NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060942

Metagenome Family F060942

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060942
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 71 residues
Representative Sequence VTKPNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLD
Number of Associated Samples 122
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.15 %
% of genes near scaffold ends (potentially truncated) 95.45 %
% of genes from short scaffolds (< 2000 bps) 89.39 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(28.788 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.121 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.55%    β-sheet: 17.65%    Coil/Unstructured: 59.80%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00733Asn_synthase 8.33
PF05936T6SS_VasE 7.58
PF13537GATase_7 3.03
PF02350Epimerase_2 1.52
PF13727CoA_binding_3 0.76
PF00535Glycos_transf_2 0.76
PF16363GDP_Man_Dehyd 0.76
PF04321RmlD_sub_bind 0.76
PF00011HSP20 0.76
PF06250YhcG_C 0.76
PF01943Polysacc_synt 0.76
PF02954HTH_8 0.76
PF13489Methyltransf_23 0.76
PF13439Glyco_transf_4 0.76
PF02219MTHFR 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG3522Predicted component of the type VI protein secretion systemIntracellular trafficking, secretion, and vesicular transport [U] 7.58
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 1.52
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 1.52
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 1.52
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 1.52
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 1.52
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.76
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 0.76
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 0.76
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 0.76
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 0.76
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.76
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 0.76
COG4804Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 familyGeneral function prediction only [R] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.73 %
UnclassifiedrootN/A2.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004778|Ga0062383_10682301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300005329|Ga0070683_102248310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium523Open in IMG/M
3300005335|Ga0070666_10026108All Organisms → cellular organisms → Bacteria3813Open in IMG/M
3300005343|Ga0070687_100657753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300005354|Ga0070675_101625373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium596Open in IMG/M
3300005529|Ga0070741_10129006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium2590Open in IMG/M
3300005533|Ga0070734_10665272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium592Open in IMG/M
3300005534|Ga0070735_10418256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium802Open in IMG/M
3300005538|Ga0070731_11091162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium527Open in IMG/M
3300005542|Ga0070732_10226895All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005616|Ga0068852_100050226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium3572Open in IMG/M
3300005764|Ga0066903_107361714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium569Open in IMG/M
3300005764|Ga0066903_108173305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium536Open in IMG/M
3300005843|Ga0068860_100308400All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300005894|Ga0075270_1086922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium505Open in IMG/M
3300006052|Ga0075029_100285818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1049Open in IMG/M
3300006052|Ga0075029_101149861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium541Open in IMG/M
3300006086|Ga0075019_10877165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300006102|Ga0075015_100267509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium931Open in IMG/M
3300006358|Ga0068871_101661454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium605Open in IMG/M
3300006871|Ga0075434_101796782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans620Open in IMG/M
3300006904|Ga0075424_101624158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium685Open in IMG/M
