Basic Information | |
---|---|
Family ID | F060846 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 45 residues |
Representative Sequence | MSRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQK |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.08 % |
% of genes near scaffold ends (potentially truncated) | 81.82 % |
% of genes from short scaffolds (< 2000 bps) | 71.21 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.424 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.970 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.42 % |
All Organisms | root | All Organisms | 32.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002306|B570J29618_1008959 | Not Available | 627 | Open in IMG/M |
3300002408|B570J29032_109536236 | Not Available | 848 | Open in IMG/M |
3300002408|B570J29032_109945985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4284 | Open in IMG/M |
3300002835|B570J40625_100410072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1312 | Open in IMG/M |
3300003394|JGI25907J50239_1064391 | Not Available | 731 | Open in IMG/M |
3300003411|JGI25911J50253_10043961 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
3300003491|JGI25924J51412_1031415 | Not Available | 882 | Open in IMG/M |
3300003491|JGI25924J51412_1072318 | Not Available | 524 | Open in IMG/M |
3300003497|JGI25925J51416_10073230 | Not Available | 857 | Open in IMG/M |
3300004792|Ga0007761_10142876 | Not Available | 610 | Open in IMG/M |
3300005580|Ga0049083_10145562 | Not Available | 813 | Open in IMG/M |
3300005581|Ga0049081_10137213 | Not Available | 900 | Open in IMG/M |
3300005584|Ga0049082_10035981 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
3300005584|Ga0049082_10104362 | Not Available | 992 | Open in IMG/M |
3300005805|Ga0079957_1082539 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
3300005805|Ga0079957_1100454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1578 | Open in IMG/M |
3300007165|Ga0079302_1076417 | Not Available | 724 | Open in IMG/M |
3300007319|Ga0102691_1493511 | Not Available | 535 | Open in IMG/M |
3300007541|Ga0099848_1009687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4272 | Open in IMG/M |
3300007651|Ga0102900_1149485 | Not Available | 515 | Open in IMG/M |
3300007973|Ga0105746_1135137 | Not Available | 825 | Open in IMG/M |
3300008117|Ga0114351_1184076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1110 | Open in IMG/M |
3300008120|Ga0114355_1137560 | Not Available | 1423 | Open in IMG/M |
3300008258|Ga0114840_1038062 | Not Available | 776 | Open in IMG/M |
3300008258|Ga0114840_1054655 | Not Available | 625 | Open in IMG/M |
3300008262|Ga0114337_1227186 | Not Available | 735 | Open in IMG/M |
3300008263|Ga0114349_1073788 | Not Available | 4463 | Open in IMG/M |
3300008266|Ga0114363_1043350 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300008266|Ga0114363_1120068 | Not Available | 914 | Open in IMG/M |
3300008450|Ga0114880_1277420 | Not Available | 504 | Open in IMG/M |
3300009159|Ga0114978_10112614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1785 | Open in IMG/M |
3300009161|Ga0114966_10506639 | Not Available | 687 | Open in IMG/M |
3300009163|Ga0114970_10055048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2557 | Open in IMG/M |
3300009184|Ga0114976_10265033 | Not Available | 928 | Open in IMG/M |
3300009194|Ga0114983_1067477 | Not Available | 818 | Open in IMG/M |
