NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060571

Metagenome / Metatranscriptome Family F060571

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060571
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 145 residues
Representative Sequence MKRNIFMLVGGLMLMSLCGCVTAMLTEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKFYATSSNPAESDKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEEIK
Number of Associated Samples 104
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 70.45 %
% of genes near scaffold ends (potentially truncated) 39.39 %
% of genes from short scaffolds (< 2000 bps) 76.52 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.455 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland
(12.121 % of family members)
Environment Ontology (ENVO) Unclassified
(51.515 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.848 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 18.78%    β-sheet: 35.91%    Coil/Unstructured: 45.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.3.6.0: automated matchesd3hhya_3hhy0.58467
b.7.1.0: automated matchesd3b7ya_3b7y0.58335
b.3.4.1: Transthyretin (synonym: prealbumin)d1f86a_1f860.56971
b.3.1.3: PUD-liked2j73a_2j730.5657
b.3.4.0: automated matchesd4q14a_4q140.5651


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00072Response_reg 1.52
PF03797Autotransporter 1.52
PF00359PTS_EIIA_2 1.52
PF00378ECH_1 1.52
PF01894UPF0047 1.52
PF13426PAS_9 0.76
PF04343DUF488 0.76
PF01817CM_2 0.76
PF00665rve 0.76
PF13396PLDc_N 0.76
PF02586SRAP 0.76
PF01842ACT 0.76
PF02457DAC 0.76
PF00589Phage_integrase 0.76
PF00005ABC_tran 0.76
PF01850PIN 0.76
PF14376Haem_bd 0.76
PF04909Amidohydro_2 0.76
PF06762LMF1 0.76
PF00498FHA 0.76
PF10114PocR 0.76
PF13358DDE_3 0.76
PF09994DUF2235 0.76
PF08240ADH_N 0.76
PF11867DUF3387 0.76
PF14371DUF4412 0.76
PF00483NTP_transferase 0.76
PF11074DUF2779 0.76
PF01527HTH_Tnp_1 0.76
PF01464SLT 0.76
PF13495Phage_int_SAM_4 0.76
PF01263Aldose_epim 0.76
PF13534Fer4_17 0.76
PF00106adh_short 0.76
PF00364Biotin_lipoyl 0.76
PF00472RF-1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 1.52
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.76
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.76
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.76
COG1605Chorismate mutaseAmino acid transport and metabolism [E] 0.76
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.76
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.76
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.76
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.76
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.76
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.76
COG4584TransposaseMobilome: prophages, transposons [X] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.45 %
UnclassifiedrootN/A4.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10000771All Organisms → cellular organisms → Bacteria24426Open in IMG/M
3300001213|JGIcombinedJ13530_101478084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium846Open in IMG/M
3300001213|JGIcombinedJ13530_101643663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium569Open in IMG/M
3300009009|Ga0105105_10026477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2478Open in IMG/M
3300009053|Ga0105095_10059197All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300009078|Ga0105106_10278661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1213Open in IMG/M
3300009091|Ga0102851_10522985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1224Open in IMG/M
3300009520|Ga0116214_1019292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2430Open in IMG/M
3300009522|Ga0116218_1057430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1766Open in IMG/M
3300009623|Ga0116133_1171149Not Available575Open in IMG/M
3300009657|Ga0116179_1163144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium773Open in IMG/M
3300009693|Ga0116141_10151357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1324Open in IMG/M
3300010340|Ga0116250_10447159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium740Open in IMG/M
3300010341|Ga0074045_10562110All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium730Open in IMG/M
3300010343|Ga0074044_10080598All Organisms → cellular organisms → Bacteria → Proteobacteria2199Open in IMG/M
3300010343|Ga0074044_10139871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1622Open in IMG/M
3300010343|Ga0074044_10656078Not Available685Open in IMG/M
3300010353|Ga0116236_10067649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium3646Open in IMG/M
3300010359|Ga0126376_10845171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium899Open in IMG/M
3300010379|Ga0136449_101068170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1289Open in IMG/M
3300014151|Ga0181539_1000229All Organisms → cellular organisms → Bacteria → Proteobacteria67614Open in IMG/M
3300014152|Ga0181533_1141079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1000Open in IMG/M
3300014156|Ga0181518_10220554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium976Open in IMG/M
3300014156|Ga0181518_10326671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium757Open in IMG/M
3300014158|Ga0181521_10238593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium967Open in IMG/M
3300014159|Ga0181530_10020993All Organisms → cellular organisms → Bacteria → Proteobacteria4975Open in IMG/M
3300014159|Ga0181530_10575811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium553Open in IMG/M
3300014162|Ga0181538_10125054All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300014165|Ga0181523_10468211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium698Open in IMG/M
3300014200|Ga0181526_10156093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1463Open in IMG/M
3300014201|Ga0181537_10180664All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1450Open in IMG/M
3300014490|Ga0182010_10009168All Organisms → cellular organisms → Bacteria → Proteobacteria4496Open in IMG/M
3300014493|Ga0182016_10001384All Organisms → cellular organisms → Bacteria29590Open in IMG/M
3300014494|Ga0182017_10090954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2003Open in IMG/M
3300014494|Ga0182017_10244402All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300014498|Ga0182019_10067055All Organisms → cellular organisms → Bacteria → Proteobacteria2118Open in IMG/M
3300014502|Ga0182021_10121613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3033Open in IMG/M
3300014502|Ga0182021_10634486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1279Open in IMG/M
3300014654|Ga0181525_10897562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium503Open in IMG/M
3300014657|Ga0181522_10354692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium874Open in IMG/M
3300014657|Ga0181522_10469982All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium756Open in IMG/M
3300014839|Ga0182027_10094133All Organisms → cellular organisms → Bacteria3623Open in IMG/M
3300014839|Ga0182027_10138773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2877Open in IMG/M
3300014839|Ga0182027_10220319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2188Open in IMG/M
3300014839|Ga0182027_10603756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1179Open in IMG/M
3300014839|Ga0182027_10707651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1066Open in IMG/M
