Basic Information | |
---|---|
Family ID | F060694 |
Family Type | Metagenome |
Number of Sequences | 132 |
Average Sequence Length | 38 residues |
Representative Sequence | VRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 62.88 % |
% of genes near scaffold ends (potentially truncated) | 12.12 % |
% of genes from short scaffolds (< 2000 bps) | 85.61 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.485 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.697 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.515 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF12773 | DZR | 16.67 |
PF00334 | NDK | 12.12 |
PF08245 | Mur_ligase_M | 5.30 |
PF02545 | Maf | 3.79 |
PF10458 | Val_tRNA-synt_C | 3.03 |
PF08241 | Methyltransf_11 | 2.27 |
PF08264 | Anticodon_1 | 0.76 |
PF00583 | Acetyltransf_1 | 0.76 |
PF08397 | IMD | 0.76 |
PF08545 | ACP_syn_III | 0.76 |
PF04280 | Tim44 | 0.76 |
PF01323 | DSBA | 0.76 |
PF00005 | ABC_tran | 0.76 |
PF00144 | Beta-lactamase | 0.76 |
PF02749 | QRPTase_N | 0.76 |
PF06723 | MreB_Mbl | 0.76 |
PF12911 | OppC_N | 0.76 |
PF02653 | BPD_transp_2 | 0.76 |
PF04093 | MreD | 0.76 |
PF00119 | ATP-synt_A | 0.76 |
PF04166 | PdxA | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 12.12 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.79 |
COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.76 |
COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.76 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.76 |
COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.76 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.76 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.76 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.76 |
COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.48 % |
Unclassified | root | N/A | 1.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090008|P3_DRAFT_NODE_36906_len_2726_cov_20_373074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2776 | Open in IMG/M |
3300000956|JGI10216J12902_104380859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300001537|A2065W1_10607817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
3300001686|C688J18823_10945162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300004480|Ga0062592_101814240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300005186|Ga0066676_10068524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2074 | Open in IMG/M |
3300005526|Ga0073909_10209023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
3300005526|Ga0073909_10306182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300005526|Ga0073909_10348328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300005534|Ga0070735_10014501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5870 | Open in IMG/M |
3300005540|Ga0066697_10216471 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300005552|Ga0066701_10215416 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300005553|Ga0066695_10192592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
3300005556|Ga0066707_10538427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300005614|Ga0068856_101785695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300005713|Ga0066905_101092280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300005764|Ga0066903_100029049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6191 | Open in IMG/M |
3300005764|Ga0066903_100633769 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300005764|Ga0066903_101122427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1452 | Open in IMG/M |
3300005764|Ga0066903_102532710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 994 | Open in IMG/M |
3300005844|Ga0068862_101005223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300005844|Ga0068862_102514461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300005985|Ga0081539_10001713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 35164 | Open in IMG/M |
3300006032|Ga0066696_10251370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1142 | Open in IMG/M |
3300006032|Ga0066696_11006220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300006046|Ga0066652_100189031 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
3300006806|Ga0079220_12117175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300006854|Ga0075425_101744027 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300009012|Ga0066710_101291343 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300009012|Ga0066710_101676773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 969 | Open in IMG/M |
