NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060990

Metagenome Family F060990

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060990
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 45 residues
Representative Sequence ELAAIDKNRDFVCVYCHTSDVGRRDPPASHYLIAERPPVKRKDIK
Number of Associated Samples 110
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.97 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(6.818 % of family members)
Environment Ontology (ENVO) Unclassified
(48.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.939 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.07%    β-sheet: 0.00%    Coil/Unstructured: 84.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF14522Cytochrome_C7 31.82
PF14537Cytochrom_c3_2 3.79
PF09699Paired_CXXCH_1 1.52
PF02085Cytochrom_CIII 1.52
PF00550PP-binding 0.76
PF06094GGACT 0.76
PF02321OEP 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.52

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100109380All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300003322|rootL2_10232873All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300004114|Ga0062593_101365781All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300004156|Ga0062589_101149079All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300005093|Ga0062594_101141288All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300005093|Ga0062594_102393696All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300005179|Ga0066684_10507903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300005290|Ga0065712_10567503All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300005294|Ga0065705_10542938All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300005336|Ga0070680_101415970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300005336|Ga0070680_101533808All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300005353|Ga0070669_101288919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300005457|Ga0070662_101602339All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300005459|Ga0068867_101387246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300005468|Ga0070707_101182858All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300005536|Ga0070697_100532445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300005536|Ga0070697_102002807All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300005539|Ga0068853_102382642All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300005545|Ga0070695_100510606All Organisms → cellular organisms → Bacteria → Acidobacteria931Open in IMG/M
3300005547|Ga0070693_100151854All Organisms → cellular organisms → Bacteria → Acidobacteria1468Open in IMG/M
3300005552|Ga0066701_10440026All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M
3300005554|Ga0066661_10891907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300005555|Ga0066692_10480489All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300005563|Ga0068855_101821983All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300005577|Ga0068857_101857104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300005577|Ga0068857_102262358All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300005577|Ga0068857_102294375All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300005586|Ga0066691_10815673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300005617|Ga0068859_100927752All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300005617|Ga0068859_102320933All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300005618|Ga0068864_100591993All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300