3300010354|Ga0129333_10284814 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300012017|Ga0153801_1025390 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
3300012773|Ga0138290_1177637 | Not Available | 527 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10108767 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
3300013372|Ga0177922_10516073 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
3300013372|Ga0177922_10954414 | Not Available | 607 | Open in IMG/M |
3300017761|Ga0181356_1179902 | Not Available | 638 | Open in IMG/M |
3300017774|Ga0181358_1036386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1907 | Open in IMG/M |
3300017774|Ga0181358_1067634 | All Organisms → Viruses → Predicted Viral | 1323 | Open in IMG/M |
3300017778|Ga0181349_1028767 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
3300017784|Ga0181348_1069810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1409 | Open in IMG/M |
3300017785|Ga0181355_1059219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1618 | Open in IMG/M |
3300019784|Ga0181359_1120592 | Not Available | 938 | Open in IMG/M |
3300020074|Ga0194113_10091117 | Not Available | 2711 | Open in IMG/M |
3300020141|Ga0211732_1257184 | Not Available | 3129 | Open in IMG/M |
3300020162|Ga0211735_11128445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2900 | Open in IMG/M |
3300020494|Ga0208326_105497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1194 | Open in IMG/M |
3300020494|Ga0208326_123160 | Not Available | 556 | Open in IMG/M |
3300020506|Ga0208091_1004673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1882 | Open in IMG/M |
3300020506|Ga0208091_1015871 | Not Available | 900 | Open in IMG/M |
3300020541|Ga0208359_1063420 | Not Available | 528 | Open in IMG/M |
3300020549|Ga0207942_1033229 | Not Available | 645 | Open in IMG/M |
3300020570|Ga0208465_1038589 | Not Available | 610 | Open in IMG/M |
3300021962|Ga0222713_10049347 | Not Available | 3227 | Open in IMG/M |
3300021963|Ga0222712_10053442 | Not Available | 3003 | Open in IMG/M |
3300022190|Ga0181354_1197536 | Not Available | 601 | Open in IMG/M |
3300022748|Ga0228702_1054222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300023179|Ga0214923_10126228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1656 | Open in IMG/M |
3300023179|Ga0214923_10229053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1067 | Open in IMG/M |
3300024350|Ga0255167_1040516 | Not Available | 833 | Open in IMG/M |
3300026473|Ga0255166_1056219 | Not Available | 763 | Open in IMG/M |
3300027144|Ga0255102_1076975 | Not Available | 525 | Open in IMG/M |
3300027214|Ga0208306_1063374 | Not Available | 629 | Open in IMG/M |
3300027293|Ga0255132_1116250 | Not Available | 526 | Open in IMG/M |
3300027581|Ga0209651_1043363 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
3300027621|Ga0208951_1143297 | Not Available | 627 | Open in IMG/M |
3300027656|Ga0209357_1011252 | All Organisms → Viruses → Predicted Viral | 3304 | Open in IMG/M |
3300027688|Ga0209553_1092913 | Not Available | 1100 | Open in IMG/M |
3300027689|Ga0209551_1055815 | Not Available | 1307 | Open in IMG/M |
3300027707|Ga0209443_1039391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1978 | Open in IMG/M |
3300027720|Ga0209617_10318590 | Not Available | 579 | Open in IMG/M |
3300027732|Ga0209442_1210585 | Not Available | 714 | Open in IMG/M |
