGLVLIAVLALMVWKPGA
Ga0307312_1065128713300028828SoilAGGDAPSPELRARLRDPISLALSWGSGVVVVVILALMIWKPGA
Ga0307312_1093873823300028828SoilMAERLAREGDAPSSELRARLHNPVALALSWSSGLATLAILALMIWKPGA
Ga0307286_1034072723300028876SoilSPELRARVHDPVSLALSYGSGLVLIAILALMIWKPGA
Ga0307308_1061824013300028884SoilEKKVRELAERLTAEGDVPNADLSARLRDPVLLALSWGSGIVVIAILALMIWKPGA
Ga0307304_1057401913300028885SoilLTAEGDVPSPELSARLRDPVWLAVSWGSGIVVIAILALMIWKPGA
Ga0307304_1061660523300028885SoilGGKREDETRKLAERLAAEGDVSSGELRARLRDPVTLALEYSSGLAVVVILVLMIWKPGG
Ga0307499_1031943823300031184SoilPSAELTARLRDPVWLALSWGSGIVILVILALMIWKPGT
Ga0308174_1157045023300031939SoilAPSGALRARLRDPVSLTLSYGSGLAVLLIVADMIWKPGA
Ga0307409_10199262623300031995RhizosphereAAGDAPSAELRARVHDPISLALSYGSGLILIVILALMTWKPGA
Ga0307470_1183324013300032174Hardwood Forest SoilTAKFAAELAAQGDAPSPELRSRVRDPISLALSYGSGLVLVAILAIMIWKPGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.