3300009012|Ga0066710_104445600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300009088|Ga0099830_10274081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
3300009089|Ga0099828_11010077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300009090|Ga0099827_10002177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10733 | Open in IMG/M |
3300009090|Ga0099827_10184748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1726 | Open in IMG/M |
3300009098|Ga0105245_11537668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300009137|Ga0066709_100174819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2786 | Open in IMG/M |
3300009137|Ga0066709_101279970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1077 | Open in IMG/M |
3300009137|Ga0066709_101281291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1076 | Open in IMG/M |
3300009137|Ga0066709_103893085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300009176|Ga0105242_11468450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300009545|Ga0105237_12235915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300009789|Ga0126307_10002936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11599 | Open in IMG/M |
3300009789|Ga0126307_10003674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10526 | Open in IMG/M |
3300009840|Ga0126313_10224952 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300010036|Ga0126305_10473740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300010037|Ga0126304_11077239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300010039|Ga0126309_10579324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300010039|Ga0126309_11061553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300010044|Ga0126310_11416069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300010044|Ga0126310_11517626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300010166|Ga0126306_10779239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300010360|Ga0126372_11221614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
3300010375|Ga0105239_10981273 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300011119|Ga0105246_11032095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300012011|Ga0120152_1026460 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
3300012011|Ga0120152_1030435 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300012096|Ga0137389_10965379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
3300012201|Ga0137365_11082379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300012204|Ga0137374_10000925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32275 | Open in IMG/M |
3300012204|Ga0137374_10008416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12202 | Open in IMG/M |
3300012204|Ga0137374_10030676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5884 | Open in IMG/M |
3300012204|Ga0137374_10697230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
3300012204|Ga0137374_10928248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300012204|Ga0137374_11054488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300012209|Ga0137379_10748885 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300012210|Ga0137378_10405915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
3300012212|Ga0150985_106066265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
3300012212|Ga0150985_122550462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2507 | Open in IMG/M |
3300012285|Ga0137370_10857862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300012349|Ga0137387_10751567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300012350|Ga0137372_10007077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10859 | Open in IMG/M |
3300012350|Ga0137372_10033238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4712 | Open in IMG/M |
3300012350|Ga0137372_10331021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1171 | Open in IMG/M |
3300012353|Ga0137367_11213456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
