NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060750

Metagenome / Metatranscriptome Family F060750

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060750
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 41 residues
Representative Sequence EDVRHSRAAVTRAWIILAVLALFYLGWTLTVYFLEPGLR
Number of Associated Samples 110
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 97.73 %
% of genes from short scaffolds (< 2000 bps) 88.64 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(31.061 % of family members)
Environment Ontology (ENVO) Unclassified
(31.061 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.818 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00115COX1 23.48
PF03100CcmE 0.76
PF00557Peptidase_M24 0.76
PF00089Trypsin 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18401DT7IWAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300001991|JGI24743J22301_10138820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300005171|Ga0066677_10507212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300005171|Ga0066677_10611785All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005172|Ga0066683_10334689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300005329|Ga0070683_102343022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005338|Ga0068868_100340313All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300005365|Ga0070688_101418177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005406|Ga0070703_10145073All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300005440|Ga0070705_101218236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005444|Ga0070694_101230864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300005451|Ga0066681_10299912All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300005544|Ga0070686_101949376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300005553|Ga0066695_10866059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005557|Ga0066704_10926960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300005558|Ga0066698_11033354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300005561|Ga0066699_10058612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2400Open in IMG/M
3300005568|Ga0066703_10305312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300005614|Ga0068856_101833496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300006046|Ga0066652_100159169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1902Open in IMG/M
3300006046|Ga0066652_100200707All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300006796|Ga0066665_10117049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1979Open in IMG/M
3300006800|Ga0066660_10067015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2419Open in IMG/M
3300006806|Ga0079220_11185014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300009012|Ga0066710_100074968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4368Open in IMG/M
3300009012|Ga0066710_101826888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300009137|Ga0066709_102601894All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300009174|Ga0105241_11404378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300010042|Ga0126314_10490184All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300010303|Ga0134082_10427799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300010320|Ga0134109_10492289All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010325|Ga0134064_10070960All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300010325|Ga0134064_10094401All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300010326|Ga0134065_10364917All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300010333|Ga0134080_10293468All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300010335|Ga0134063_10059240All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300010336|Ga0134071