3300027772|Ga0209768_10156414 | Not Available | 1062 | Open in IMG/M |
3300027772|Ga0209768_10375111 | Not Available | 573 | Open in IMG/M |
3300027806|Ga0209985_10145902 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1069881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1900 | Open in IMG/M |
3300027971|Ga0209401_1234245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300028088|Ga0255251_1071313 | Not Available | 670 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1159197 | Not Available | 914 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10188201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1168 | Open in IMG/M |
3300031758|Ga0315907_11180449 | Not Available | 537 | Open in IMG/M |
3300031758|Ga0315907_11238861 | Not Available | 519 | Open in IMG/M |
3300031787|Ga0315900_10470849 | Not Available | 963 | Open in IMG/M |
3300031857|Ga0315909_10222069 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
3300031857|Ga0315909_10421195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 949 | Open in IMG/M |
3300031857|Ga0315909_10940655 | Not Available | 528 | Open in IMG/M |
3300031951|Ga0315904_10611361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300031963|Ga0315901_10886855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300032050|Ga0315906_10421942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1154 | Open in IMG/M |
3300033981|Ga0334982_0026621 | All Organisms → Viruses → Predicted Viral | 3327 | Open in IMG/M |
3300033994|Ga0334996_0366383 | Not Available | 689 | Open in IMG/M |
3300034019|Ga0334998_0766897 | Not Available | 507 | Open in IMG/M |
3300034021|Ga0335004_0123056 | Not Available | 1707 | Open in IMG/M |
3300034061|Ga0334987_0427390 | Not Available | 830 | Open in IMG/M |
3300034092|Ga0335010_0597655 | Not Available | 560 | Open in IMG/M |
3300034101|Ga0335027_0065331 | Not Available | 2882 | Open in IMG/M |
3300034104|Ga0335031_0255789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1159 | Open in IMG/M |
3300034104|Ga0335031_0684667 | Not Available | 591 | Open in IMG/M |
3300034106|Ga0335036_0040688 | All Organisms → Viruses → Predicted Viral | 3600 | Open in IMG/M |
3300034106|Ga0335036_0229260 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
3300034106|Ga0335036_0877097 | Not Available | 511 | Open in IMG/M |
3300034110|Ga0335055_0197159 | Not Available | 893 | Open in IMG/M |
3300034283|Ga0335007_0288394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1082 | Open in IMG/M |
3300034355|Ga0335039_0400012 | Not Available | 705 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.94% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.82% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.82% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.79% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.79% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.52% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.52% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.52% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.52% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.52% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.76% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028088 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29618_10089591 | 3300002306 | Freshwater | MARGKAIQVKIPTAKVIKALETRLAELNTNFAKQDENEAKYRKAQ |