3300012469|Ga0150984_110154786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300012901|Ga0157288_10273055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300012902|Ga0157291_10224385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300012922|Ga0137394_11553165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300012958|Ga0164299_10812479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300012961|Ga0164302_11674356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300012972|Ga0134077_10149104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300012984|Ga0164309_11606217 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300013296|Ga0157374_12134926 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300013501|Ga0120154_1021836 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300015264|Ga0137403_10727866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 851 | Open in IMG/M |
3300015265|Ga0182005_1118127 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300015358|Ga0134089_10445628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300015371|Ga0132258_11329492 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300015371|Ga0132258_12437576 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300015371|Ga0132258_13964316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
3300015372|Ga0132256_102556098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300015373|Ga0132257_102408107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300015373|Ga0132257_103934563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
3300015373|Ga0132257_104526749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300018027|Ga0184605_10116958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
3300018061|Ga0184619_10338896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300018071|Ga0184618_10137028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
3300018072|Ga0184635_10163021 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300018431|Ga0066655_10948458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300018468|Ga0066662_10525460 | Not Available | 1086 | Open in IMG/M |
3300018468|Ga0066662_11151105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
3300022756|Ga0222622_10143980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
3300024187|Ga0247672_1046110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
3300024330|Ga0137417_1410347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2052 | Open in IMG/M |
3300025915|Ga0207693_11475708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300025929|Ga0207664_10823839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300025936|Ga0207670_10968337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300025939|Ga0207665_10502296 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300025986|Ga0207658_11595201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 597 | Open in IMG/M |
3300026075|Ga0207708_10810353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 806 | Open in IMG/M |
3300026313|Ga0209761_1149441 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300026324|Ga0209470_1278391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300026524|Ga0209690_1104852 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300026550|Ga0209474_10632114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300027821|Ga0209811_10305478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300027862|Ga0209701_10208157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
3300027874|Ga0209465_10669370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300027882|Ga0209590_10001972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 8092 | Open in IMG/M |
3300027882|Ga0209590_10132933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
3300027986|Ga0209168_10010729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5486 | Open in IMG/M |
3300028744|Ga0307318_10110082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300028824|Ga0307310_10755349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300028828|Ga0307312_10638508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300028878|Ga0307278_10258855 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300028885|Ga0307304_10554915 | Not Available | 530 | Open in IMG/M |
3300031543|Ga0318516_10810489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300031548|Ga0307408_101533339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300031890|Ga0306925_11961019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300031938|Ga0308175_100206209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1940 | Open in IMG/M |