_10237663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300010337|Ga0134062_10575365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300010337|Ga0134062_10611458All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010337|Ga0134062_10618539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300010373|Ga0134128_13022029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012198|Ga0137364_10286368All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300012201|Ga0137365_10944577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300012204|Ga0137374_10068982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3496Open in IMG/M
3300012204|Ga0137374_10097242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2789Open in IMG/M
3300012211|Ga0137377_11383606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300012285|Ga0137370_10940892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300012356|Ga0137371_10330639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300012356|Ga0137371_11122905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300012356|Ga0137371_11133402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012358|Ga0137368_10067679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2913Open in IMG/M
3300012913|Ga0157298_10274679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300012923|Ga0137359_11480028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012941|Ga0162652_100046595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300012951|Ga0164300_10156963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300012984|Ga0164309_11093101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300012989|Ga0164305_12108811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300014157|Ga0134078_10070746All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300014157|Ga0134078_10295012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300014157|Ga0134078_10387242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300014314|Ga0075316_1113896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300014325|Ga0163163_11967111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300014968|Ga0157379_11201300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300015054|Ga0137420_1492206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4191Open in IMG/M
3300015077|Ga0173483_10065332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1431Open in IMG/M
3300015161|Ga0167623_1011489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2602Open in IMG/M
3300015359|Ga0134085_10134805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1042Open in IMG/M
3300015359|Ga0134085_10355856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300018027|Ga0184605_10213896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300018051|Ga0184620_10311802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300018071|Ga0184618_10043000All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300018071|Ga0184618_10357806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300018071|Ga0184618_10471859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300018073|Ga0184624_10027598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2171Open in IMG/M
3300018076|Ga0184609_10192214All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300018431|Ga0066655_10218144All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300019867|Ga0193704_1074682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300019876|Ga0193703_1011618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1323Open in IMG/M
