NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061107

Metagenome / Metatranscriptome Family F061107

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061107
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 41 residues
Representative Sequence MKVLYERVAGIDVHKDMIKVAIRSPGDKPWTRKTEILEYRTF
Number of Associated Samples 115
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.73 %
% of genes near scaffold ends (potentially truncated) 93.94 %
% of genes from short scaffolds (< 2000 bps) 93.94 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.394 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.364 % of family members)
Environment Ontology (ENVO) Unclassified
(21.212 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.242 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 35.71%    Coil/Unstructured: 64.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF02371Transposase_20 3.03
PF13683rve_3 2.27
PF13359DDE_Tnp_4 1.52
PF01548DEDD_Tnp_IS110 1.52
PF07883Cupin_2 1.52
PF13408Zn_ribbon_recom 0.76
PF01063Aminotran_4 0.76
PF04075F420H2_quin_red 0.76
PF09509Hypoth_Ymh 0.76
PF02945Endonuclease_7 0.76
PF13701DDE_Tnp_1_4 0.76
PF13604AAA_30 0.76
PF08388GIIM 0.76
PF00266Aminotran_5 0.76
PF00589Phage_integrase 0.76
PF13414TPR_11 0.76
PF13629T2SS-T3SS_pil_N 0.76
PF00990GGDEF 0.76
PF07582Obsolete Pfam Family 0.76
PF16859TetR_C_11 0.76
PF02518HATPase_c 0.76
PF13328HD_4 0.76
PF00561Abhydrolase_1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 4.55
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.39 %
UnclassifiedrootN/A35.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_108065611All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300001356|JGI12269J14319_10244616All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005181|Ga0066678_11118058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala506Open in IMG/M
3300005332|Ga0066388_107439874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala550Open in IMG/M
3300005355|Ga0070671_101695909All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005435|Ga0070714_101617609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium canettii633Open in IMG/M
3300005450|Ga0066682_10234882Not Available1179Open in IMG/M
3300006028|Ga0070717_11841895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium senegalense546Open in IMG/M
3300006175|Ga0070712_101575165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala574Open in IMG/M
3300006804|Ga0079221_10068967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1645Open in IMG/M
3300006806|Ga0079220_10390771All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300007076|Ga0075435_100197763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp.1703Open in IMG/M
3300009090|Ga0099827_11074169Not Available699Open in IMG/M
3300009162|Ga0075423_10681884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300009521|Ga0116222_1220432Not Available817Open in IMG/M
3300009522|Ga0116218_1468908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium OK006561Open in IMG/M
3300009523|Ga0116221_1170952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala944Open in IMG/M
3300009523|Ga0116221_1369705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala623Open in IMG/M
3300009523|Ga0116221_1510417Not Available527Open in IMG/M
3300009525|Ga0116220_10546283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala529Open in IMG/M
3300009624|Ga0116105_1169583Not Available588Open in IMG/M
3300009662|Ga0105856_1325448Not Available520Open in IMG/M