005718|Ga0068866_10261234All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300005844|Ga0068862_101094950All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300005844|Ga0068862_102336196All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300005985|Ga0081539_10337578All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300006049|Ga0075417_10633151All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300006237|Ga0097621_101044070All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300006796|Ga0066665_10116625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1982Open in IMG/M
3300006804|Ga0079221_11609359All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300006853|Ga0075420_100475580All Organisms → cellular organisms → Bacteria → Acidobacteria1079Open in IMG/M
3300006876|Ga0079217_10234014All Organisms → cellular organisms → Bacteria → Acidobacteria967Open in IMG/M
3300006894|Ga0079215_10949523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300006903|Ga0075426_11234890All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300006954|Ga0079219_10621287All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300009093|Ga0105240_11311455All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300009098|Ga0105245_10700872All Organisms → cellular organisms → Bacteria → Acidobacteria1046Open in IMG/M
3300009147|Ga0114129_12439719All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300009148|Ga0105243_10482865All Organisms → cellular organisms → Bacteria → Acidobacteria1170Open in IMG/M
3300009148|Ga0105243_10568823All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300009148|Ga0105243_10724147All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300009148|Ga0105243_12008152All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300009148|Ga0105243_12428497All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300009156|Ga0111538_10841532All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300009162|Ga0075423_10989336All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300009176|Ga0105242_12978984All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300009177|Ga0105248_10336295All Organisms → cellular organisms → Bacteria → Acidobacteria1700Open in IMG/M
3300009545|Ga0105237_10358782All Organisms → cellular organisms → Bacteria → Acidobacteria1462Open in IMG/M
3300009553|Ga0105249_13444194All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300010036|Ga0126305_10905110All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300010301|Ga0134070_10038964All Organisms → cellular organisms → Bacteria → Acidobacteria1586Open in IMG/M
3300010323|Ga0134086_10441148All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010361|Ga0126378_10353910All Organisms → cellular organisms → Bacteria → Acidobacteria1578Open in IMG/M
3300010373|Ga0134128_13205464All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300010375|Ga0105239_10611624All Organisms → cellular organisms → Bacteria → Acidobacteria1243Open in IMG/M
3300010397|Ga0134124_10183214All Organisms → cellular organisms → Bacteria → Acidobacteria1890Open in IMG/M
3300010397|Ga0134124_10678607All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300010399|Ga0134127_11076173All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300010399|Ga0134127_12440956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300010400|Ga0134122_11501757All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300010401|Ga0134121_10907764All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300012201|Ga0137365_10541315All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300012208|Ga0137376_11524801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300012285|Ga0137370_10859242All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300012349|Ga0137387_10911829All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300012356|Ga0137371_10546452All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300012685|Ga0137397_10081577All Organisms → cellular organisms → Bacteria → Acidobacteria2353Open in IMG/M