3300019890|Ga0193728_1359209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300020005|Ga0193697_1106865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300020170|Ga0179594_10426277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300021073|Ga0210378_10248135All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300021080|Ga0210382_10323077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300021413|Ga0193750_1082062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300021445|Ga0182009_10794115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300022694|Ga0222623_10408243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300022694|Ga0222623_10413845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300022756|Ga0222622_10014197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3887Open in IMG/M
3300022756|Ga0222622_10429442All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300025944|Ga0207661_12146283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300025993|Ga0208415_1018127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300026078|Ga0207702_11732522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300026523|Ga0209808_1252470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300026547|Ga0209156_10284541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300026550|Ga0209474_10043661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3256Open in IMG/M
3300026552|Ga0209577_10055139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3339Open in IMG/M
3300026552|Ga0209577_10686586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300026552|Ga0209577_10824169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300027562|Ga0209735_1103490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300028379|Ga0268266_11444635All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300028708|Ga0307295_10047121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300028708|Ga0307295_10118221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300028711|Ga0307293_10094173All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300028715|Ga0307313_10232768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300028718|Ga0307307_10131618All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300028721|Ga0307315_10147272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300028744|Ga0307318_10014356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2535Open in IMG/M
3300028771|Ga0307320_10127929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria976Open in IMG/M
3300028778|Ga0307288_10105498All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300028784|Ga0307282_10057884All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300028787|Ga0307323_10071850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300028787|Ga0307323_10075324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1202Open in IMG/M
3300028791|Ga0307290_10285627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300028793|Ga0307299_10127414All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300028803|Ga0307281_10349964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300028807|Ga0307305_10086381All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300028810|Ga0307294_10009882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2350Open in IMG/M
3300028811|Ga0307292_10202835All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300028824|Ga0307310_10482722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300028828|Ga0307312_11191725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300028872|Ga0307314_10053624All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300028875|Ga0307289_10148570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300028878|Ga0307278_10075016All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300028880|Ga0307300_10009303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2494Open in IMG/M