B570J29032_1095362361 | 3300002408 | Freshwater | MARSKPISVKIATTKVIKALETRLAKLEADFKKQD |
B570J29032_10994598518 | 3300002408 | Freshwater | MARSGKAIQVKIATTKVIKALEIRLAKLEADYTKQDENEAKYQKAMEKWRKE |
B570J40625_1004100723 | 3300002835 | Freshwater | MARGKAINVKIATPKVITALENRLVELEANYKKQDENEAKYNEALEAW |
JGI25907J50239_10643912 | 3300003394 | Freshwater Lake | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDEYEATYKLAK |
JGI25911J50253_100439611 | 3300003411 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKY |
JGI25924J51412_10314154 | 3300003491 | Freshwater Lake | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAKFQK |
JGI25924J51412_10723182 | 3300003491 | Freshwater Lake | MARSKPISVKIATAKVIKALETKLAETKANYAKQDENEAKYKLAQ |
JGI25925J51416_100732301 | 3300003497 | Freshwater Lake | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAK |
JGI25930J51415_10339341 | 3300003499 | Freshwater Lake | MARGNGRTLNVKIPTAKVIKALETKLAQIKVDYTKQDENEAKYQK |
Ga0007761_101428761 | 3300004792 | Freshwater Lake | MSRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDEYEAKYQKSREKWQKE |
Ga0068877_104803242 | 3300005525 | Freshwater Lake | MARGNGRTINVKIPTAKVIKALEDRLTVIKAEYKIQDELEAKYQKSMDKWRKEV |
Ga0049083_101455623 | 3300005580 | Freshwater Lentic | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQD |
Ga0049081_101372131 | 3300005581 | Freshwater Lentic | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDEYEATYKLA |
Ga0049082_100359811 | 3300005584 | Freshwater Lentic | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQD |
Ga0049082_101043624 | 3300005584 | Freshwater Lentic | MARSKPISVKIATAKVIKALETKLAETKANYAKQDENEAKYK |
Ga0079957_10825396 | 3300005805 | Lake | MARGGKAIQVKIPTAKVIKALETRLAKLEADYIKQDENEAKYKKAHEKWTKEL |
Ga0079957_11004541 | 3300005805 | Lake | MATRGKAINVKIATSKVITALENRLAKLEADYKKQDEN |
Ga0075471_102257801 | 3300006641 | Aqueous | MARGNNRTINVKIPTAKVIKALETKLAQMKADYAKQDENEAKYQKQMDTWRKQ |
Ga0079302_10764173 | 3300007165 | Deep Subsurface | MARGKAINVKIATPKVITALENRLVELEANYKKQDENEAKYNEALEAWKKE |
Ga0102691_14935111 | 3300007319 | Freshwater Lake | MATRGKAINVKIATAKVIQALETKLAQIEADYSKQDEKEANFKLAQEK |
Ga0099848_10096878 | 3300007541 | Aqueous | MARGNGRTINVKIPTQKVIKALEDRLTVIKAEYKI |
Ga0102900_11494852 | 3300007651 | Estuarine | MSRGKSISVKIATAKVIKALETKLAQLESDYATQTEK |
Ga0102859_12224331 | 3300007708 | Estuarine | MARGNGRTINVKIPTAKVIKALETKLVEIKTNYAKQDELENKYEKARQKWQK |
Ga0105746_11351373 | 3300007973 | Estuary Water | METITMARSKPISVKIATAKVIKALETKLAETKANYAKQDENEAKY |
Ga0114343_10784161 | 3300008110 | Freshwater, Plankton | MARGNGRTINVKIPTVKVINALETKLTQVKANYAKQDELE |
Ga0114351_11840763 | 3300008117 | Freshwater, Plankton | MARGKAINVKIATEKVIKALETKPAQIKKQYAEQDSLEAKYQKSL |
Ga0114355_11375605 | 3300008120 | Freshwater, Plankton | MTRGKAIQVKIPTAKVIKALETKLAELNTNFAKQDENEAKYRKA |
Ga0114840_10380621 | 3300008258 | Freshwater, Plankton | MARGKAIQVKIATTKVIKALEARLAKLEADYTKQDENEAKYNKKVEAWKKEI |
Ga0114840_10546551 | 3300008258 | Freshwater, Plankton | MARGKAIQVKIATAKVIKALETKLAKIEADYTKQDENE |
Ga0114337_12271861 | 3300008262 | Freshwater, Plankton | MARGKAIQVKIPTAKVIKALEAKLAQVEADYKKQDE |
Ga0114349_10737884 | 3300008263 | Freshwater, Plankton | MARSKPISVKIATAKVIQALETKLAQVEADYAKQDEKC* |
Ga0114363_10433506 | 3300008266 | Freshwater, Plankton | MARSKPISVKIATTKVIKALEARLAQLEADYTKQDENEAKYQ |
Ga0114363_11200683 | 3300008266 | Freshwater, Plankton | MATRGKAINVKIATSKVITALENRLAQLEANYKKQDENEAKYQDLF |