3300009698|Ga0116216_10334097Not Available922Open in IMG/M
3300010047|Ga0126382_12281688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala523Open in IMG/M
3300010048|Ga0126373_10747866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1038Open in IMG/M
3300010048|Ga0126373_12404247Not Available587Open in IMG/M
3300010304|Ga0134088_10636490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala532Open in IMG/M
3300010336|Ga0134071_10520018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala616Open in IMG/M
3300010373|Ga0134128_12523451Not Available566Open in IMG/M
3300010376|Ga0126381_104085165Not Available567Open in IMG/M
3300010379|Ga0136449_103742606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala574Open in IMG/M
3300010379|Ga0136449_104512523Not Available511Open in IMG/M
3300010396|Ga0134126_10719557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300010396|Ga0134126_11013438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella929Open in IMG/M
3300011107|Ga0151490_1442132Not Available504Open in IMG/M
3300012189|Ga0137388_11237738All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012202|Ga0137363_11414499Not Available585Open in IMG/M
3300012209|Ga0137379_10028062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5415Open in IMG/M
3300012210|Ga0137378_11488657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala588Open in IMG/M
3300012349|Ga0137387_10253089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1270Open in IMG/M
3300012354|Ga0137366_10432297All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300012357|Ga0137384_10821029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora751Open in IMG/M
3300012357|Ga0137384_11104629Not Available635Open in IMG/M
3300012361|Ga0137360_10125249All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300012683|Ga0137398_10728422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium OK006690Open in IMG/M
3300012910|Ga0157308_10369482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala548Open in IMG/M
3300013105|Ga0157369_11610543Not Available660Open in IMG/M
3300014157|Ga0134078_10285275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300014164|Ga0181532_10337533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium846Open in IMG/M
3300014745|Ga0157377_11116009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala605Open in IMG/M
3300015077|Ga0173483_10795777Not Available545Open in IMG/M
3300015264|Ga0137403_10423379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300015373|Ga0132257_100239215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae2164Open in IMG/M
3300016319|Ga0182033_10433732All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300016319|Ga0182033_11347162Not Available642Open in IMG/M
3300016357|Ga0182032_11460971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala593Open in IMG/M
3300016357|Ga0182032_11857229Not Available527Open in IMG/M
3300016371|Ga0182034_11915445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala523Open in IMG/M
3300016404|Ga0182037_10967068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala741Open in IMG/M
3300016445|Ga0182038_10922538All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300017930|Ga0187825_10282363All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300017932|Ga0187814_10035920Not Available1838Open in IMG/M
3300017933|Ga0187801_10408599Not Available565Open in IMG/M
3300017943|Ga0187819_10208845Not Available1151Open in IMG/M