3300028880|Ga0307300_10162774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300028885|Ga0307304_10108636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300030903|Ga0308206_1082945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300030993|Ga0308190_1095975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300030993|Ga0308190_1129072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300031058|Ga0308189_10117927All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300031421|Ga0308194_10067339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300032205|Ga0307472_102229077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil31.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil12.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015161Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_005627502124908009SoilVRHSRSALIRAWIILALLALFYLAWTLTVYFLEPGLR
JGI24743J22301_1013882023300001991Corn, Switchgrass And Miscanthus RhizosphereDVGGDVRHSRGAMNRAWVILAILILFYLAWTLTVYFLEPGLR*
Ga0066677_1050721213300005171SoilDVGEDVRHSRGAVTRAWIILVAIALFYLAWTLIVYFLEPGLR*
Ga0066677_1061178513300005171SoilVGYRDVGEDVRHSRRAQNRAWVILGILILLYLGWTLIVYFLEPGLR*
Ga0066683_1033468923300005172SoilLFGYRDVGEDVRHSRSTMMRAWVILAVLIAFYVGWTLVIFFLEPGLR*
Ga0070683_10234302213300005329Corn RhizosphereDVGEDIRHGRGAIQRAWIVLAILIVIYLAWTLTVYFLEPGLR*
Ga0068868_10034031313300005338Miscanthus RhizosphereRDVGEDVRHSRSTTIRAWVILAGLMIIYLGWTLVVFFLEPGLR*
Ga0070688_10141817713300005365Switchgrass RhizosphereRDVGEDVRHGKSAMTRAWIVLAILIVIYLAWTLTIYFLEPGLR*
Ga0070703_1014507323300005406Corn, Switchgrass And Miscanthus RhizosphereGYRDVGEDVRHGRRAEIRAWTILAVLMAIYLGWTLLIYFVEPGLR*
Ga0070705_10121823623300005440Corn, Switchgrass And Miscanthus RhizosphereLVGYRDVGEDIRHGPSAIRRAWIVLAILIVIYLVWTLTIYFLEPGLR*
Ga0070694_10123086423300005444Corn, Switchgrass And Miscanthus RhizosphereVGYRDVGEDIRHGPSAIRRAWIVLAILIVIYLVWTLTIYFLEPGLR*
Ga0066681_1029991213300005451SoilGYRDIGEDVRQSRGSLIRAWVILAALVIFYLGWTLTVFFLEPGLR*
Ga0070686_10194937613300005544Switchgrass RhizosphereDVGEDVRHGKSAMTRAWIVLAILIVIYLAWTLTIYFLEPGLR*
Ga0066695_1086605913300005553SoilVGEDVRHSRSTTIRAWVILAGLMIIYLGWTLVVFFLEPGLR*
Ga0066704_1092696023300005557SoilTGEDVRDGRSALTRAWIVLAILIVIYLAWTLTVYFLEPGLR*
Ga0066698_1103335413300005558SoilGEDIRHSRALVTRTWVILGLIAVVYLAWTLTVFFLEPGLR*
Ga0066699_1005861213300005561SoilGEDVRHSRGAIWRGWIILAVLMAFYLGWTLVVYFLEPGLR*
Ga0066703_1030531223300005568SoilTGEDVRDGRSALTRAWIVLAILIVIYLAWTLTVYFIEPGLR*
Ga0068856_10183349623300005614Corn RhizosphereRDVGEDVRHSRGSIIRAWIILAVLMLFYIGWTLTVYFLEPGLR*
Ga0066652_10015916913300006046SoilTGEETRWSRRTVIRAWIILAVIALLYLGWTLTVYFLEPGLR*
Ga0066652_10020070713300006046SoilSRGSLIRAWVILAALVIFYLGWTLTVFFLEPGLR*
Ga0066665_1011704923300006796SoilDVRHSRRNHVRAWIILAFLVALYLIWTLIVYFLEPGLR*
Ga0066660_1006701513300006800SoilLFGYRDVGDEVRHSRGTLWRAWIILAVLMLFYIGWTLTVYFLEPGLR*
Ga0079220_1118501423300006806Agricultural SoilGYRDVGEHDPRHSREAHIRAWVILGVIAAVYLVWTLIVYFFEPGLR*
Ga0066710_10007496843300009012Grasslands SoilFGYRDVGEEVRHSKRAEMRAWVILAVIALFYFGWTLTVYFFEPGLR
Ga0066710_10182688813300009012Grasslands SoilHSRRTMIRAWVIIAALMIFYLIWTLVVFFLEPGLR
Ga0066709_10260189413300009137Grasslands SoilGYRDVGEDVRHARGSMIRAWVILAVLVLFYLGWTLIVFFLEPGLR*
Ga0105241_1140437823300009174Corn RhizosphereYRDVGEDIRHGRGAIQRAWIVLAILIVIYLAWTLTVYFLEPGLR*
Ga0126314_1049018413300010042Serpentine SoilRDIGEDEARDSRRTGVRTWLIIAGLALFYLAWTLIVYFLEPGLR*
Ga0134082_1042779923300010303Grasslands SoilDVRHSRGAIRRGWIILAVLMAFYLGWTLIVYFLEPGLR*
Ga0134109_1049228913300010320Grasslands SoilDVGEDTRHSRRAVIRAWVILAVIGAFYLAWTLTVYFLEPGLR*
Ga0134064_1007096013300010325Grasslands SoilEEVRESRGSLIRAWIILGALVIFYLGWTLIVFFLEPGLR*
Ga0134064_1009440113300010325Grasslands SoilSRGAVIRAWVILAVLGAFYLAWTLTVFFLEPGLR*
Ga0134065_1036491723300010326Grasslands SoilHSRRAQNRAWVILGILILLYLGWTLIVYFLEPGLR*
Ga0134080_1029346813300010333Grasslands SoilTRHSRNAVIRAWVILAVIGLCYLGWTLTVYFLEPGLR*
Ga0134063_1005924013300010335Grasslands SoilRDVGEDVRHSRGAMSRAWIVLAALMLFYLGWTLFIYFLEPGLR*
Ga0134071_1023766313300010336Grasslands SoilDVRHSRTALTRAWIVLAILIVIYLAWTLTVYFLEPGLR*
Ga0134062_1057536513300010337Grasslands SoilSRNATSRAWIVLAALILLYLGWTLVVYFLEPGLR*