Ga0114880_12774201 | 3300008450 | Freshwater Lake | MARGKAINVKIATAKVIKALETKLAQVNSDYAKQDEYEAKYQKSVEKWNKEIAKFAV |
Ga0114968_101565251 | 3300009155 | Freshwater Lake | MARGNNRTINVKIPTAKVIKALETKSAQIKADYAKQDENEAKYQKQMDTWRKQVIK |
Ga0114968_102644811 | 3300009155 | Freshwater Lake | MARGNNRTINVKIPTTKVIKALETKSAQIKADYAKQDENEAKYQKQMDTWRKQVIK |
Ga0114977_106335901 | 3300009158 | Freshwater Lake | MARGNNRTINVKIPTTKVIKALETKLAQMKADYAKQDENEAKYQKQMDTWRKQVT |
Ga0114978_101126147 | 3300009159 | Freshwater Lake | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAKFQKK |
Ga0114966_104559932 | 3300009161 | Freshwater Lake | MARGNNRTINVKIPTTKVIKALETKLAQIKADYAKQDENEAKYQKQMDTWRKQVIK |
Ga0114966_105066391 | 3300009161 | Freshwater Lake | MARSKPISVKIPTAKVIKALETKLAETKANYAKQDENEAK |
Ga0114970_1005504812 | 3300009163 | Freshwater Lake | MARGNNRTINVKIPTAKVIKALETKSAQIKADYAKQDENEAKYQKQ |
Ga0105102_109189441 | 3300009165 | Freshwater Sediment | MTSNCSLLTKEIDMAKGNGRTINVKIPTVKVINALENRLTVIKAEYKIQDELEAKYQKSMDKWRKEVIKF |
Ga0114976_102650334 | 3300009184 | Freshwater Lake | MARGKAIQVKIPTAKVIKAIETRLAKLEADYTKQDENEA |
Ga0114983_10674774 | 3300009194 | Deep Subsurface | MARGKAIQVKIATDKVIKALEAKLAQLNADYAKQDENEA |
Ga0129333_102848141 | 3300010354 | Freshwater To Marine Saline Gradient | MSRGKAINVKIATPKVIKALETKLAQVEADYKKQDENEAK |
Ga0129333_116173592 | 3300010354 | Freshwater To Marine Saline Gradient | MARGNGRTINVKIPTAKVIKALETKLAQIKVDYAKQDENEAKYQKQMETWRKQVTKFAVA |
Ga0153801_10253901 | 3300012017 | Freshwater | MSRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQKSREKWQKEI |
Ga0138290_11776371 | 3300012773 | Freshwater Lake | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAKFQKKM |
(restricted) Ga0172373_101087677 | 3300013131 | Freshwater | MARGNGRTINVKIPTVKVIKALETKLTQIKADYTKQDELE |
Ga0177922_105160735 | 3300013372 | Freshwater | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKYQ |
Ga0177922_109544141 | 3300013372 | Freshwater | MSRGKAINVKIATSKVIKALETKLAQIKKDYESQDDLEAKYQK |
Ga0181356_11799022 | 3300017761 | Freshwater Lake | MNRNKPISVKIATTKVIKALEIKLAQVKADYTNQDEL |
Ga0181358_10363861 | 3300017774 | Freshwater Lake | MNRNKPISVKIATTKVIKALEIKLAQVKADYTNQDELEAKYQKQLEL |
Ga0181358_10676341 | 3300017774 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENE |
Ga0181349_10287671 | 3300017778 | Freshwater Lake | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDEYE |
Ga0181348_10698101 | 3300017784 | Freshwater Lake | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDEYEAT |
Ga0181355_10592191 | 3300017785 | Freshwater Lake | MNRNKPISVKIATTKVIKALEAKLAEVKADYTNQDELEAKYQKE |
Ga0181359_11205924 | 3300019784 | Freshwater Lake | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDE |
Ga0194113_100911171 | 3300020074 | Freshwater Lake | MSRSKAINVKIATAKVIKALETRLAKLNADFSSQDELE |
Ga0211732_125718411 | 3300020141 | Freshwater | MARSKPISVKIATAKVIQALETKLAQVEADYAKQDEKEAKYK |
Ga0211735_1112844510 | 3300020162 | Freshwater | MARGKAIQVKIATTKVIKALEVRLAKLEADYASQEEKEAKYQKSLEK |
Ga0208326_1054971 | 3300020494 | Freshwater | MARTKPISVKIATAKVITALENRLAELEANYKTQDENEAKFQTAIEAWKK |
Ga0208326_1231601 | 3300020494 | Freshwater | MARGKAINVKIATPKVIKALETKLAEIKNDYAKQDENEAKYQKSVEKWNKEI |
Ga0208091_10046735 | 3300020506 | Freshwater | MARGKAINVKIATPKVITALTNKLAELEANYKKQDENEAKYNEALEAWKK |
Ga0208091_10158711 | 3300020506 | Freshwater | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAKFQKKVD |
Ga0208359_10634202 | 3300020541 | Freshwater | MARGKAINVKIATAKVIKALEAKLATLEKDYATQTEKEAK |
Ga0207942_10332293 | 3300020549 | Freshwater | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENE |
Ga0208465_10385892 | 3300020570 | Freshwater | MARTKPISVKIATAKVITALENRLAELEANYKTQDENEAKFQ |
Ga0222713_1004934710 | 3300021962 | Estuarine Water | MARGKAINVKIATAKVIKALETKLAQVNSDYAKQD |
Ga0222712_100534421 | 3300021963 | Estuarine Water | MARGKAINVKIATAKVIKALETKLAQVNSDYAKQDEYEAKYQKSVE |
Ga0181354_11975361 | 3300022190 | Freshwater Lake | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQKSREKWQ |
Ga0228702_10542221 | 3300022748 | Freshwater | MARGNNRTINVKIPTTKVIKALETKLVQIKADYAKQDENEAKYQKQM |
Ga0214917_101945474 | 3300022752 | Freshwater | MARGNNRTINVKIPTAKVIKALETKLAQIKADYAKQDENEAKYQKQMDTWRKEVTKF |
Ga0214923_101262285 | 3300023179 | Freshwater | MARSKPISVKIATTKVIKALETRLAKLEADYTKQDENEAKY |
Ga0214923_102290531 | 3300023179 | Freshwater | MATRGKAINVKIATSKVITALENRLAKLEADYKKQDENEANYQ |
Ga0255167_10405161 | 3300024350 | Freshwater | MARGGKAIQVKIPTAKVIKALETKLAQLEADYTKQDENEAK |
Ga0255166_10562191 | 3300026473 | Freshwater | MARGGKAIQVKIPTAKVIKALETKLAQLEADYTKQDENE |
Ga0255102_10769751 | 3300027144 | Freshwater | MSRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQK |
Ga0208306_10633742 | 3300027214 | Estuarine | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQKSREKW |
Ga0255132_11162502 | 3300027293 | Freshwater | MARGKAINVKIATPKVITALTNKLAELEANYKKQDENEAKYQELHD |
Ga0209651_10433635 | 3300027581 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKYQKK |
Ga0208951_11432972 | 3300027621 | Freshwater Lentic | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDE |
Ga0209357_101125213 | 3300027656 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDEN |
Ga0209553_10929131 | 3300027688 | Freshwater Lake | MATRGKAIQVKIPTAKVIKALETRLATLEADYTKQDENE |
Ga0209551_10558151 | 3300027689 | Freshwater Lake | MNRNKPISVKIATTKVIKALEVKLAQIKADYTNQDELEAKYQKELE |
Ga0209443_10204281 | 3300027707 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKYQKKKEAWQKEIGK |
Ga0209443_10393911 | 3300027707 | Freshwater Lake | MARGKAIQVKIPTAKIITALEAKLAKTKADYSKQDEYEATY |
Ga0209617_103185903 | 3300027720 | Freshwater And Sediment | MTRGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKYQ |
Ga0209442_10291078 | 3300027732 | Freshwater Lake | MARGGKAIQVKIPTAKVIKALETKLAQTKANYAKQDENEAKYQKKKEAWQKEIG |
Ga0209442_12105851 | 3300027732 | Freshwater Lake | MARSKPISVKIATAKVITALTTRLAELEANYKTQDENEGKYQKKKE |
Ga0209768_101564143 | 3300027772 | Freshwater Lake | MNRNKPISVKIATTKVIKALEIKLAQVKADYTNQDELEAKYQKE |
Ga0209768_103751112 | 3300027772 | Freshwater Lake | MTRGKAIQVKIPTAKVIKALETKLAKVKADYAKQDENEAKYQKS |
Ga0209985_101459025 | 3300027806 | Freshwater Lake | MARGKAINVKIATAKVIKALETKLAQVNADYSKQDEYEAKYQKSVE |
Ga0209990_101246881 | 3300027816 | Freshwater Lake | MARGNNRTINVKIPTARVIKALENRLAVIKAEYKAQDELEAKYNKAYLAWQKELVK |
(restricted) Ga0247837_10698816 | 3300027970 | Freshwater | MARGKAIQVKIPTAKIITALEAKLAKTKADYAKQDEYEAKYKLEKEAWQ |
Ga0209401_12342452 | 3300027971 | Freshwater Lake | MARGNNRTINVKIPTAKVIKALETKLAQMKADYAKQDENEARY |
Ga0255251_10713131 | 3300028088 | Freshwater | MTRGKAIQVKIPTAKVIKALETKLAKVRADYAKQDEYEAKYQKSREKWQKEIGK |
(restricted) Ga0247843_11591973 | 3300028569 | Freshwater | MARGKAIQVKIPTAKIISALEAKLAKTKADYSKQDEYEAKYK |