3300012918|Ga0137396_10261073All Organisms → cellular organisms → Bacteria → Acidobacteria1278Open in IMG/M
3300012957|Ga0164303_10195301All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300012989|Ga0164305_12187236All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300013306|Ga0163162_11141966All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300013306|Ga0163162_11449160All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300013306|Ga0163162_12795504All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300014325|Ga0163163_10081402All Organisms → cellular organisms → Bacteria → Acidobacteria3240Open in IMG/M
3300014325|Ga0163163_12079215All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300014745|Ga0157377_10589591All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300014968|Ga0157379_11902627All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300015200|Ga0173480_10579416All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300015264|Ga0137403_11258882All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300015356|Ga0134073_10341836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300015371|Ga0132258_11083989All Organisms → cellular organisms → Bacteria → Acidobacteria2025Open in IMG/M
3300015371|Ga0132258_11548519All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300015373|Ga0132257_102359594All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300015373|Ga0132257_103223819All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300015374|Ga0132255_100160926All Organisms → cellular organisms → Bacteria → Acidobacteria3141Open in IMG/M
3300015374|Ga0132255_101411228All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300015374|Ga0132255_102778609All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300018433|Ga0066667_10524433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium979Open in IMG/M
3300018466|Ga0190268_10732583All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300018469|Ga0190270_11681498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300018920|Ga0190273_11101765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300021418|Ga0193695_1125935All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300025900|Ga0207710_10511123All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300025907|Ga0207645_10281352All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300025910|Ga0207684_10769443All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300025912|Ga0207707_11283707All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300025918|Ga0207662_10236118All Organisms → cellular organisms → Bacteria → Acidobacteria1195Open in IMG/M
3300025921|Ga0207652_11065891All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300025923|Ga0207681_11546453All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300025932|Ga0207690_10602329All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300025933|Ga0207706_10847510All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300025933|Ga0207706_11089698All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300025935|Ga0207709_10983740All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300025938|Ga0207704_10186904All Organisms → cellular organisms → Bacteria → Acidobacteria1503Open in IMG/M