3300031996|Ga0308176_12326795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300033004|Ga0335084_10618307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.58% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.55% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.03% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_DRAFT_00937580 | 2088090008 | Soil | VHSWKERLAVFAFALAVITSIVAVAFATGYIIGKLIL |
JGI10216J12902_1043808592 | 3300000956 | Soil | VQGWGERLAVLGFAAALLAAFVGLSFALGYIIGRLIL* |
A2065W1_106078172 | 3300001537 | Permafrost | VHSWKERLAVFAFALAVITGIVAVAFATGYIIGKLIL* |
C688J18823_109451622 | 3300001686 | Soil | VQQTWGERLAVFVFALALLAGLIGVTFAAGYIIGRLIL* |
Ga0062592_1018142402 | 3300004480 | Soil | GKVRQTWGERLAVFTFALALLAGIVGVSFAAGYIIGKLIL* |
Ga0066676_100685242 | 3300005186 | Soil | VVQQTWGERLAVFVFALALLAGIIGVTFAAGYIIGRLIL* |
Ga0073909_102090231 | 3300005526 | Surface Soil | VRQTWGQRLAVFAFALALLAGIVGASFAAGYIIGKLIL* |
Ga0073909_103061822 | 3300005526 | Surface Soil | MHQTWGERLAVFAFAFLLLAGVVGVTFAAGYIIGRLIL* |
Ga0073909_103483282 | 3300005526 | Surface Soil | VQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKLIL* |
Ga0070735_100145016 | 3300005534 | Surface Soil | MRTTWGERLAVFAFALAVVAAIVGAAFAAGYIIGRLIL* |
Ga0066697_102164712 | 3300005540 | Soil | VRQTWGERLAVFVFALALVAGIVGVSFAAGYIIGRLIL* |
Ga0066701_102154161 | 3300005552 | Soil | VRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL* |
Ga0066695_101925921 | 3300005553 | Soil | NEKVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL* |
Ga0066707_105384271 | 3300005556 | Soil | VRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGRLIL* |
Ga0068856_1017856952 | 3300005614 | Corn Rhizosphere | VQQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0066905_1010922802 | 3300005713 | Tropical Forest Soil | MHQTWGERLAVFAFALLLLAGLVGVTFAAGYIIGRLIL* |
Ga0066903_1000290494 | 3300005764 | Tropical Forest Soil | MHQTWGQRLAVFAFAFAILAGVVGVTFAAGYIIGRLIL* |
Ga0066903_1006337694 | 3300005764 | Tropical Forest Soil | MHQTWGERLAVFAFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0066903_1011224272 | 3300005764 | Tropical Forest Soil | MHQTWGERLAVFAFALAILAGLVGVTFAAGYIIGRLIL* |
Ga0066903_1025327102 | 3300005764 | Tropical Forest Soil | MHQTWGERLAVFGFAFLLLAGVVGVTFAAGYIIGRLIL* |
Ga0068862_1010052232 | 3300005844 | Switchgrass Rhizosphere | VRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL* |
Ga0068862_1025144612 | 3300005844 | Switchgrass Rhizosphere | VHSWKERLSVFAFALAVVAAIVGAAFATGYIIGKLIL* |
Ga0081539_1000171326 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VQDWSERLAVLGFALALLAAFVGLSFAVGYIIGKLIL* |
Ga0066696_102513702 | 3300006032 | Soil | MRTTWGERLAVFAFAAAVLAAIVGAAFAAGYIIGKLIL* |
Ga0066696_110062201 | 3300006032 | Soil | VRQSWGDRIAVFAFALAVVAAIVGISFAAGYIIGKLIL* |
Ga0066652_1001890312 | 3300006046 | Soil | VQQTWGERLAVFFFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0079220_121171752 | 3300006806 | Agricultural Soil | WGERLAVFGFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0075425_1017440272 | 3300006854 | Populus Rhizosphere | VRQTWGDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL* |
Ga0066710_1012913433 | 3300009012 | Grasslands Soil | VRQSWGDRLAVFAFALAVVAAIVGISFAAGYIIGKLIL |
Ga0066710_1016767732 | 3300009012 | Grasslands Soil | VRQTWGERLAVFVFALALVAGIVGVSFAAGYIIGRLIL |
Ga0066710_1044456002 | 3300009012 | Grasslands Soil | VRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL |
Ga0099830_102740812 | 3300009088 | Vadose Zone Soil | VRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGKLIL* |
Ga0099828_110100772 | 3300009089 | Vadose Zone Soil | VRQSWGERLAVFVFALAVVAAIVGVAFAAGYIIGKLIL* |
Ga0099827_100021779 | 3300009090 | Vadose Zone Soil | VRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGKLIL* |
Ga0099827_101847482 | 3300009090 | Vadose Zone Soil | VRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGRLIL* |
Ga0105245_115376681 | 3300009098 | Miscanthus Rhizosphere | HVRQTWGQRFAVFAFALALLALIVGASFAAGYIIGRLIL* |
Ga0066709_1001748192 | 3300009137 | Grasslands Soil | VRQSWGDRLAVFAFALAVVAAIVGISFAAGYIIGKLIL* |
Ga0066709_1012799702 | 3300009137 | Grasslands Soil | VRQSWGERLAVLAFALALLGAIVGVAFAAGYIIGKLIL* |
Ga0066709_1012812912 | 3300009137 | Grasslands Soil | MRQRRSRLGVLAFATAALLAIVGLAFAAGYIIGKLVL* |
Ga0066709_1038930851 | 3300009137 | Grasslands Soil | VESWKERLAVFAFALGVITAIVVVAFAAGYIIGKLIL* |
Ga0105242_114684502 | 3300009176 | Miscanthus Rhizosphere | VQQTWGERLAVFAFALAILAGLVGVTFAAGYIIGRLIL* |
Ga0105237_122359151 | 3300009545 | Corn Rhizosphere | NEVVRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL* |