3300017943|Ga0187819_10863024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala507Open in IMG/M
3300017955|Ga0187817_10541518Not Available743Open in IMG/M
3300017955|Ga0187817_10611662Not Available695Open in IMG/M
3300017961|Ga0187778_10321888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300017961|Ga0187778_10903398Not Available607Open in IMG/M
3300017966|Ga0187776_10248572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1137Open in IMG/M
3300017966|Ga0187776_11173713Not Available574Open in IMG/M
3300017972|Ga0187781_11368397Not Available523Open in IMG/M
3300018007|Ga0187805_10241078All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300018007|Ga0187805_10286869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales756Open in IMG/M
3300018007|Ga0187805_10426176Not Available617Open in IMG/M
3300018043|Ga0187887_10738541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala581Open in IMG/M
3300018046|Ga0187851_10261734All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300018085|Ga0187772_10354716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1014Open in IMG/M
3300018085|Ga0187772_10604276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia780Open in IMG/M
3300018089|Ga0187774_10426844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300018482|Ga0066669_10623014Not Available947Open in IMG/M
3300019787|Ga0182031_1517711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1997Open in IMG/M
3300020062|Ga0193724_1119896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala520Open in IMG/M
3300020076|Ga0206355_1456462Not Available515Open in IMG/M
3300020583|Ga0210401_11379317Not Available562Open in IMG/M
3300021178|Ga0210408_11210636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala576Open in IMG/M
3300021407|Ga0210383_11063365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala684Open in IMG/M
3300021474|Ga0210390_10357201Not Available1236Open in IMG/M
3300021560|Ga0126371_11172376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300021560|Ga0126371_11407024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala828Open in IMG/M
3300024284|Ga0247671_1062067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala602Open in IMG/M
3300025885|Ga0207653_10232670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. AS58702Open in IMG/M
3300025905|Ga0207685_10801927Not Available519Open in IMG/M
3300025910|Ga0207684_10178000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1834Open in IMG/M
3300025928|Ga0207700_10190726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1722Open in IMG/M
3300026118|Ga0207675_102144190Not Available575Open in IMG/M
3300026276|Ga0209847_1013793All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300026538|Ga0209056_10566153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala576Open in IMG/M
3300027854|Ga0209517_10044543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3443Open in IMG/M
3300027855|Ga0209693_10396736Not Available667Open in IMG/M
3300027889|Ga0209380_10370920Not Available840Open in IMG/M
3300028801|Ga0302226_10468596Not Available526Open in IMG/M
3300028867|Ga0302146_10315174Not Available603Open in IMG/M
3300029999|Ga0311339_10191254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala2331Open in IMG/M
3300030007|Ga0311338_10043787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6058Open in IMG/M
3300030056|Ga0302181_10077706All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300030580|Ga0311355_10501986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala1163Open in IMG/M