3300025942|Ga0207689_10366666All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300025981|Ga0207640_11387282All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300025981|Ga0207640_11505372All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300026035|Ga0207703_11535352All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300026041|Ga0207639_11333812All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300026067|Ga0207678_11042958All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300026088|Ga0207641_12217063All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300026089|Ga0207648_11214822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300026095|Ga0207676_11698377All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300026142|Ga0207698_10625273All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300026360|Ga0257173_1067357All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300026538|Ga0209056_10312736All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300027873|Ga0209814_10576275All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300031547|Ga0310887_10558872All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300031847|Ga0310907_10031497All Organisms → cellular organisms → Bacteria → Acidobacteria1912Open in IMG/M
3300031995|Ga0307409_101235485All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300032000|Ga0310903_10342230All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300032002|Ga0307416_102921234All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300032180|Ga0307471_102629299All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.30%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.03%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.76%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10010938013300000559SoilLAQIDKNREFVCIYCHTSNVGRQDPPPGHYLIAGREPLKRKDLK*
rootL2_1023287313300003322Sugarcane Root And Bulk SoilAREDLNKELLAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRRDIK*
Ga0062593_10136578123300004114SoilSKELEAIDKNRDFVCKYCHTSDIGRRDPPSSHYLIAGRDAIKRENLK*
Ga0062589_10114907913300004156SoilGTREDLNKELLAIDKNRGFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDMK*
Ga0062594_10114128813300005093SoilLNKELAAIDKDRSFTCVYCHAPNLGSLDAPADHYLIAERPPIKRKDIK*
Ga0062594_10239369613300005093SoilAIDKNRAFVCVYCHAPNVGSLDPPASHYLIAERPPLKRKDLK*
Ga0066684_1050790323300005179SoilDLNNELAAIDKNNNFVCSYCHTSDVGRRDAPASHYSVAERPPLKRADLK*
Ga0065712_1056750323300005290Miscanthus RhizosphereRQDLNKELAAIDKDRNFTCVYCHASNTGSLDPPARHYLIAERPPIKRKDIK*
Ga0065705_1054293813300005294Switchgrass RhizosphereRELLAIDKSAAFVCVYCHTSNVGKLDPPASHYLIAERPPIKRKDIK*
Ga0070680_10141597023300005336Corn RhizosphereSKELEAIDRNRDFVCVYCHTSDTGRRDPPPGHYLIAGREALKRKDVK*
Ga0070680_10153380813300005336Corn RhizosphereVGTREDLNKELLAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0070669_10128891913300005353Switchgrass RhizosphereRQDLNRELVALDKNKDFVCTYCHTSEVGRRDPKPSHYLVAERPPLTRKDLK*
Ga0070662_10160233913300005457Corn RhizosphereVAIDKDRNFTCVYCHAANVGNLDPPTSHYLIAERPPIKRKDIK*
Ga0068867_10138724623300005459Miscanthus RhizosphereIDKRRDFVCTYCHTSDIGRRDPPSSHYLIAGREAIKRENVK*
Ga0070707_10118285823300005468Corn, Switchgrass And Miscanthus RhizosphereTALDKNRAFTCTYCHTSNVGKLDAPASHYLIAQRPPLTRKDIK*
Ga0070697_10053244523300005536Corn, Switchgrass And Miscanthus RhizosphereLAAIDKNKNFVCSYCHTSDVGKRDAPASHYSVAERPTLKRADLK*
Ga0070697_10200280713300005536Corn, Switchgrass And Miscanthus RhizosphereGLRQDLSKELAAIDKNRAFVCIYCHAESVGSLDPPASHYLIAERPPLKRKDIK*