3300007004|Ga0079218_13904908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300009156|Ga0111538_10973337Not Available1074Open in IMG/M
3300009174|Ga0105241_11779668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium601Open in IMG/M
3300009177|Ga0105248_10316459All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300009177|Ga0105248_12152642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium634Open in IMG/M
3300009503|Ga0123519_10090405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2702Open in IMG/M
3300009521|Ga0116222_1363003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium628Open in IMG/M
3300009522|Ga0116218_1451810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium573Open in IMG/M
3300009524|Ga0116225_1534109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium521Open in IMG/M
3300009545|Ga0105237_10289010All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300009545|Ga0105237_11739947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300009624|Ga0116105_1039249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1055Open in IMG/M
3300009636|Ga0116112_1148711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium653Open in IMG/M
3300009645|Ga0116106_1082687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1046Open in IMG/M
3300009665|Ga0116135_1379647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium570Open in IMG/M
3300009759|Ga0116101_1059490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300009764|Ga0116134_1188136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300010036|Ga0126305_10547422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300010341|Ga0074045_10665427All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium662Open in IMG/M
3300010358|Ga0126370_11156028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium717Open in IMG/M
3300011119|Ga0105246_11538960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300012354|Ga0137366_10816353All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300012360|Ga0137375_10326181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1375Open in IMG/M
3300012533|Ga0138256_11435489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium505Open in IMG/M
3300012961|Ga0164302_10845228All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300012971|Ga0126369_10541791All Organisms → cellular organisms → Bacteria → Acidobacteria1227Open in IMG/M
3300012989|Ga0164305_10303637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1180Open in IMG/M
3300013105|Ga0157369_11174407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium784Open in IMG/M
3300013297|Ga0157378_11574337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium703Open in IMG/M
3300013308|Ga0157375_13591117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium516Open in IMG/M
3300014151|Ga0181539_1383547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium504Open in IMG/M
3300014162|Ga0181538_10349868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300014165|Ga0181523_10315062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium881Open in IMG/M
3300014200|Ga0181526_11017765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium520Open in IMG/M
3300014323|Ga0075356_1172626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium568Open in IMG/M
3300014492|Ga0182013_10530532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300014654|Ga0181525_10832217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium522Open in IMG/M
3300015200|Ga0173480_10919903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300015373|Ga0132257_102514943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium669Open in IMG/M
3300015374|Ga0132255_100050329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5421Open in IMG/M
3300015374|Ga0132255_105369363All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300017946|Ga0187879_10298928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium894Open in IMG/M
3300017975|Ga0187782_10511841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300017988|Ga0181520_10228130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1441Open in IMG/M
3300018030|Ga0187869_10212195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium945Open in IMG/M
3300018035|Ga0187875_10629222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium565Open in IMG/M