Ga0126307_100029363 | 3300009789 | Serpentine Soil | VQTWGERLAVLAFALTLLAAFVGLSFAVGYIIGRLIL* |
Ga0126307_100036748 | 3300009789 | Serpentine Soil | VQTWGERLTVLAFALALLVAFVGLSFAAGYIIGRLIL* |
Ga0126313_102249523 | 3300009840 | Serpentine Soil | VQQTWGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL* |
Ga0126305_104737401 | 3300010036 | Serpentine Soil | VQTWGERLAVLAFALTLLAAFVGLSFAAGYIIGRLIL* |
Ga0126304_110772392 | 3300010037 | Serpentine Soil | VQTWGERLTVLAFALALLAAFVGLSFAGGYIIGRLIL* |
Ga0126309_105793242 | 3300010039 | Serpentine Soil | VQTWGERLAVLAFALTLLVGFVGLSFAAGYIIGRLIL* |
Ga0126309_110615532 | 3300010039 | Serpentine Soil | QTWGQRLAVFTFALALLGGIVGVSFAAGYIIGKLIL* |
Ga0126310_114160692 | 3300010044 | Serpentine Soil | VRQTWGQRLAVFTFALALLTGIVGVSFAAGYIIGKLIL* |
Ga0126310_115176262 | 3300010044 | Serpentine Soil | VQTWGERLGVLAFAVVLLAAFVGVSFATGYIIGRLIL* |
Ga0126306_107792392 | 3300010166 | Serpentine Soil | VQTWGERLAVLAFALALLAAFVGLSFAAGYIIGRLIL* |
Ga0126372_112216141 | 3300010360 | Tropical Forest Soil | VRHTWGERIAVFAFAIALVAAIVGASFAAGYIIGRLIL* |
Ga0105239_109812732 | 3300010375 | Corn Rhizosphere | VHQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0105246_110320951 | 3300011119 | Miscanthus Rhizosphere | RQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL* |
Ga0120152_10264604 | 3300012011 | Permafrost | VRQTWRERLAVFMFAVAFIAAIVGISFAAGYIIGKLIL* |
Ga0120152_10304352 | 3300012011 | Permafrost | VQSWKERLAVFAFALGLITGIVVVAFAAGYIIGKLIL* |
Ga0137389_109653792 | 3300012096 | Vadose Zone Soil | VRQSWGERLAVFAFALAVVAAIVGVAFAAGYRIGRLIL* |
Ga0137365_110823792 | 3300012201 | Vadose Zone Soil | VQQTWGERLAVFAFALALLAGLVGVTFAAGFLIGRILL* |
Ga0137374_1000092521 | 3300012204 | Vadose Zone Soil | VHGWGDRLAVLGFALALLAAFVGLSFTVGYIIGKLIL* |
Ga0137374_1000841612 | 3300012204 | Vadose Zone Soil | MRTTWGERLAVFAFALAVLFAIVGAAFAAGYIIGKLIL* |
Ga0137374_100306764 | 3300012204 | Vadose Zone Soil | VQTWGERLGVLAFALVLLGAFVGLSFATGYIIGRLIL* |
Ga0137374_106972302 | 3300012204 | Vadose Zone Soil | VRQTWGERLAVFGFALALLAGIVGVSFAAGYIIGKLIL* |
Ga0137374_109282482 | 3300012204 | Vadose Zone Soil | VRQTWGERLAVFAFALALLAGIVGVSFAAGYIIGRIIL* |
Ga0137374_110544882 | 3300012204 | Vadose Zone Soil | VQTWGERLGVLAFALVLLAAFVGLSFATGYIIGRLIL* |
Ga0137379_107488851 | 3300012209 | Vadose Zone Soil | VRQSWGERLAVFAFALAVVAAIVGISFAAGYIIGKLIL* |
Ga0137378_104059153 | 3300012210 | Vadose Zone Soil | VESWKERLAVFAFALGLITGIVVVAFAAGYIIGKLIL* |
Ga0150985_1060662654 | 3300012212 | Avena Fatua Rhizosphere | WGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL* |
Ga0150985_1225504622 | 3300012212 | Avena Fatua Rhizosphere | VRQTWGDRLAVFAFALCVVAAIVGISFAAGYIIGKLIL* |
Ga0137370_108578621 | 3300012285 | Vadose Zone Soil | AVRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL* |
Ga0137387_107515671 | 3300012349 | Vadose Zone Soil | VRQTWGQRLAVFAFALALMAGIVGVSFAAGYIIGRLIL* |
Ga0137372_100070779 | 3300012350 | Vadose Zone Soil | VRQTWGQRLAVFTFALALLAGIVGVSFAAGYIIGKLIL* |
Ga0137372_100332386 | 3300012350 | Vadose Zone Soil | VRQSWGERLAVFAFALAVLAAIVGASFAAGYIIGKLIL* |
Ga0137372_103310212 | 3300012350 | Vadose Zone Soil | MRQTWGERVAVFVFALALLAAIVGVSFAAGYIIGKLIL* |
Ga0137367_112134562 | 3300012353 | Vadose Zone Soil | VRQSWGERLAVFAFALAVLAAIVGFSFAAGYIIGKLIL* |
Ga0150984_1101547861 | 3300012469 | Avena Fatua Rhizosphere | VRQTWGERLAVFAFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0157288_102730552 | 3300012901 | Soil | VRQTWRERLEVFTFGLALLAGIVGVSFAAGYIIGKLIL* |
Ga0157291_102243852 | 3300012902 | Soil | VRQTWGDRLVVFAFALGLIAAIVGISFGAGYIIGRLIL* |
Ga0137394_115531652 | 3300012922 | Vadose Zone Soil | VQSWKERLAVFGFALAVITAIVVVAFAAGYIIGKLIL* |
Ga0164299_108124791 | 3300012958 | Soil | VHGWGERLGVLAFALALLAGLVGLSFAAGYIIGKLIL* |
Ga0164302_116743562 | 3300012961 | Soil | VRQTWGERLAVFTFALFLLAAIVGISFAAGYIIGKLIL* |
Ga0134077_101491043 | 3300012972 | Grasslands Soil | VVQQTWGERVAVFAFALALLAGIIGVTFAAGYIIGRLIL* |
Ga0164309_116062172 | 3300012984 | Soil | VQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKL |
Ga0157374_121349262 | 3300013296 | Miscanthus Rhizosphere | VRGWSDRLSVLGFAFALVLALVGLSFAVGYIIGKLIL* |
Ga0120154_10218362 | 3300013501 | Permafrost | VHTWGERLAIFAFALAVVAAIVVAAFAAGYIIGKLIL* |
Ga0137403_107278663 | 3300015264 | Vadose Zone Soil | SWKERLAVFAFALAVITAIVVVAFAAGYIIGKLIL* |
Ga0182005_11181272 | 3300015265 | Rhizosphere | VQQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLFL* |
Ga0134089_104456282 | 3300015358 | Grasslands Soil | VRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL* |