Ga0068853_10238264223300005539Corn RhizosphereKNRAFECVYCHAPNVGSLDPPASHYLIAERPPLKRKDLK*
Ga0070695_10051060623300005545Corn, Switchgrass And Miscanthus RhizosphereAIDKNPAFVCVYCHTSEVGKRDPPPRHYLIAERPPLSRKDIK*
Ga0070693_10015185413300005547Corn, Switchgrass And Miscanthus RhizosphereDLNKELAAIDKNRSFTCMYCHAANVGSLDPPASHYLIAERPPLKRKDIK*
Ga0066701_1044002623300005552SoilHVEISNELAAIDKNRDFVCVYCHTSDVGRRDPPASHYLIAERPPVKRKDIK*
Ga0066661_1089190713300005554SoilQDLSNELAAIDRDRNFVCSYCHTSNVGKRDPPASHYIVAERQPLKRSDMK*
Ga0066692_1048048923300005555SoilELAAIDKNRDFVCVYCHTSDVGRRDPPASHYLIAERPPVKRKDIK*
Ga0068855_10182198323300005563Corn RhizosphereLLEIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0068857_10185710423300005577Corn RhizosphereLEAIDKRRDFVCTYCHTSDIGRHDPPSSHYLIAGREAIKRENVK*
Ga0068857_10226235823300005577Corn RhizosphereDLNTELVALDKNRNFTCVYCHAPNVGNLDPPANHYLIAERPPLKRKDIK*
Ga0068857_10229437513300005577Corn RhizosphereAAIDKDRNFTCVYCHAPNTGSLDPPARHYLIAERPPIKRKDIK*
Ga0066691_1081567313300005586SoilQDLNNELAAIDKNKNFVCSYCHTSDVGKRDAPASHYRVAERPPLKRADLK*
Ga0068859_10092775223300005617Switchgrass RhizosphereDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0068859_10232093323300005617Switchgrass RhizosphereKELLAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0068864_10059199313300005618Switchgrass RhizosphereKDGLRQDLSKELMAIDKNRSFTCNYCHAEKVGSLEPPASHYLIAERPPLKRKDIK*
Ga0068866_1026123423300005718Miscanthus RhizosphereDKNKAFVCVYCHTSNVGSLDPPASHYMISERPPLKRKEIK*
Ga0068862_10109495023300005844Switchgrass RhizosphereNKDFVCVYCHTSNVGRQDPPSSHYLIAGREALKRKDIK*
Ga0068862_10233619623300005844Switchgrass RhizosphereFTCTYCHTSDVGKLDPPASHYLIAERPPLKRKDVK*
Ga0081539_1033757823300005985Tabebuia Heterophylla RhizosphereIDKNRGFVCVYCHAPNVGSLDPPASHYLIAERPPIKRRDIK*
Ga0075417_1063315113300006049Populus RhizosphereIDKNRAFVCVYCHAPNVGTLDPPASHYVIAERPPLKRKDIR*
Ga0097621_10104407013300006237Miscanthus RhizosphereELAAIDKDKAFVCVYCHTSNVGSLDPPASHYLISERPPLKRKEIK*
Ga0066665_1011662513300006796SoilLAAIDKNKNFVCNYCHKSEVGKRDDPASHYSVAERPLLIRADLK*
Ga0079221_1160935913300006804Agricultural SoilDLDTELAAIDKDRNFTCGYCHAANVGRLDPPPSHYLIAQRSPIKRKDVK*
Ga0075420_10047558013300006853Populus RhizosphereSKELVSIDKNGVFVCVYCHEPNVGTLDPPVTHYLIAERPPLKRKDIK*
Ga0079217_1023401423300006876Agricultural SoilKNRDFVCVYCHTSDVGRRDPPVGHYLIAGRAPLKRKDVK*
Ga0079215_1094952313300006894Agricultural SoilVANELEAVDRNRDFVCVYCHTSDVGRGDPPASHYLIAGRDPLKRKDVK*
Ga0075426_1123489023300006903Populus RhizosphereNKELVAIDKNRAFVCVYCHAENVGSLDPPASHYLIAERPPLKRKEIK*
Ga0079219_1062128723300006954Agricultural SoilRQDLNTELTALDKNHSFTCAYCHTSNIGSQDAPASHYLIAQRPPLKRKDIK*
Ga0105240_1131145513300009093Corn RhizosphereDRNRSFTCVYCHAEKVGNLDPPASHYLIAQRPPLKRRDIK*
Ga0105245_1070087213300009098Miscanthus RhizosphereTCSYCHTSDVGRRDPPSSHYLIAGREAIKRENVK*
Ga0114129_1243971923300009147Populus RhizosphereNIELSAIDKNRAFVCVYCHAPNVGSLDPPASHYLIAERPPIKRKDIK*
Ga0105243_1048286533300009148Miscanthus RhizosphereGTREDLNKELLAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAQRPPLKRRDIK*
Ga0105243_1056882313300009148Miscanthus RhizosphereGLRQDVSRELAAIDKNPAFVCVYCHTSEVGKRDPPPRHYLIAERPPLSRKDIK*
Ga0105243_1072414723300009148Miscanthus RhizosphereDFVCSYCHTSDVGRRDPPSRHYLIAGREAIKRKDVK*
Ga0105243_1200815213300009148Miscanthus RhizosphereEYGTEALDTNRNFTCVYCHAPNVGNLDPPASHYLIAERPPLKRKDIK*
Ga0105243_1242849723300009148Miscanthus RhizosphereKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0111538_1084153213300009156Populus RhizosphereDKDRSFTCVYCHAPNVGSLDPPERHYLIAERPPIKRKDIK*
Ga0075423_1098933623300009162Populus RhizosphereLRLDVSNELEAIDKNHDFVCVYCHTSDVGRLDPPAGHYLIAGRSPVKRKDLK*
Ga0105242_1297898423300009176Miscanthus RhizosphereRFDITNELLAIDKNPAFTCSYCHTADVGRRDPPASHYLIAWLSPKKRKDVK*