3300018037|Ga0187883_10136403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1267Open in IMG/M
3300018038|Ga0187855_10001520All Organisms → cellular organisms → Bacteria18333Open in IMG/M
3300018046|Ga0187851_10334427All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium873Open in IMG/M
3300018057|Ga0187858_10042311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3333Open in IMG/M
3300018057|Ga0187858_10274926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1074Open in IMG/M
3300018062|Ga0187784_11529955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium528Open in IMG/M
3300018062|Ga0187784_11694639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium501Open in IMG/M
3300018086|Ga0187769_11152352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium587Open in IMG/M
3300018088|Ga0187771_10433080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1110Open in IMG/M
3300018088|Ga0187771_11049070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium691Open in IMG/M
3300018920|Ga0190273_10259531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1133Open in IMG/M
3300019361|Ga0173482_10107237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1024Open in IMG/M
3300021401|Ga0210393_10176533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1723Open in IMG/M
3300021477|Ga0210398_11452304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium535Open in IMG/M
3300021478|Ga0210402_11998785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium506Open in IMG/M
3300021560|Ga0126371_12047811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium689Open in IMG/M
3300023250|Ga0224544_1064955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300024056|Ga0124853_1511915All Organisms → cellular organisms → Bacteria2922Open in IMG/M
3300025412|Ga0208194_1017320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1161Open in IMG/M
3300025414|Ga0208935_1042460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium605Open in IMG/M
3300025434|Ga0208690_1010421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1896Open in IMG/M
3300025473|Ga0208190_1083557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium636Open in IMG/M
3300025634|Ga0208589_1068637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium866Open in IMG/M
3300025914|Ga0207671_10196551All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300025914|Ga0207671_10518504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium950Open in IMG/M
3300025927|Ga0207687_10064435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium2599Open in IMG/M
3300025941|Ga0207711_12064999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300026118|Ga0207675_100924627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium889Open in IMG/M
3300026835|Ga0207782_119984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium516Open in IMG/M
3300026928|Ga0207779_1032221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium621Open in IMG/M
3300026982|Ga0207854_1034580All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300027497|Ga0208199_1044700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium952Open in IMG/M
3300027745|Ga0209908_10073664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium802Open in IMG/M
3300027831|Ga0209797_10369379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium587Open in IMG/M
3300027879|Ga0209169_10138982All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300027889|Ga0209380_10012217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4951Open in IMG/M
3300027908|Ga0209006_11337642All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300028381|Ga0268264_10505832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1179Open in IMG/M
3300028587|Ga0247828_10175683All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300028592|Ga0247822_11577600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300028747|Ga0302219_10135693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300028759|Ga0302224_10457742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium521Open in IMG/M
3300028863|Ga0302218_10196876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium643Open in IMG/M
3300028866|Ga0302278_10505201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium512Open in IMG/M
3300029910|Ga0311369_10598258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium921Open in IMG/M
3300029911|Ga0311361_10164190All Organisms → cellular organisms → Bacteria2859Open in IMG/M