3300030739|Ga0302311_11025497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala520Open in IMG/M
3300031234|Ga0302325_12125726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300031640|Ga0318555_10215784Not Available1035Open in IMG/M
3300031718|Ga0307474_11105317Not Available627Open in IMG/M
3300031736|Ga0318501_10632393Not Available588Open in IMG/M
3300031751|Ga0318494_10625897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala629Open in IMG/M
3300031777|Ga0318543_10534227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala525Open in IMG/M
3300031859|Ga0318527_10535095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala500Open in IMG/M
3300031879|Ga0306919_11474873Not Available512Open in IMG/M
3300031959|Ga0318530_10156501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300032001|Ga0306922_12361462Not Available508Open in IMG/M
3300032060|Ga0318505_10082119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1437Open in IMG/M
3300032067|Ga0318524_10750386Not Available515Open in IMG/M
3300032076|Ga0306924_11803983Not Available637Open in IMG/M
3300032091|Ga0318577_10644379Not Available503Open in IMG/M
3300032094|Ga0318540_10648996Not Available508Open in IMG/M
3300032782|Ga0335082_10012060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9389Open in IMG/M
3300032782|Ga0335082_11660119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala512Open in IMG/M
3300032783|Ga0335079_12273891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala515Open in IMG/M
3300032805|Ga0335078_12744028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala500Open in IMG/M
3300032892|Ga0335081_11285256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia827Open in IMG/M
3300032896|Ga0335075_11132157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala686Open in IMG/M
3300032955|Ga0335076_11219113Not Available636Open in IMG/M
3300033158|Ga0335077_10127848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2944Open in IMG/M
3300033824|Ga0334840_059528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1119Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.09%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.06%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.06%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.52%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026276Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10806561123300000955SoilLYERVAGIDVHKDMIKVGIRSPGDKPWTRKSEVLQY
JGI12269J14319_1024461623300001356Peatlands SoilVKVLHERVAGIDVHKDMIKVAIRSPGDKPWTRTTEVSEFRTFY
Ga0066678_1111805813300005181SoilVKVMYERVAGIDVHKDMIKVAVRSPGDKPWTRKTEILTFRTFYG
Ga0066388_10743987413300005332Tropical Forest SoilMKVMHERVAGIDVHKDMVKVAIRLPGDKPWTRKTEILEFRTF
Ga0070671_10169590913300005355Switchgrass RhizosphereVKVMYERVAGIDVRKDMIKVAVRSPGDKPWTRKTEILTFRTFYG
Ga0070714_10161760913300005435Agricultural SoilMKVMHDRVAGIDVHKKMIKVAVRSPGAKPWTRKTEVLTFSTFYGVLQAMA
Ga0066682_1023488213300005450SoilMKVLYERVAGLGVHRKMIKVGIHAPGDKPWARESEVLQYGTF
Ga0070717_1184189513300006028Corn, Switchgrass And Miscanthus RhizosphereVKVMHDRVAAIDVHKDMVKVAVRVPGAKRGTRKTDVLE
Ga0070712_10157516523300006175Corn, Switchgrass And Miscanthus RhizosphereVRVVHEHVAGIDVHKDMIKVAIRCPGEKPWTRKTEILEFRTFYGVLQ
Ga0079221_1006896713300006804Agricultural SoilMKVLYERVAGIDVHKDMIKVAIRSPGEKPWTRKTEILEYR*
Ga0079220_1039077113300006806Agricultural SoilVKVMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRTFYG
Ga0075435_10019776313300007076Populus RhizosphereMRVLYDRVAAIDVHKDMVKVAIRGPGARRGTRKTDVLEFRTFY