Ga0105248_1033629533300009177Switchgrass RhizosphereKNRSFTCVYCHEAKVGSQDPPASHYLIAERTPLKRKDIK*
Ga0105237_1035878213300009545Corn RhizosphereREDLNQELAAIDRNKAFVCTYCHTSNVGSLDPPASHYLIAQRPPLKRKDIK*
Ga0105249_1344419423300009553Switchgrass RhizosphereAIDKDRNFTCVYCHAANVGNLDPPTSHYLIAERPPIKRKDIK*
Ga0126305_1090511013300010036Serpentine SoilQDLNKELMAIDKNRSFTCVYCHGEKVGGLDAPASHYLIAERPPLKRRDIK*
Ga0134070_1003896413300010301Grasslands SoilAIDKNKNFVCSYCHTSDVGKRDAPASHYSVAERPLLKRADLK*
Ga0134086_1044114813300010323Grasslands SoilDLNNELAAIDKNKNFVCSYCHTSDVGKRDAPASHYSVAERPLLKRADLK*
Ga0126378_1035391013300010361Tropical Forest SoilELLAVDKNREFNCTYCHTSDVGKKDAPASHYLAAERPPLKRSDIK*
Ga0134128_1320546413300010373Terrestrial SoilLRQDLSKELMAIDKNRGFTCVYCHAEKVGSLDPPASHYLIAERPPLKRQNIK*
Ga0105239_1061162433300010375Corn RhizosphereDLSKELIAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0134124_1018321413300010397Terrestrial SoilDKNRDFVCKYCHTSEIGRRDPPSSHYLIAGRDAIKRENVK*
Ga0134124_1067860713300010397Terrestrial SoilLAAIDKNKSFVCVYCHTSNVGSKDPPSSHYLIAERPPLKRKEIK*
Ga0134127_1107617313300010399Terrestrial SoilRQDVSKELASIDKNKTFVCVYCHTSNIGSQDPPASHYLIAERPALKRKEIK*
Ga0134127_1244095623300010399Terrestrial SoilKELEAIDKNRDFVCTYCHTSEVGRRDPPSSHYLIAGREAITRKDIK*
Ga0134122_1150175713300010400Terrestrial SoilVSKELEAIDKNRDLVCTYCHTSEVGRRDPPSSHYLIAGREAISRKDIK*
Ga0134121_1090776423300010401Terrestrial SoilELAAIDKDRAFVCVYCHEPNVGSKDPPPSHYLIAERPPMKRK*
Ga0137365_1054131513300012201Vadose Zone SoilSKELEALDKNREFVCVYCHTSNVGRRDPPRSHYLIAGREPLKRMDLK*
Ga0137376_1152480113300012208Vadose Zone SoilITTELVAIDKNRDFVCTYCHTSDVGRRDPPAGHYLSSGLPPKKRKDVK*
Ga0137370_1085924213300012285Vadose Zone SoilKNRDFVCSYCHTSDVGRLDPPPGHYLIAGREAMKRKDVK*
Ga0137387_1091182913300012349Vadose Zone SoilGLRLDVSRELEAIDKNRDFVCSYCHASDIGHLDPPTSHYLIAGREPMKRKDVK*
Ga0137371_1054645223300012356Vadose Zone SoilSKELEAIDKNRDFVCSYCHTSDVGRRDPPASHYLIAGREAMKRKDIK*
Ga0137397_1008157713300012685Vadose Zone SoilRQDVSKELEAIDKDRDFTCKYCHTSDVGRRDPPASHYLIAEREPLKRKDVK*
Ga0137396_1026107323300012918Vadose Zone SoilCHNKAPAHLEIPNELVAIDKNRDFVCTYCHTSDVGRRDPPASHYLSSGLTPKKRKDVK*
Ga0164303_1019530123300012957SoilSIDKDKAFVCVYCHTSNVGSLDPPASHYLISERPPLKRKEIK*
Ga0164305_1218723613300012989SoilLDKNRAFTCVYCHASNVGSLDAPVSHYLIAQRPPLKRSDIK*
Ga0163162_1114196623300013306Switchgrass RhizosphereKNRAFVCVYCHAPNVGDKDPPASHYLIAERPPLKRKDVK*
Ga0163162_1144916013300013306Switchgrass RhizosphereELAAIDKNKTFVCVYCHTSNVGSLDPPSSHYLIGERPPLKRKEIK*
Ga0163162_1279550423300013306Switchgrass RhizosphereFVCVYCHDPSLGKEDAPARHYLIAERPPLKRRDIK*
Ga0163163_1008140213300014325Switchgrass RhizosphereIDKDRNFTCVYCHAPNVGNLDPPAGHYLIAERPPMKRKL*
Ga0163163_1207921513300014325Switchgrass RhizosphereIDKNRNFTCVYCHAPNVGSLDPPASHYLIAERPPLKRKDIK*
Ga0157377_1058959113300014745Miscanthus RhizosphereVSKELLAIDKDKSFTCTYCHTSDVGKLDPPASHYLIAERPPLKRKDVK*
Ga0157379_1190262713300014968Switchgrass RhizosphereNRSFTCVYCHAEKVGSLDPPASHYLIAQRPPLKRRDIK*
Ga0173480_1057941613300015200SoilLAAIDKNKTFVCVYCHTSNVGSLDPPSSHYLIAERPPLKRKEIK*
Ga0137403_1125888223300015264Vadose Zone SoilSKELEAMDKNRDFVCSYCHTSDVGRLDPPRGHYLIAGREPMKRKDVK*
Ga0134073_1034183613300015356Grasslands SoilNELAAIDKNNNFVCSYCHTSDVGRRDAPASHYSVAERPPLKRADLK*
Ga0132258_1108398933300015371Arabidopsis RhizosphereLEALDKNREFVCVYCHTSNVGRLDPPSSHYLIAGREPLKRKDIK*
Ga0132258_1154851933300015371Arabidopsis RhizosphereIDKNKAFVCVYCHTSNVGSLDPPASHYMISERPPLKRKEIK*
Ga0132257_10235959413300015373Arabidopsis RhizosphereQELAAIDKDKAFVCVYCHTSNVGSLDPPASHYLISERPPLKRKEIK*
Ga0132257_10322381913300015373Arabidopsis RhizosphereFTCVYCHEAKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0132255_10016092633300015374Arabidopsis RhizosphereDKNRSFTCIYCHEAKVGSLDPPASHYLIAERPPLKRKDIK*