Ga0132258_113294921 | 3300015371 | Arabidopsis Rhizosphere | VRQTWGDHLVVFAFALGLIAAIVGISSGAGYIIGRLIL* |
Ga0132258_124375764 | 3300015371 | Arabidopsis Rhizosphere | VRHTWGERVAVFVFAIALVAAIVGASFAAGYIIGRLIL* |
Ga0132258_139643162 | 3300015371 | Arabidopsis Rhizosphere | VRQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL* |
Ga0132256_1025560982 | 3300015372 | Arabidopsis Rhizosphere | VQQTWGERLAVFAFALAILAGLVGATFAAGYIIGRLIL* |
Ga0132257_1024081072 | 3300015373 | Arabidopsis Rhizosphere | VRQTWGERLAVFTFALFLLAAIVGISFAAGYIIGRLIL* |
Ga0132257_1039345632 | 3300015373 | Arabidopsis Rhizosphere | NPAVQGWSERLAVLAFALALLAAFVGLSFAVGYIIGKLIL* |
Ga0132257_1045267492 | 3300015373 | Arabidopsis Rhizosphere | VRQSWGDRLVVFAFALGVIAAIVGISFGAGYIIGRLIL* |
Ga0184605_101169583 | 3300018027 | Groundwater Sediment | VRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLLL |
Ga0184619_103388962 | 3300018061 | Groundwater Sediment | VHSWGERLAVLAFALALLGAIVGLFFTAGYIIGKLIL |
Ga0184618_101370283 | 3300018071 | Groundwater Sediment | VRQTWGERLAVFAFALALIAGIVGVSFAAGYIIGRLIL |
Ga0184635_101630212 | 3300018072 | Groundwater Sediment | VRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGKLIL |
Ga0066655_109484582 | 3300018431 | Grasslands Soil | VQQTWGERLAVFVFALALLAGIIGVTFAAGYIIGRLIL |
Ga0066662_105254601 | 3300018468 | Grasslands Soil | VRQTWGERLAVFTFALAVVAAIVAISFAAGYIIGKLI |
Ga0066662_111511052 | 3300018468 | Grasslands Soil | VRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL |
Ga0222622_101439802 | 3300022756 | Groundwater Sediment | VRQTWGDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL |
Ga0247672_10461102 | 3300024187 | Soil | MQQTWGQRLAVFAFAFAILAGVVGVTFAAGYIIGRLIL |
Ga0137417_14103473 | 3300024330 | Vadose Zone Soil | VQSWKERLAVFGFALGLITAIVVVAFAAGYIIGKLIL |
Ga0207693_114757082 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKLIL |
Ga0207664_108238393 | 3300025929 | Agricultural Soil | VRPTWGDRLAVFAFALGVVAAIVGISFGAGYIIGRLIL |
Ga0207670_109683372 | 3300025936 | Switchgrass Rhizosphere | VRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL |
Ga0207665_105022963 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VQQTWGERLAVFAFALALLAGLVGAMFAAGYIIGRLIL |
Ga0207658_115952012 | 3300025986 | Switchgrass Rhizosphere | VRQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL |
Ga0207708_108103531 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQTWGDRLVVFAFALGLIAAIVGISFGAGYIIGRLIL |
Ga0209761_11494411 | 3300026313 | Grasslands Soil | VRQTWGERLAVFTFALAVVAAIVGISFAAGYIIGKLIL |
Ga0209470_12783912 | 3300026324 | Soil | VRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL |
Ga0209690_11048521 | 3300026524 | Soil | KVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL |
Ga0209474_106321141 | 3300026550 | Soil | VRQSWGDRIAVFAFALAVVAAIVGISFAAGYIIGKLIL |
Ga0209811_103054782 | 3300027821 | Surface Soil | MHQTWGERLAVFAFAFLLLAGVVGVTFAAGYIIGRLIL |
Ga0209701_102081572 | 3300027862 | Vadose Zone Soil | VRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGKLIL |
Ga0209465_106693701 | 3300027874 | Tropical Forest Soil | VRPTWGDRLAVFAFALGVVVAIVGISFGAGYIIGRLIL |
Ga0209590_100019724 | 3300027882 | Vadose Zone Soil | VRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGKLIL |
Ga0209590_101329333 | 3300027882 | Vadose Zone Soil | VRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGRLIL |
Ga0209168_100107293 | 3300027986 | Surface Soil | MRTTWGERLAVFAFALAVVAAIVGAAFAAGYIIGRLIL |
Ga0307318_101100822 | 3300028744 | Soil | VRQTWRDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL |
Ga0307310_107553491 | 3300028824 | Soil | VHSWRERLAIFAFALAVVAAIVGGAFAAGYIIGKLIL |
Ga0307312_106385081 | 3300028828 | Soil | VRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGR |
Ga0307278_102588552 | 3300028878 | Soil | VQGWGDRLAVLGFALALLAAFVGLSFTVGYIIGKLIL |
Ga0307304_105549151 | 3300028885 | Soil | VRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLLL |
Ga0318516_108104892 | 3300031543 | Soil | MHQTWGQRLAVFAFALAILAGVVGVTFAAGYIIGRLIL |
Ga0307408_1015333392 | 3300031548 | Rhizosphere | VQTWGERLTVLAFALALLVAFVGLSFAAGYIIGRLIL |
Ga0306925_119610191 | 3300031890 | Soil | VRHTWGERVAVFAFAIALVAAIVGASFAAGYIIGRLI |
Ga0308175_1002062092 | 3300031938 | Soil | VQQTWGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL |
Ga0308176_123267952 | 3300031996 | Soil | VRGWGDRLSVLGFALALIGAIVGLSFAAGYIIGKLIL |
Ga0335084_106183073 | 3300033004 | Soil | MRTTWGERLSVFAFALLVVAAIVGAAFAAGYIIGRLIL |
⦗Top⦘ |