Ga0099827_1107416913300009090Vadose Zone SoilMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRTFYGVLE
Ga0075423_1068188413300009162Populus RhizosphereMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRTF
Ga0116222_122043213300009521Peatlands SoilMYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYGV
Ga0116218_146890813300009522Peatlands SoilMKVLYERVAGIDVHKDMVKVAVRSPGEKPWTRKTEILEFRTFY
Ga0116221_117095213300009523Peatlands SoilMYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYGVLQAM
Ga0116221_136970513300009523Peatlands SoilVKGLHERVAGIDVHKDMIKVAIRSPGDKPWTRTTEV
Ga0116221_151041713300009523Peatlands SoilMKVMYEHVAGIDVHKEMIKVAIRSPGDKPWTRKTEILEY
Ga0116220_1054628313300009525Peatlands SoilMKVMYERVAGIDVHKDMIKVGIRTPGHRAWTRTSEVLEYRTFYGVLQ
Ga0116105_116958323300009624PeatlandMHDRVAAIDVHKEMVKVAVRVPGAKRGSRKTDVLEFRTFYGV
Ga0105856_132544813300009662Permafrost SoilMYDRVAAIDVHKDMVKVAIRVPGARRGTRKTDVLE
Ga0116216_1033409713300009698Peatlands SoilMYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRT
Ga0126382_1228168813300010047Tropical Forest SoilVLHERVAGIDVHKDMVKVAIRSPGEKPWTRKTEILEFRTFY
Ga0126373_1074786613300010048Tropical Forest SoilMKVLYERVAGIDVHKDMIKVGIRSPGDKPWTRKSEVLQYRT
Ga0126373_1240424723300010048Tropical Forest SoilMHDRVAAIDVHKDMVKVAVRVPGGKRGKRTTGVLEFRTFYGVSCF*
Ga0134088_1063649013300010304Grasslands SoilMKVRYERVAGIDVHKDMIKVAIRSPGEKPWTRTTEILEFRT
Ga0134071_1052001813300010336Grasslands SoilMKVLHERVAGIDVHKDMIKVAIRSPGEKPWTRKTEILEYRT
Ga0134128_1252345113300010373Terrestrial SoilMKVLYERVAGIDVHKEMIKVAIRSPGDKPWTRTTEILE
Ga0126381_10408516513300010376Tropical Forest SoilVLYDRVAAIDVHKDMIKVAVRVPGKKRGTRTTDVLEYRT
Ga0136449_10374260613300010379Peatlands SoilVKVLHERVAGIDVHKDMIKVAIRSPGDKPWTRTTEV
Ga0136449_10451252313300010379Peatlands SoilVKVRYERVAGIDVHKEMVKVAIRSPGEGGERKTEVL
Ga0134126_1071955723300010396Terrestrial SoilVKVMHEHVVGIDVHKKMIKVAVRSPGARPWTRKTEVLTFGTFYGVLRQMA
Ga0134126_1101343823300010396Terrestrial SoilVAHEHVAGIDVHKDMIKVAIRSPGEKPWTRKTEILEFRT
Ga0151490_144213213300011107SoilMKVMYERVAGIDVHKDMIKVAIRSPADKPWTRKTEIF*
Ga0137388_1123773813300012189Vadose Zone SoilMKVMYERVAGIDVHKDMIKVAIRSPGDKQWTRNTEI
Ga0137363_1141449913300012202Vadose Zone SoilMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRTFYGV
Ga0137379_1002806213300012209Vadose Zone SoilMFERVAGIDVHKDMIKVGIRGPGHRAWTRTSEVLEYRTFYGVL
Ga0137378_1148865723300012210Vadose Zone SoilMRVLHERVAGIDVHKDMIKVGIRAPGHRAWTRTCEVLEYRTFYGVL
Ga0137387_1025308913300012349Vadose Zone SoilVKVLYERVAGIDVHKKMIKVGIRVPGDKPWTRKSEVLQYRTFYGVLQ
Ga0137366_1043229723300012354Vadose Zone SoilMRVLFERVAGIDVHKDMIKVGVRTPGHRAWTRTCEVLE
Ga0137384_1082102923300012357Vadose Zone SoilMRVLYDRVAAIDVRKDMVKVAIRVPGAKRGTRKTDVPEFRTFYVG*
Ga0137384_1110462913300012357Vadose Zone SoilMRVLYDGVAAIYVDKDMVKDAIRVPGAKRGTRKTDVLEFRTFYGVLQAMARELR
Ga0137360_1012524913300012361Vadose Zone SoilMRVLHERVAGIDVHKDMVKVAIRSPGDKPWARKTEIVEYRT
Ga0137398_1072842213300012683Vadose Zone SoilMKVLYERVAGIDVHKDMVKVAIRSPGDKPWTRKTEILEFRTFFGVLRHM
Ga0157308_1036948213300012910SoilMYERVAGIDVHKDMIKVAVRSPGDKPWTRKTEILTFRTF
Ga0157369_1161054313300013105Corn RhizosphereMKVLYERVAGIDVHKDMIKAAVRSPGQKAWTRKTD
Ga0134078_1028527523300014157Grasslands SoilRMKVLYERVAGIDVHKDMVKVAIRSPGEKPWTRTTEILEYRTFYGGAPADGP*
Ga0181532_1033753313300014164BogMYERVAGIDVHKDMIKVGIRTPGHRAWTRTSEVLEYRTFYG
Ga0157377_1111600913300014745Miscanthus RhizosphereMHERVAGIDVHKDMIKVAIRSPGEKRWTRTTEIFEFRTFYGVLQAMARD
Ga0173483_1079577713300015077SoilMKVMHERVAGIDVHKKMIKVAIRSPGDKPWTRKTE