Ga0134062_1061145813300010337Grasslands SoilIRHSSRAHTRSWIILAALILLYLGWTLVIYFLEPGLR*
Ga0134062_1061853923300010337Grasslands SoilGEDVRHSRSTMIRAWVILAVLMAFYVGWTLVIFFLEPGLR*
Ga0134128_1302202923300010373Terrestrial SoilYRDVGHGVRHSRRNVTRSWIILACLIGLYLLWTLIVYFLEPGLR*
Ga0137364_1028636813300012198Vadose Zone SoilSRSTMIRAWVILAVLMAFYVGWTLVIFFLEPGLR*
Ga0137365_1094457713300012201Vadose Zone SoilGYRDVGPDVRHSRRNITRAWIVLGALVCFYLAWTLLVYFLEPGLR*
Ga0137374_1006898223300012204Vadose Zone SoilMGYRDTGEDVRHSRAALLRAWVILGAIAIFYLAWTLIVYFLEPGLR*
Ga0137374_1009724223300012204Vadose Zone SoilSRQAHVRAWVILAVMIALSLGWTLTVYFIEPGLR*
Ga0137377_1138360623300012211Vadose Zone SoilVRHSRSAMTRAWVILAVLMALYLGWTLVVYFLEPGLR*
Ga0137370_1094089223300012285Vadose Zone SoilVGADVRHNRSTLTRAWIILAILIVIYLAWTLTVYFIEPGLR*
Ga0137371_1033063923300012356Vadose Zone SoilGEGVRHGRNALTRAWIILAILIVLYFAWTLTVYFVEPGLR*
Ga0137371_1112290513300012356Vadose Zone SoilRHSRSTMIRAWVILAVLMAFYLGWTLIVFFLEPGLR*
Ga0137371_1113340213300012356Vadose Zone SoilEDVRHSRKAVSRAWVILAIMTLLYLGWTLTVYFIEPGLR*
Ga0137368_1006767923300012358Vadose Zone SoilYRDVGEDVRWSRQAQYRAWVILAVMIALSLGWTLTVYFIEPGLR*
Ga0157298_1027467933300012913SoilGYRDVGEDVRHSRDAMTRAWVILAILVVLYLAWTLTVYFLEPGLR*
Ga0137359_1148002813300012923Vadose Zone SoilVGEDLRHGRNAQTRAWIVLAILIVIYFAWTLTVYFIEPGLR*
Ga0162652_10004659513300012941SoilRDIGEDDVRHSRSALRRAWIVLAILIVIYLAWTLTIYFLEPGLR*
Ga0164300_1015696323300012951SoilFGYRDTGADDVRHSRSALRRAWIVLAILIVFYLAWTLTIYFLEPGLR*
Ga0164309_1109310113300012984SoilLLGYRDVGEDVRHGKSAMKRAWIVLAILIVIYLAWTLTIYFLEPGLR*
Ga0164305_1210881123300012989SoilVGYRDVGEDVRHSRSSMIRAWIILAVLIAFYLGWTLIVFFLEPGLR*
Ga0134078_1007074623300014157Grasslands SoilLVGYRDVGEETRHSRGAEIRAWVILAVIGAFYLGWTLTVYFLEPGLR*
Ga0134078_1029501223300014157Grasslands SoilDARHSRPAIVRAWVILAVLVAIYLTWTLIVYFFEPGLR*
Ga0134078_1038724223300014157Grasslands SoilRHSRGSMVRGWVILGALALFYLAWTLTVYFLEPGLR*
Ga0075316_111389623300014314Natural And Restored WetlandsVRHSSRNVSRAWIILAVMIAIYLLWTLIIYFLEPGLR*
Ga0163163_1196711113300014325Switchgrass RhizosphereAGYRDVGGDVRHSRGAMNRAWVILAILILFYLAWTLTVYFLEPGLR*
Ga0157379_1120130023300014968Switchgrass RhizosphereRHSRSTTIRAWVILAGLMIIYLGWTLVVFFLEPGLR*
Ga0137420_149220643300015054Vadose Zone SoilVRHGRSAVSRAWVILAFMVLVYLGWTLTVYFIEPGLR*
Ga0173483_1006533223300015077SoilVGEDVRHSRQAVNRAWVILAIMVLLYLAWTLTVFFIEPGLR*
Ga0167623_101148923300015161Glacier Forefield SoilRGERHGREQQRRAWVILALLVVLYLGWTLTIFFIEPGLR*
Ga0134085_1013480513300015359Grasslands SoilRDVGHGVRHSRRNVTRSWIILACLIGLYLLWTLIVYFLEPGLR*
Ga0134085_1035585623300015359Grasslands SoilEVRHSRRAQNRAWVILAVLVVLYLAWTLTVYFIEPGLR*
Ga0184605_1021389623300018027Groundwater SedimentVRHSRNSIVRSWVILALLVVFYVAWTLTVYFAEPGLR
Ga0184620_1031180213300018051Groundwater SedimentIRHGRDALTRAWIVLAILIVIYLAWTLTIYFIEPGLR
Ga0184618_1004300013300018071Groundwater SedimentLVGYRDVGGDVRHSRPQMVRSWIILAVLVLLYFVWTLTVYFLEPGLR
Ga0184618_1035780623300018071Groundwater SedimentRDVGEDVRHGRNALTRAWIVLAILIVIYLAWTLTVYFLEPGLR
Ga0184618_1047185923300018071Groundwater SedimentGYRDVGGPDVRHSRGAMTRAWIVLAVMVVLYLAWTLTVYFLEPGLR
Ga0184624_1002759813300018073Groundwater SedimentVRHSRQQVVRSWVILAFLIVLFFAWTLTVYFLEPGLR
Ga0184609_1019221423300018076Groundwater SedimentEDVRHSRPARIRAWVILALIALLYVAWTLTVYFIEPGLR
Ga0066655_1021814423300018431Grasslands SoilRQSRGSLIRAWVILAALVIFYLGWTLTVFFLEPGLR
Ga0193704_107468223300019867SoilRHSRQQVVRSWVILAFLIVLFFAWTLTVYFLEPGLR
Ga0193703_101161823300019876SoilRHNRSALRRAWIVLAILIVFYLAWTLTIYFLEPGLR
Ga0193728_135920923300019890SoilVGYRDVGEDVRHSRSSMIRAWMILAVLIAFYLGWTLVVFFLEPGLR
Ga0193697_110686523300020005SoilGYRDVGEDVRHSRSAVNRSWVILAILVVVYLAWTLTVFFIEPGLR
Ga0179594_1042627723300020170Vadose Zone SoilDVGEDVRHGRNALTRAWIVLAILIVIYLAWTLTVYFVEPGLR
Ga0210378_1024813523300021073Groundwater SedimentGYRDVGEDVRHSRPARIRAWVILALIALLYVAWTLTVYFVEPGLR
Ga0210382_1032307723300021080Groundwater SedimentIGPGVRHSRRAEIRAWVILGLLAVIYLGWTLTVYFIEPGLR