Ga0132255_10141122823300015374Arabidopsis RhizosphereLRQDVSKELAAIDKDKAFVCVYCHTSNVGSLDPPASHYLISERPPLKRKEIK*
Ga0132255_10277860913300015374Arabidopsis RhizosphereLDKNRAFTCVYCHTSNVGTLDAPASHYLIAQRPPLKRRDIK*
Ga0066667_1052443333300018433Grasslands SoilDKNKNFGCSYCHTSDVGKHDAPASHYSVAERPLLKRADLK
Ga0190268_1073258313300018466SoilSDELAAIDKKRDFVCVYCHTSDVGKLDPPSGHYLIAERPPLKRRDIK
Ga0190270_1168149823300018469SoilRLDVSKELEAIDKNRDFVCSYCHRSDVGRSDPPSSHYLIAGREAMKRKDVK
Ga0190273_1110176523300018920SoilEAIDKNRDFVCSYCHTSDVGRRDPPSSHYLIAGREAMKRKDVK
Ga0193695_112593513300021418SoilKAPSHFEITNELVAIDKNPGFVCTYCHTSDVGRRDPPAGHYLSSGLPPKKRKDVK
Ga0207710_1051112323300025900Switchgrass RhizosphereQDLSKELVAIDKDRNFTCVYCHAPNVGSLDPPERHYLIAERPPIKRKDVK
Ga0207645_1028135213300025907Miscanthus RhizosphereLRQDVSRELAAIDKNPAFVCVYCHTSEVGKRDPPPRHYLIAERPPLSRKDIK
Ga0207684_1076944323300025910Corn, Switchgrass And Miscanthus RhizosphereLDKNRAFTCTYCHTSNVGKLDPPASHYLIAQRPPLTRRDIK
Ga0207707_1128370713300025912Corn RhizosphereNFMCVYCHAANVGKLDPPASHYLIAERPPLKRKDIK
Ga0207662_1023611823300025918Switchgrass RhizosphereLLAIDKNRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK
Ga0207652_1106589113300025921Corn RhizosphereRQDLNTELVAIDKNRTFTCVYCHAPNVGNLDPPASHYLIAERPPLKRKDIK
Ga0207681_1154645323300025923Switchgrass RhizosphereELEAIDKNRDFVCSYCHTSDIGRRDPPASHYLIAGREAMKRKDVK
Ga0207690_1060232913300025932Corn RhizosphereDVSKELLAIDKDKSFTCTYCHTSDVGKLDPPASHYLIAERPPLKRKDVK
Ga0207706_1084751023300025933Corn RhizosphereAAIDKNPAFVCVYCHTSDVGKRDPPPRHYVIAERPPLTRKDIK
Ga0207706_1108969823300025933Corn RhizosphereSKELVAIDKDRNFTCVYCHAANVGNLDPPTSHYLIAERPPIKRKDIK
Ga0207709_1098374023300025935Miscanthus RhizosphereIDKNRNFTCAYCHAPNVGNLDPPTSHYLIAERPPLKRKDIK
Ga0207704_1018690413300025938Miscanthus RhizosphereIDKNKTFVCVYCHTSNVGSLDPPSSHYLIAERPPLKRKEIK
Ga0207689_1036666633300025942Miscanthus RhizosphereKELMAIDKDRSFTCTYCHTSDVGKLDPPASHYLIAERPPLKRKDVK
Ga0207640_1138728223300025981Corn RhizosphereNPAFVCVYCHTSDVGKRDPPPRHYVIAERPPLTRKDIK
Ga0207640_1150537223300025981Corn RhizosphereEDLNKELKAIDKNRIFTCVYCHAEKVGSLDPPASHYLIAERPPLKRRDIK
Ga0207703_1153535223300026035Switchgrass RhizosphereAAIDKNRAFTCVYCHDAKTGSLDPPASHYLIAERPPLKRKDIK
Ga0207639_1133381213300026041Corn RhizosphereRSFTCVYCHAANVGSLDPPASHYVIAERPPLKRKDIK
Ga0207678_1104295823300026067Corn RhizosphereFASVYCHAEKVGSLDPPASHYLIAQRPPLKRKDIK
Ga0207641_1221706323300026088Switchgrass RhizosphereRSFTCVYCHAEKVGSLDPPASHYLIAERPPLKRKDIK
Ga0207648_1121482223300026089Miscanthus RhizosphereKELEAIDKRRDFVCTYCHTSDIGRRDPPSSHYLIAGREAIKRENVK
Ga0207676_1169837713300026095Switchgrass RhizosphereEDLNKELNAIDKNRSFTCMYCHAEKVGSLDPPASHYLIAERPPLKRRDIK
Ga0207698_1062527313300026142Corn RhizosphereDVSRELAAIDKNPAFVCVYCHTSDVGKRDPPPRHYVIAERPPLTRKDIK
Ga0257173_106735713300026360SoilNRDFVCSYCHTSDIGHLDPPASHYLIAGREPMKRKDAK
Ga0209056_1031273613300026538SoilDLAQLEKNKDFACVYCHTSDVGSRDAPASHYVVAERTPIKRKDIK
Ga0209814_1057627523300027873Populus RhizosphereRQDLSTELNSIDKNRAFVCVYCHAPNVGTLDPPASHYVIAERPPLKRKDIR
Ga0310887_1055887223300031547SoilLSKELAAIDKNRGFVCVYCHDPSLGKEDAPARHYLIAERPPLKRRDSK
Ga0310907_1003149713300031847SoilAIDKNPAFVCVYCHTSEVGKRDPPLRHYLIAERPPLSRKNIK
Ga0307409_10123548523300031995RhizosphereDLSKELLAIDKNRAFACVYCHESNVGTLDPPATHYLIAERPPLKRKDIR
Ga0310903_1034223023300032000SoilKNPAFVCVYCHTSEVGKRDPPPRHYLIAERPALSRKDIK
Ga0307416_10292123413300032002RhizosphereAFVCVYCHAPNVGSLDPPASHYLIAERPPLKRKDIK
Ga0307471_10262929913300032180Hardwood Forest SoilQDLNTELVAIDKNRNFTCVYCHAPNVGSLDPPASHYLIAERPPLKRKDIK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.