Ga0137403_1042337923300015264Vadose Zone SoilMKVLYERVAGIDVHKDMIKVAIRSPGEKPWTRTTEILEFRTFY
Ga0132257_10023921523300015373Arabidopsis RhizosphereMYERVAGIDVHKDMIKVAIRFPGEKGTRKTEVLEFRTFWGVLQEVAR*
Ga0182033_1043373213300016319SoilMKVLYERVAGIDVHKDMIKVAVRSPGEKPWTRTTEILEFRTFYGV
Ga0182033_1134716213300016319SoilLRVLYDRVAAIDVHKDMVKVAVRVPGAKRGTRKTDVLEYRT
Ga0182032_1146097113300016357SoilMRVLYERVAGIDVHLDMIKVGIHTPGHRAWTRTSEVLEYRTFYGVLQQ
Ga0182032_1185722913300016357SoilMKVLYERVAGIDVHKEMVKVAIRSPGDKPWTRKTEILEFRTFY
Ga0182034_1191544513300016371SoilVARRMKVLYERVAGIDVHKDMIKVAIRSPGDKPWTRKTE
Ga0182037_1096706833300016404SoilVKVRYERVAGIDVHKDMVKVAIRSPGEGGERKTEVLEFRAFYGMLQAMARLLRERGV
Ga0182038_1092253813300016445SoilVKVMHEHVAGIGVHKKMIKVAVRSPGKGRWGRKTDVLTFGTFWDELRAMAGE
Ga0187825_1028236313300017930Freshwater SedimentMKVMYERVAGIDVHKEMVKVAVRSPGDKPWTRTTEILE
Ga0187814_1003592013300017932Freshwater SedimentMRVMYDRVSAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRT
Ga0187801_1040859913300017933Freshwater SedimentMRVMYDRVSAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYG
Ga0187819_1020884513300017943Freshwater SedimentMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDV
Ga0187819_1086302423300017943Freshwater SedimentVRVLYEHVAGIDVHKDMIKVAIRSPGEKEWTRTTEILE
Ga0187817_1054151813300017955Freshwater SedimentMKVLYERVAGIDVHKDMIKVAIRSLGAKPWTRRTEILTFGTFYGVL
Ga0187817_1061166213300017955Freshwater SedimentMRVMYDRVAAVDVHKDMVKVAIRVPGAKRGTRKTDVLE
Ga0187778_1032188813300017961Tropical PeatlandMKVMYERVAGIDVHKDMIKVAVRSPGDKPWTRTTEIFEFRTF
Ga0187778_1090339813300017961Tropical PeatlandVKVMHDRVAAIDVHKDMVKVAVRVPGAKRGSRKTDVLEFRTFYGV
Ga0187776_1024857213300017966Tropical PeatlandMRVLYERVAGIDVHKEMIKVAIRSPGEKPWTRKTEILEFRT
Ga0187776_1117371313300017966Tropical PeatlandMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTF
Ga0187781_1136839713300017972Tropical PeatlandMRVMYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLE
Ga0187805_1024107813300018007Freshwater SedimentMKVMYERVAGIDVHKDMVKVAIRSPGDKPWTRKTEIVEFRTF
Ga0187805_1028686923300018007Freshwater SedimentVRVRYERVAGIDVHKEMIKVAIRSPGENGERTTEVLEFRAF
Ga0187805_1042617613300018007Freshwater SedimentMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFR
Ga0187887_1073854113300018043PeatlandVRVMYERVAGIDVHKDMIKVAIRFPGEKGTRKTEVLEFRTFWGVLQEVARELRRR
Ga0187851_1026173413300018046PeatlandMRVMYERVAGIDVHKDMIKVGIRTPGHRAWTRTSEVLEYRTFYGVLQT
Ga0187772_1035471613300018085Tropical PeatlandVKVMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRTFYGV
Ga0187772_1060427613300018085Tropical PeatlandMKVLHEHVAGIDVHKKMIKVAIRSPGDKPWTRKTEILTFRTF
Ga0187774_1042684423300018089Tropical PeatlandMKVLYERVAGIDVHKDMVKVEMRSPGEKPWTRKTEVLEFR
Ga0066669_1062301413300018482Grasslands SoilVKVMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTGVL
Ga0182031_151771133300019787BogMKVLYERVAGIDVHKDMIKVAIRSPGRKAVDRKTEVLQFRTFTVCCGRRP
Ga0193724_111989623300020062SoilVRVMYERVAGIDVHKDMIKVAIRFPGEKGTRKTEVLEFRTFWG
Ga0206355_145646213300020076Corn, Switchgrass And Miscanthus RhizosphereLRVLHDRVAAIDVHKDMVKVAVRVPGARRGARKTDVAEYRTFY
Ga0210401_1137931713300020583SoilMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYGV
Ga0210408_1121063613300021178SoilMKVLYERVAGIDVHKDMIKVAIRSPGEKPWTRKTEI
Ga0210383_1106336523300021407SoilVKVLHERVAGIDVHKDMIKVAIRSPGEKPWTRKTEVFEFRT
Ga0210390_1035720113300021474SoilMRVLHERVAGIDVHKDMIKVAIRSPGEKPWTRKTEILEYRTFFG
Ga0126371_1117237613300021560Tropical Forest SoilMKVLYERVAGIDVHKDMIKVAVRSPGEKPWTRTTEILEFRTFY
Ga0126371_1140702413300021560Tropical Forest SoilMKVLYGRVAGIDVHKDMIKVAIRSPGDKPWTRKTGILEY