(restricted) Ga0247842_101882013 | 3300029268 | Freshwater | MARGKAIQVKIPTAKIITALEAKLAKTKADFSKQDEYEAQYKLAK |
Ga0315907_111804491 | 3300031758 | Freshwater | MARGKAINVKIATAKVIKALETKLAQVNADYSKQDEYE |
Ga0315907_112388612 | 3300031758 | Freshwater | MARGKAIQVKIATTKVIKALETRLAKLEADYTKQDENEAKY |
Ga0315899_102343191 | 3300031784 | Freshwater | MTNHQSHGRIGAQTVGTKQKGRQMARGNNRTINVKIPTVKVIKALETKLAQVKADYEKQDENETKYQKQMETWKKQ |
Ga0315900_104708494 | 3300031787 | Freshwater | MARGKAINVKIATAKVIKALETKLAQVNADYSKQDE |
Ga0315900_107456072 | 3300031787 | Freshwater | MARGNGRTINVKIPTAKVINALETKLTQIKTNYAKQDELENKYKKTH |
Ga0315900_109174112 | 3300031787 | Freshwater | MARGNNRTINVKIPTARVIKALENRLAVIKAEYKAQDELEAKYQQSYEQWKKKVAKL |
Ga0315909_102220696 | 3300031857 | Freshwater | MARGNGRTLNVKIPTAKVIKALETKLAQIKVDYTKQDE |
Ga0315909_104211953 | 3300031857 | Freshwater | MARSKPISVKIATAKVIQALETKLAQVEADYAKQDENEAK |
Ga0315909_109406551 | 3300031857 | Freshwater | MARSKPISVKIATTKVIKALEAKLAQIKADYAKQDENEAKYQKSLEKW |
Ga0315904_106113611 | 3300031951 | Freshwater | MARGNGRTLNVKIPTAKVIKALEIKLAQIKVDYTKQDENEAKYQKQMETWRKQVT |
Ga0315901_108868551 | 3300031963 | Freshwater | MARGNGRTINVKIPTTKVINALETKLTQIKTNYAKQDELESKYK |
Ga0315906_104219423 | 3300032050 | Freshwater | MATRGKAINVKIATSKVITALENRLAKLEADYKKQDENEAKYQKSVEKWKK |
Ga0315902_106923013 | 3300032093 | Freshwater | MVGTKQKGRQMARGNNRTINVKIPTTKVIKALETKLAQMKADYAKQDENEAKYQKQMDTWRKQVT |
Ga0315903_106295093 | 3300032116 | Freshwater | MARGNNRTINVKIPTVKVIKALETKLAQMKADYAKQDENEAKYQKQMDTWRKQVTKFAV |
Ga0334982_0026621_2_124 | 3300033981 | Freshwater | MARGKAINVKIATPKVITALTNKLAELEANYKKQDENEAKY |
Ga0334996_0366383_3_134 | 3300033994 | Freshwater | MARTKPISVKIATAKVITALENRLAELEANYKTQDENEAKYQAS |
Ga0334998_0766897_1_153 | 3300034019 | Freshwater | MARSKPISVKIATAKVITALEARLAELEANYKTQDENEAKFQIAIEAWKKE |
Ga0335004_0123056_3_158 | 3300034021 | Freshwater | MARGKAIQVKIATTKVIKALETRLAKLEADYKKQDENEAKFQKSIEKWKKEL |
Ga0334987_0427390_2_133 | 3300034061 | Freshwater | MTRGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAKYQKA |
Ga0335010_0597655_2_121 | 3300034092 | Freshwater | MARGKAIQVKIPTAKVIKALETRLAKLEADYTKQDENEAK |
Ga0335027_0065331_2757_2882 | 3300034101 | Freshwater | MARGKAINVKIATPKVITALENRLVELEANYKKQDENEAKYN |
Ga0335027_0523321_2_163 | 3300034101 | Freshwater | MARGNGRTINVKIPTQKVIKALENRLEVIKAEYKIQDELEAKYQKSMDKWREEV |
Ga0335030_0507370_590_757 | 3300034103 | Freshwater | MARGNGRTINVKIPTARVIKALESRLAVIKLEYKAQDELEAKYNKAYLAWQKELVK |
Ga0335031_0255789_3_143 | 3300034104 | Freshwater | MARGKAINVKIATPKVITALTNKLAELEANYKKQDENEAKYNEALEA |
Ga0335031_0684667_1_117 | 3300034104 | Freshwater | MARAKPISVKIATTKVIKALETRLAKLEADFKKQDENEA |
Ga0335036_0040688_3_143 | 3300034106 | Freshwater | MARGKAINVKIATPKVITALENRLVELEANYKKQDENEAKYNEALEA |
Ga0335036_0229260_1134_1268 | 3300034106 | Freshwater | MARAKPISVKIATTKVIKALETRLAKLEADFKKQDENEAKYRKAQ |
Ga0335036_0877097_386_511 | 3300034106 | Freshwater | MARSKPISVKIATAKVITALEARLAELEANYKTQDENEAKFQ |
Ga0335055_0197159_3_143 | 3300034110 | Freshwater | MARGKAINVKIATPKVITALTNKLVELEANYKKQDENEANFQLKQDA |
Ga0335056_0341939_633_818 | 3300034120 | Freshwater | MARGNNRTINVKIPTARVIKALESRLAVIKLEYKAQDELEAKYNKAYLAWQKELVKYAMDNI |
Ga0335007_0288394_3_125 | 3300034283 | Freshwater | MARGKAINVKIATPKVITALENRLVELEANYKKQDENEAKY |
Ga0335039_0400012_2_160 | 3300034355 | Freshwater | MARGKAIQVKIPTTKVIKALEVRLAKLEADYTKQDENEAKFNKNMEAWKKEIG |
⦗Top⦘ |