Ga0193750_108206213300021413SoilVRHSRPQSIRSWIILAVLVLLYFGWTLTVYFLEPGLR
Ga0182009_1079411523300021445SoilDVGEDVRHSRGSIIRAWIILAVLMLFYIGWTLTVYFLEPGLR
Ga0222623_1040824323300022694Groundwater SedimentGEDVRHGRSAMTRAWIVLAILIVIYLAWTLTVYFLEPGLR
Ga0222623_1041384523300022694Groundwater SedimentVGEDVRHSRQAVSRAWVILGIMAVLYLAWTLTVYFVEPGLR
Ga0222622_1001419743300022756Groundwater SedimentGGDVRHSRSAMTRAWIILAILIVFYLAWTLIVYFLEPGLR
Ga0222622_1042944213300022756Groundwater SedimentDVRHSRPQIVRAWLILAFLIVLYIGWTLTVYFLEPGLR
Ga0207661_1214628313300025944Corn RhizosphereVRHGKSAMTRAWIVLAILIVIYLAWTLTIYFLEPGLR
Ga0208415_101812713300025993Rice Paddy SoilGGEVRHSRRAQNRAWAILAVFVILYLAWTLTVYFIEPGLR
Ga0207702_1173252223300026078Corn RhizosphereDTGAEPHRFSRGALVRAWVILAILVVFYLGWTLTVYFLEPGLR
Ga0209808_125247023300026523SoilAGYRDVGHDVRHSRRNHMRAWIILAVLVALYLVWTLIVYFLEPGLR
Ga0209156_1028454113300026547SoilVGYRDTGVEEDDRQSRSAVTRAWIILAVIALFYLGWTLTVYFLEPGLR
Ga0209474_1004366113300026550SoilDIGEDVRHSRGAIIRAWIILAALAIFYLGWTLIVFFLEPGLR
Ga0209577_1005513923300026552SoilGYRDVGDEVRHSRGTLWRAWIILAVLMLFYIGWTLTVYFLEPGLR
Ga0209577_1068658623300026552SoilRDVGEDIRHSRRSLTRAWIILAVLMAIYLGWTLTVFFLEPGLR
Ga0209577_1082416923300026552SoilEDVRHSRAAVTRAWIILAVLALFYLGWTLTVYFLEPGLR
Ga0209735_110349023300027562Forest SoilGEDVRHGRNALTRAWIVLAILIVIYLAWTLTVYFAEPGLR
Ga0268266_1144463523300028379Switchgrass RhizosphereHSRGAMTRAWVILAILVLFYLAWTLTVYFLEPGLR
Ga0307295_1004712113300028708SoilLVGYRDVGEEVRHSRRAQNRAWVILAVLVVLYLAWTLTVYFLEPGLR
Ga0307295_1011822113300028708SoilVRHSRSTLIRAWVILAVLMAFYLGWTLVIFFLEPGLR
Ga0307293_1009417323300028711SoilRHSRAGQTRAFVILGCLMLIYLGWTLVIYFLEPGLR
Ga0307313_1023276823300028715SoilRHSRPAIRRAWVILAVMALFYLGWTLIVYFLEPGLR
Ga0307307_1013161823300028718SoilRDVGEDVRHGRPAITRAWIILAVMAVLYLAWTLTVFFIEPGLR
Ga0307315_1014727223300028721SoilDIGPDARHSRGAVQRSWVILAVLVAIYLIWTLIVYFFEPGLR
Ga0307318_1001435613300028744SoilGYRDVGEQVRHSRRAQNRAWVILAVLVVLYLAWTLTVYFLEPGLR
Ga0307320_1012792923300028771SoilHSRRAVSRAWIIIALLGVLYLAWTLTVYFVEPGLR
Ga0307288_1010549823300028778SoilVRHSRPQMVRSWIILAVLVLLYFVWTLTVYFLEPGLR
Ga0307282_1005788423300028784SoilRHSRSTMIRAWVILAVLMAFYVGWTLVIFFLEPGLR
Ga0307323_1007185023300028787SoilVGYRDVGEEVRHSRRSEIRAWVILGVLVVLYLGWTLTVYFIEPGLR
Ga0307323_1007532423300028787SoilEDVRHSKRAVQRAWVILVVMALFYLAWTLIIYFLEPGLR
Ga0307290_1028562713300028791SoilGEDVRHSRSTMIRAWVILAVLMAFYVGWTLVIFFLEPGLR
Ga0307299_1012741423300028793SoilDVRHSRSAMTRAWVILAVLMALYLGWTLVVYFLEPGLR
Ga0307281_1034996423300028803SoilGYRDVGDVGEDVRHGRSALTRAWIVLAILIVIYLAWTLTIYFIEPGLR
Ga0307305_1008638113300028807SoilGYRDVGEDVRHSRKAIWRGWIILAVLMAFYLGWTLVVYFLEPGLR
Ga0307294_1000988223300028810SoilVGGDVRHSRPQMVRSWIILAVLVLLYFVWTLTVYFLEPGLR
Ga0307292_1020283523300028811SoilVRHSRPARIRAWVILALIALLYVAWTLTVYFIEPGLR
Ga0307310_1048272213300028824SoilHSRGAVSRAWIILAILALVYLGWTLTVYFLEPGLR
Ga0307312_1119172513300028828SoilRDVGEDVRHSRSTMIRAWVILAVLMAFYVGWTLVIFFLEPGLR
Ga0307314_1005362413300028872SoilHSRPQIVRAWLILAFLIVLYIGWTLTVYFLEPGLR
Ga0307289_1014857013300028875SoilDIRHGRSAITRAWIVLAILIVIYLAWTLTVYFLEPGLR
Ga0307278_1007501623300028878SoilVGEDVRHSRKAVSRAWVILAIMALLYLGWTLTVYFIEPGLR
Ga0307300_1000930313300028880SoilGYRDIGEDVRWSRRAVQRSWLVLALMVVIWLAWALTVYFIEPGLR
Ga0307300_1016277423300028880SoilRDVGEDIRHGRDALTRAWIVLAILIVIYLAWTLTIYFIEPGLR
Ga0307304_1010863623300028885SoilVGEDVRHSRPQIVRAWLILAFLAVLYLGWTLTVFFIEPGLR
Ga0308206_108294513300030903SoilDVGEDVRHSPRAVRKAWVILALLAAFYLAWTLTVYFLEPGLR
Ga0308190_109597513300030993SoilVRHTRGTVIRAWVILAAIALIYLGWTLTVYFLEPGLR
Ga0308190_112907213300030993SoilHGRDALTRAWIVLAILIVIYLAWTLTIYFIEPGLR
Ga0308189_1011792723300031058SoilRDVGEEVRHSRRAQNRAWVILAVLVVLYLAWTLTVYFLEPGLR
Ga0308194_1006733913300031421SoilGYRDVGEGIRHTRAAVTRAWIILVVIALVYLGWTLTIYFLEPGLR
Ga0307472_10222907723300032205Hardwood Forest SoilIRDSRSARVRSWVILACLMAIYLGWTLVIYFLEPGLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.