Ga0247671_106206713300024284SoilMKVMHERVAGIDVHKKMIKVAIRSPGDKPWTRKTEI
Ga0207653_1023267013300025885Corn, Switchgrass And Miscanthus RhizosphereMKVLYERVAGIDVHKDMIKVAIRSPGEKPWTRKTEILEFRTFYGV
Ga0207685_1080192713300025905Corn, Switchgrass And Miscanthus RhizosphereMKVLYERVAGIDVHKEMVKVAIRSPGEKPWTRKTEVLE
Ga0207684_1017800013300025910Corn, Switchgrass And Miscanthus RhizosphereMKVMHERVAGIDVHKDMVKVAIRSPGDKPWTRKTEI
Ga0207700_1019072613300025928Corn, Switchgrass And Miscanthus RhizosphereMRVMYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYG
Ga0207675_10214419013300026118Switchgrass RhizosphereVKVMYERVAGIDVRKDMIKVAVRSPGDKPWARKTEILTFRTFT
Ga0209847_101379343300026276Permafrost SoilMRVMYDRVAAIDVHKDMVKVAIRVPGARRGTRKTDVLE
Ga0209056_1056615313300026538SoilMKVMYERVAGIDVHKDMIKVAIRSPGDKPWTRKTEILEYRTFY
Ga0209517_1004454353300027854Peatlands SoilMKVLYERVAGIDVHKEMIKVAIRSPGEKPWTRKTE
Ga0209693_1039673613300027855SoilLSRPLIDDNVLDELVAGIGVRKDMIKVAIRSPGETPRSRGTEVSGF
Ga0209380_1037092013300027889SoilMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTDVLEFRTFYG
Ga0302226_1046859613300028801PalsaVKVMHDRVAAIDVHKDMVKVAIRVPGERRGTRKTDVLEFRTF
Ga0302146_1031517413300028867BogMKVMYERVAGIDVHKDMIKVAVRSPGEKPWTRKTE
Ga0311339_1019125413300029999PalsaMKVLYERVAGIDVHKDMIKVAIRSPGDKPWTRKTEVLEYRTFYG
Ga0311338_10043787103300030007PalsaVKILHERVAGIDVHKDMIKVAVRSPGDKPWTRKTEIFTFR
Ga0302181_1007770633300030056PalsaMKVMYECVAGIDVHKEMVKVAIRSPGAKAQARKTEVLTFRTFY
Ga0311355_1050198613300030580PalsaMKVLHERVAGIDVHKDMVKVAIRSPGEKPWTRKTEIVEFRTFYG
Ga0302311_1102549713300030739PalsaMKVMYERVAGIDVHKDMIKVGVRSPGDKAWTRKTEILEYRTF
Ga0302325_1212572623300031234PalsaWLRVKILHERVAGIDVHKDMIKVAVRSPGDKPWTRKTEIFTFR
Ga0318555_1021578423300031640SoilMRVLYERVAGIDVHKDMIKVAVRSAGEKPWTRMTEILEF
Ga0307474_1110531713300031718Hardwood Forest SoilVRVIHERVAAIDVHKDMVKVAVRVPGAKRGTRKTDVLEFRTFFGV
Ga0318501_1063239313300031736SoilVRVLYDRVAAIDVHKDMVKVAVRVPGSKRGARKTDVLEFRTFYG
Ga0318494_1062589723300031751SoilMKVLYERVAGIDVHKDMIKVAIRSPGEKPWTRTTEILE
Ga0318543_1053422713300031777SoilVKVRYERVAGIDVHKDMVKVAIRSPGEGGERKTEVLEFRAFYGMLQ
Ga0318527_1053509523300031859SoilMKVLYERVAGIDVHKDMIKVAIRSPGDKPWTRKTEILEYRTF
Ga0306919_1147487313300031879SoilMRVLYDRVAAIDVHKDMVKVAIRVPGAKRGTRKTD
Ga0318530_1015650113300031959SoilVRVLYDRVAAIDVHKDMVKVAVRVPGKKRGTRTTD
Ga0306922_1236146223300032001SoilVKVMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTDVLEFRAFY
Ga0318505_1008211913300032060SoilVRVLYERVAGIDVHKDMIKVAIRSPGEKPWARAIEILEFR
Ga0318524_1075038613300032067SoilMQLKVMHEYVAGIDVHKDMVKVAVRSPGKKEWTRKTEILT
Ga0306924_1180398313300032076SoilVKVMHDRAAAIDVHKDMVKVAVRVPGERRGTRKTD
Ga0318577_1064437913300032091SoilMKVLYERVAGIDVHKEMVKVAIRSPGDKPWTRKTEIL
Ga0318540_1064899613300032094SoilMRVLHDRVAAIDVHKDMVKVAIRVPGGKRGTRKTDVL
Ga0335082_1001206033300032782SoilMKVMHERVAGIDVHKKMIKVAIRSPGDKPWTRKTEILTFRT
Ga0335082_1166011913300032782SoilVKVLHEHVAGIDVHKDMIKLAIRSPGEKPWTRKTEV
Ga0335079_1227389113300032783SoilMRVRYERVAGIDVHKDMIKVAIRAPGENGERTTEVLEFRAF
Ga0335078_1274402813300032805SoilMRVMYERVAGIDVHKDMIKVGVRTPGHRAWTRNSEVLEYRTFYGVLLTM
Ga0335081_1128525623300032892SoilMKVLHERVAGIDVHKEMVKVAIRSPGEKPWTRKTEILEFRT
Ga0335075_1113215723300032896SoilVKVLHEHVAGIDVHKDMIKVAIRSPGDKPWTRKTEILEFRTFY
Ga0335076_1121911323300032955SoilVRVLYDRVAAIDVHKDMIKVAVRLPGKKPGSRTTDVLEFRTFY
Ga0335077_1012784853300033158SoilMRVRYERVAGIDVHKDMIKVAIRAPGENGERTTEVLEFRA
Ga0334840_059528_1_1053300033824SoilMKVMHDRVAAIDVHKDMVKVAVRVPGERRGTRKTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.