3300029943|Ga0311340_11477083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300029951|Ga0311371_12247252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium567Open in IMG/M
3300029999|Ga0311339_11809670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium530Open in IMG/M
3300030058|Ga0302179_10203262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300030509|Ga0302183_10089845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1212Open in IMG/M
3300031234|Ga0302325_10437351All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium2015Open in IMG/M
3300031344|Ga0265316_10961763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium595Open in IMG/M
3300031521|Ga0311364_12481164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium505Open in IMG/M
3300031525|Ga0302326_10703574All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300031616|Ga0307508_10887027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium517Open in IMG/M
3300031708|Ga0310686_107043525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300031708|Ga0310686_111070286All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031996|Ga0308176_10883615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium938Open in IMG/M
3300032805|Ga0335078_11944602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium632Open in IMG/M
3300032897|Ga0335071_10758886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium919Open in IMG/M
3300033557|Ga0316617_102823684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium506Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.58%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.30%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.03%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.27%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.27%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.52%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.52%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.76%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.76%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.76%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.76%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026835Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes)EnvironmentalOpen in IMG/M
3300026928Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)EnvironmentalOpen in IMG/M
3300026982Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062383_1068230123300004778Wetland SedimentVTKSVAAKPLVLNLSVEEENLAAVPFAVLERRVGKRVGKLEIHGKKVLSDGTEVEVLW
Ga0070683_10224831023300005329Corn RhizosphereLKKPETKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKMLPDGTEVRVVWQIQGNNELGLPTEQDLDIFVALG
Ga0070666_1002610813300005335Switchgrass RhizosphereLKKPESKPSLINLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIFVALGV
Ga0070687_10065775313300005343Switchgrass RhizosphereLSPSVSKSVPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKIQIQGTKVLPDGTELHVS
Ga0070675_10162537323300005354Miscanthus RhizosphereLSVEEENLAAVPFAVLERRVGKRFGKLEIDGTKVLPDGTVVQVLWQVQGNAELGLPTEQDLDIFVALGVLTFQSNFA
Ga0070741_1012900613300005529Surface SoilLNKSNPKPSLVNLSVEEENLAAIPFAVLERRVGKRVAKIEIKGTKVLPNGEELEVVWQIQGNNELG
Ga0070734_1066527223300005533Surface SoilVNKNSPKPAFVNLSVEEENLAAIPFAVLERRVGKRIAKIEIKGAKVLPNGREMEVVWQIQGNNEL
Ga0070735_1041825613300005534Surface SoilLVTVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEINGTKLLPDGTE
Ga0070731_1109116213300005538Surface SoilVNRNNPKPSLVNLSVEEENLAAIPFAVLERRVGKRTSKIEIKGAKTLPDGSEMEVVWQIQGNNEL
Ga0070732_1022689513300005542Surface SoilLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEINGTKLLPDG
Ga0068852_10005022643300005616Corn RhizosphereLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIFVALGVLTFQNNFNKT
Ga0066903_10736171423300005764Tropical Forest SoilVGKVQPNLLNLSVEEENLAAIPFAVLERRVGKRIGKIELSGTKMLPDGTELRVTWQVQGNNELGLPTEQDLDIFVA
Ga0066903_10817330533300005764Tropical Forest SoilVGKVQPTLLNLSVEEENLAAIPFAVLERRVGKQIGKIELNGTKTLPDGSELRVTWQVQGNNELGLPTEQDLDIFVAL
Ga0068860_10030840023300005843Switchgrass RhizosphereLKKPESKPSLINLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIF
Ga0075270_108692213300005894Rice Paddy SoilMFQKANSVPHVRTSLINLSVEEENLAAIPFAVLERRVGKRIGKLEIQGVKILPDGSQVRVTWQVQGNNELGLPTEQDLDIFIALGVLTFQNN
Ga0075029_10028581823300006052WatershedsLATKHSPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQD
Ga0075029_10114986113300006052WatershedsMRMPQNTDKPALLNLSVEEENLAAIPFAVLERRVGKKIGKIEIKGTKVLPDGTEMEVVWQVQGNAELGLPTEQDLDLFV
Ga0075019_1087716523300006086WatershedsMPRNTDKPALLNLSVEEENLAAIPFAVLERRVGKKIGKIEIKGTKVLPDGTEMEVVWQVQ
Ga0075015_10026750913300006102WatershedsVTKANPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIF
Ga0068871_10166145413300006358Miscanthus RhizosphereLSVEEENLAAVPFAVLERRVGKRFGKLEIDGTKVLPDGTVVQVLWQVQGNAELGLPTEQ
Ga0075434_10179678213300006871Populus RhizosphereLPRPNYTKPSLLNLSVEEENLAAIPFAVLERRVGKKIGKIEVRGTKILPDGREMRVTWQVQGNDELGLPTEQDLDIFVALGALTFRNNFTK
Ga0075424_10162415813300006904Populus RhizosphereMAKSVVKPALFRMSVEEENLGSIPFAVLESRVGKRIAKLEIQGTKTLPDGQELRVSWQVQGNSELGLPTEQDL
Ga0079218_1390490813300007004Agricultural SoilVSKPEPNKTSLLHLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGTEVHVSWQVQGNT
Ga0111538_1097333733300009156Populus RhizosphereMSAVAAVPNHKQSLIHLSVEEENLASIPFAILERRVGRRLGSIEIKGTKTLPDGTDITVCWQVQGNQEVGLPTEQD
Ga0105241_1177966813300009174Corn RhizosphereLATVLKKPEPKSSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIFVALGVLTFQNNFH
Ga0105248_1031645913300009177Switchgrass RhizosphereLATVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKVLPDGTEVRVVWQIQG
Ga0105248_1215264213300009177Switchgrass RhizosphereVSKQHNPKPSLVNLSVEEENLAAIPFAVLERRVGKRVGKIEIKGTKILPNGSEMEVVWQIQGNNELG
Ga0123519_1009040543300009503Hot SpringLNPSQNAKPALLNLSVEEENLGAIPFAVLERRVGKRLGKLEIKGKKALPDGTEVAVSWQVQGN
Ga0116222_136300313300009521Peatlands SoilVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPTEQDLDIFVVLGV
Ga0116218_145181013300009522Peatlands SoilVTRNNLKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTF
Ga0116225_153410913300009524Peatlands SoilMNLSVEEENLAAIPFAVLERRVGKRVGKIEINGNKVLPDGTKVRVVWQVQGNNELGLPTEQDLDIFVALG
Ga0105237_1028901023300009545Corn RhizosphereLATVLKKPETKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKMLPDGTEVRVVWQIQGNNELGLPTEQD
Ga0105237_1173994713300009545Corn RhizosphereLATVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVR
Ga0116105_103924933300009624PeatlandVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVL
Ga0116112_114871123300009636PeatlandVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTF
Ga0116106_108268713300009645PeatlandVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIHGNFKQTVPTEQDLDI
Ga0116135_137964723300009665PeatlandMTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRNNFA
Ga0116101_105949013300009759PeatlandVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVV
Ga0116134_118813613300009764PeatlandVIRHTPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEM
Ga0126305_1054742213300010036Serpentine SoilVSKAIPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKLLPDGTE
Ga0074045_1066542713300010341Bog Forest SoilVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGNIEIKGTKVLPNGSEMEVIWQIQGNNELGLPTEQDLD
Ga0126370_1115602813300010358Tropical Forest SoilVGKVQPTLLNLSVEEENLAAIPFAVLERRVGKQIGKIELNGTKMLPDGTELQVTWQVQGNNELGLPTEQDLDIFVALGVLTFRQNFA
Ga0105246_1153896013300011119Miscanthus RhizosphereVSKPVPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGAEVHVSW
Ga0137366_1081635313300012354Vadose Zone SoilMGKNLPKSSLMNLSIEEENLAAIPFAVLERRVGKRIGKLELHGTKILPDGSELRVLWQ
Ga0137375_1032618123300012360Vadose Zone SoilMVKHTAKLPLNLSVEEENLAAIPFAVLERRVGKRVGKIELQGTKILTNGQEVRVVWQVQG
Ga0138256_1143548913300012533Active SludgeMDKPSRKSSLINLSVEEENLAVIPFAVLERRVGKRVGKIEIRGRKTLPDGTDASVLWQVQGNADLGLPTEQDLDIFVALGV
Ga0164302_1084522813300012961SoilLFVPKTSAKRSLVNLSVEEQNLAAIPFAVLERRVGRRIGKLELEGTKILPDGTPVRVMWQVQGKQRNR*
Ga0126369_1054179113300012971Tropical Forest SoilVGKVQPTLLNLSVEEENLAAIPFAVLERRVGKQIGKIELNGTKVLPDGTELRVT
Ga0164305_1030363723300012989SoilLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGAEVHVSWQVQGNTELGLPTEQD
Ga0157369_1117440713300013105Corn RhizosphereLVPVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLP
Ga0157378_1157433733300013297Miscanthus RhizosphereMNLSVKQENLAAIPFAVLERRVGKKVGKIEINGTKILPDGTKMRVVWQVQGNNDLGLPTEQDLDIFVALGVLTFRN
Ga0157372_1020639323300013307Corn RhizosphereMAISPLGKAKATPKQSLMNLSVEEENLAAIPFAVLERRVGKKVGKIEISGSKTLPDGTAARVTWQVQGISDLGPPTEQDLDIFVALGVL
Ga0157375_1359111713300013308Miscanthus RhizosphereLATVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKVLPDGTEVRVVWQIQGNNELGLPTEQDL
Ga0181539_138354713300014151BogVTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPT
Ga0181538_1034986813300014162BogVTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVV
Ga0181523_1031506213300014165BogMNLSVEEENHAAIPFAVLERRVGKKIGKIEINGTKTLPDGTKMRVTWQVQGNNELGLPTEQDLDIFVALGVLTF
Ga0181526_1101776513300014200BogMEKHLAKLSLLNLSVEEENLAAIPFAVLERRVGKRIGKLEISGTKTLPDGSEVRVTWQIQGNSELGLPTEQ
Ga0075356_117262613300014323Natural And Restored WetlandsMNLSVEEENLAAIPFAVLERRVGKRVGKLEINGTKVLPDGTKVRVVWQVQGNSELGLPTE
Ga0182013_1053053223300014492BogVTKHNPKPTLVNLSVEEENLAAIPFAVLERRVGKRVGKIEIKGTKVLPNGSE
Ga0181525_1083221713300014654BogVTKPNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLD
Ga0173480_1091990313300015200SoilVSKPLPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGTEVHVSW
Ga0132257_10251494313300015373Arabidopsis RhizosphereVSKPVPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGAEVHVSWQVQGNTELGLPTEQDLDIFVALG
Ga0132255_10005032913300015374Arabidopsis RhizosphereMFQKSDGAQYAQTSLVNLSVEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGSQARVTWQVQGNNELGLPTEQDLDIFIA
Ga0132255_10536936313300015374Arabidopsis RhizosphereLVTVLKKPESKPSLLNLSVEEHNLASIPFAVLERRVGKTIGKLELNGTKLLPDGTEVRVVWQIQGNN
Ga0187879_1029892813300017946PeatlandLTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELG
Ga0187782_1051184113300017975Tropical PeatlandVTKPNQKPALVNLSVEEENLAAIPFAVLERRVGKRVGKIEIKGTKILPNGNEMEVV
Ga0181520_1022813013300017988BogVTKNNPKPALVNLSVEEENLSAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQI
Ga0187869_1021219513300018030PeatlandLTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPTE
Ga0187875_1062922213300018035PeatlandVTKHSLKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRNNF
Ga0187883_1013640333300018037PeatlandVTRHNPKPALVNLSVEEENLAAIPLAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRN
Ga0187855_1000152083300018038PeatlandVIRHTPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLACSHSGTTLLRL
Ga0187851_1033442713300018046PeatlandLTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPTEQDLDIF
Ga0187858_1004231113300018057PeatlandVTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPDGSEMEVVWQIQGNNELGLPT
Ga0187858_1027492633300018057PeatlandMTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRNNFAK
Ga0187784_1152995513300018062Tropical PeatlandVTKQNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPT
Ga0187784_1169463913300018062Tropical PeatlandVSKPNQKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGAKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVV
Ga0187769_1115235213300018086Tropical PeatlandVTKQPAKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPTEQDLDIFVVL
Ga0187771_1043308013300018088Tropical PeatlandVTKQNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVV
Ga0187771_1104907013300018088Tropical PeatlandVIKQSPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGL
Ga0190273_1025953113300018920SoilVTKSIPKPSLLHLSIEEENLAAIPFAVLERRVGKRIGKLEIQGTKVLPDGTEVLVSWQVQGNTELGLPTEQD
Ga0173482_1010723723300019361SoilMTHKTSSRLAALNLSVEEENLAAVPFAVLERRVGKRFGKLEIDGTKVLPDGTVVQVLWQVQGNAELGLPTEQDLDIFVALGVLTFQSNFA
Ga0210393_1017653323300021401SoilMLQEQRGDLIPDPRVNKIGSKPALVNLSVEEENLAAIPFAVLERRVGKRIAKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDL
Ga0210398_1145230413300021477SoilLVPVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKLLPDGTEVRVVWQIQGNNE
Ga0210402_1199878513300021478SoilLVPVLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEINGTKLLPDGTEVHVVWQIQGNNELGLPTEQDLDIFVALG
Ga0126371_1204781113300021560Tropical Forest SoilVGKVQPTLLNLSVEEENLAAIPFAVLERRVGKQIGKIELNGTKMLPDGTELQVTWQVQGNNEL
Ga0224544_106495513300023250SoilVTKHNPKPALVNLSVEEENLAAIPFAVLERSVGKRIGKIEIKGTKVLPNGSEMEVVWQIQ
Ga0124853_151191513300024056Freshwater WetlandsVIGLTKNTAKVSMLNLSIEEENLAAIPFAVLERRVGKRISRIQISGMKVLPNGRELRVTWEVQGNDELGLPTEQDLDIFVALGVLTFREQF
Ga0208194_101732013300025412PeatlandVTKHNPKPTLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRNN
Ga0208935_104246033300025414PeatlandVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIF
Ga0208690_101042133300025434PeatlandVTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNELGLPTEQDLDIFVVLGVLTFRNNFAK
Ga0208190_108355723300025473PeatlandVTRNNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNEFG
Ga0208589_106863713300025634Arctic Peat SoilLKKLESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEINGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIFVALGVLTF
Ga0207671_1019655113300025914Corn RhizosphereLKKPEPKSSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQI
Ga0207671_1051850423300025914Corn RhizosphereMPLPLAPVKAKASPKASLMNLSVEEENLAAIPFAVLERRVGKKIGKIEIKGKKVLPDGTEVEVNWQVQGNNELGLPTEQDL
Ga0207687_1006443553300025927Miscanthus RhizosphereLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNEL
Ga0207711_1206499913300025941Switchgrass RhizosphereVSKQHNPKPSLVNLSVEEENLAAIPFAVLERRVGKRVGKIEIKGTKILPNGSE
Ga0207675_10092462723300026118Switchgrass RhizosphereLVPVLKKPESKPSLINLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPT
Ga0207782_11998423300026835Tropical Forest SoilVSKISAKRSLVNLSVEEQNLAAIPFAVLERRVGRRIGKIELEGTKILPDGTEVRVVWQVQGNSELGLPTEQD
Ga0207779_103222113300026928Tropical Forest SoilVSKISAKRSLVNLSVEEQNLAAIPFAVLERRVGRRIGKLELEGTKILPDGTEVRVVWQIQGNSELGLPTEQDLDIFVALGVLTFQNNF
Ga0207854_103458013300026982Tropical Forest SoilMAKLPVVKTSLLHLSVEEENLAAIPFAVLERRVGKRIPQIEIKGSKILPDGSEMRV
Ga0208199_104470013300027497Peatlands SoilVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGGEMEVVWQIQGNNEL
Ga0209908_1007366423300027745Thawing PermafrostVTKQNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVIWQVQGNNELGLPTEQDLDIFVILGVLTFRN
Ga0209797_1036937923300027831Wetland SedimentVTKSVAAKPLVLNLSVEEENLAAVPFAVLERRVGKRVGKLEIHGKKVLSDGTEVEVLWQVQGNAELGLPTEQDLDIFVALGVLT
Ga0209169_1013898213300027879SoilMTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTE
Ga0209380_1001221743300027889SoilVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEV
Ga0209006_1133764213300027908Forest SoilVTKHPPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQI
Ga0268264_1050583223300028381Switchgrass RhizosphereLKKPESKPSLINLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKTLPDGTEVRVVWQIQGNNELGLPTEQDLDIFV
Ga0247828_1017568323300028587SoilMSKLVPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLQIEGTKLLPDGTEVLVSWQVQGNAELGLPTEQDLDIFVALGVLT
Ga0247822_1157760013300028592SoilMSKLVPKPSLLHLSVEEENLAAIPFAVLERRVGKRIGKLQIEGTKLLPDGTEVLVSWQVQGNAE
Ga0302219_1013569313300028747PalsaVNKHNLKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQ
Ga0302224_1045774213300028759PalsaVNKHNLKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVALGVLTFRNNF
Ga0302218_1019687623300028863PalsaVNKHNLKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLP
Ga0302278_1050520123300028866BogLVSVLKKLDSRPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEFEGTKLLPDGTEVRVMWQIQGNNELGLPTEQDLDIFVALGVLTFQNNFQKT
Ga0311369_1059825823300029910PalsaVNKHNLKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVALGVLTFRN
Ga0311361_1016419013300029911BogVTKYNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQDLDIF
Ga0311340_1147708313300029943PalsaVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEME
Ga0311371_1224725213300029951PalsaVNKHNLKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGSEMEVVWQIQGNNELGLPTEQDLDIFVALG
Ga0311339_1180967023300029999PalsaVTKYNPKPALVNLSVEEENLAAIPFAVLERRVGKRVGKIEIKGTKVLPNGSEMEVVWQIQGNNELGLPTEQ
Ga0302179_1020326213300030058PalsaVTKHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPNGGEMEV
Ga0302183_1008984523300030509PalsaVTKHNPKPSLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEM
Ga0302325_1043735123300031234PalsaLLNLSVEEQNLASIPFAVLERRVGKTTGKLEFEGTKLLPDGTEVKVMWQIQGNNELGLPTEQDLDIFVA
Ga0265316_1096176313300031344RhizosphereLTKPNPKPTLVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNNE
Ga0311364_1248116413300031521FenLSLKQITGRPSLVNLSVEEENLAAIPFAVLERRVGKRVGKIEITGNKTLPDGTEMQVTWQVQGNAEL
Ga0302326_1070357423300031525PalsaLLNLSVEEQNLASIPFAVLERRVGKTIGKLEFEGTKLLPDGTEVRVMWQIQGNNELGLPTEQDLDIFVALGVLTFQN
Ga0307508_1088702713300031616EctomycorrhizaMNLSVEEENLAAIPFAVLERRVGKKVGKIEINGSKTLPDGTIARVTWQVQGNNELGL
Ga0310686_10704352513300031708SoilVTRHNPKPALVNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKVLPNGSEMEVVWQIQGNN
Ga0310686_11107028613300031708SoilLVSVLKKPDSRPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLEFEGTKLLPDGAEVRVQ
Ga0308176_1088361513300031996SoilVYKQFSWLLFLKKPESKPSLLNLSVEEQNLASIPFAVLERRVGKTIGKLELNGTKLLPDGTEMHVVWQIQGNNELGLPTEQDLDIFV
Ga0335078_1194460213300032805SoilMPISSGKNKPGIKPPLLNLSVEEENLAAIPFAVLERRVGKKVGKIEISGTKALPDGTHMRVTWQVQGNNELGLPTEQDLDIFVALGTL
Ga0335071_1075888613300032897SoilMNLSVEEENLAAIPFAVLERRVGKKVGKIEINGTKTLADGSKLRVVWQVQGNNDLGLPTEQDLDIF
Ga0316617_10282368413300033557SoilVTNHLPKAALPNLSVEEENLAAIPFAVLERRVGKRIGKIEIKGTKILPDGTEVRVVWQVQGNNELGLPTEQDLDVF
Ga0326724_0504684_1_1473300034091Peat SoilMSINSAKRSLVNLSVEEQNLAAIPFAVLERRVGRRIGKLELEGTKILPD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.