3300017823|Ga0187818_10254841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium767Open in IMG/M
3300017925|Ga0187856_1155874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium857Open in IMG/M
3300017933|Ga0187801_10173355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium847Open in IMG/M
3300017934|Ga0187803_10053527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1592Open in IMG/M
3300017942|Ga0187808_10473249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium578Open in IMG/M
3300017943|Ga0187819_10215368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1130Open in IMG/M
3300017948|Ga0187847_10086159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1741Open in IMG/M
3300017959|Ga0187779_10562465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium760Open in IMG/M
3300017972|Ga0187781_10405388All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium973Open in IMG/M
3300017973|Ga0187780_10876822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium651Open in IMG/M
3300017974|Ga0187777_10211068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1310Open in IMG/M
3300018001|Ga0187815_10419096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium571Open in IMG/M
3300018006|Ga0187804_10002551All Organisms → cellular organisms → Bacteria5511Open in IMG/M
3300018007|Ga0187805_10198559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium916Open in IMG/M
3300018017|Ga0187872_10162142All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1060Open in IMG/M
3300018023|Ga0187889_10396332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium598Open in IMG/M
3300018034|Ga0187863_10147068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1315Open in IMG/M
3300018034|Ga0187863_10242862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1001Open in IMG/M
3300018034|Ga0187863_10434767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium733Open in IMG/M
3300018035|Ga0187875_10747348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium513Open in IMG/M
3300018042|Ga0187871_10468773Not Available696Open in IMG/M
3300018043|Ga0187887_10002699All Organisms → cellular organisms → Bacteria14074Open in IMG/M
3300018046|Ga0187851_10196179Not Available1201Open in IMG/M
3300018046|Ga0187851_10404946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium780Open in IMG/M
3300018047|Ga0187859_10640720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium601Open in IMG/M
3300018058|Ga0187766_10778676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium666Open in IMG/M
3300018060|Ga0187765_10039561All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium GWA2_39_152377Open in IMG/M
3300018062|Ga0187784_10139612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1979Open in IMG/M
3300018064|Ga0187773_11053788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium537Open in IMG/M
3300018085|Ga0187772_10532620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium831Open in IMG/M
3300018086|Ga0187769_10982525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium639Open in IMG/M
3300018086|Ga0187769_11115925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium597Open in IMG/M
3300018086|Ga0187769_11499045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium510Open in IMG/M
3300018088|Ga0187771_10961223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium725Open in IMG/M
3300018088|Ga0187771_11599770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium553Open in IMG/M
3300018090|Ga0187770_10203772All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300018090|Ga0187770_10808125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium751Open in IMG/M
3300019278|Ga0187800_1393379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium620Open in IMG/M
3300019785|Ga0182022_1057064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1303Open in IMG/M
3300022650|Ga0236339_1243325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium579Open in IMG/M
3300023311|Ga0256681_10050184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium893Open in IMG/M
3300027497|Ga0208199_1017848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1597Open in IMG/M
3300027568|Ga0208042_1001675All Organisms → cellular organisms → Bacteria7047Open in IMG/M
3300027713|Ga0209286_1328362All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium528Open in IMG/M
3300027902|Ga0209048_10018863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae6014Open in IMG/M
3300027902|Ga0209048_10026137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales5002Open in IMG/M
3300028556|Ga0265337_1047402All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1218Open in IMG/M
3300028563|Ga0265319_1088713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium977Open in IMG/M
3300028573|Ga0265334_10065106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1368Open in IMG/M
3300028573|Ga0265334_10300292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium550Open in IMG/M
3300028577|Ga0265318_10117492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium977Open in IMG/M
3300028653|Ga0265323_10274046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium523Open in IMG/M
3300028800|Ga0265338_10011815All Organisms → cellular organisms → Bacteria10035Open in IMG/M
3300028800|Ga0265338_10141800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1881Open in IMG/M
3300028800|Ga0265338_10371935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1023Open in IMG/M
3300028909|Ga0302200_10103197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1541Open in IMG/M
3300029911|Ga0311361_10231121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2207Open in IMG/M
3300029990|Ga0311336_10824983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium800Open in IMG/M
3300029998|Ga0302271_10542815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium503Open in IMG/M
3300030002|Ga0311350_10646765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium950Open in IMG/M
3300030019|Ga0311348_10979131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium630Open in IMG/M
3300030114|Ga0311333_10690144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium851Open in IMG/M
3300031240|Ga0265320_10490272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium543Open in IMG/M
3300031241|Ga0265325_10129693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1208Open in IMG/M
3300031249|Ga0265339_10471189Not Available582Open in IMG/M
3300031344|Ga0265316_10018397All Organisms → cellular organisms → Bacteria6005Open in IMG/M
3300031344|Ga0265316_10856562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium636Open in IMG/M
3300031524|Ga0302320_10260143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2369Open in IMG/M
3300032770|Ga0335085_10271343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium2027Open in IMG/M
3300032783|Ga0335079_10843643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium946Open in IMG/M
3300032805|Ga0335078_10186419All Organisms → cellular organisms → Bacteria2897Open in IMG/M
3300032805|Ga0335078_10491850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1579Open in IMG/M
3300032805|Ga0335078_11020356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium977Open in IMG/M
3300032805|Ga0335078_12299093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium564Open in IMG/M
3300032892|Ga0335081_12179450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium584Open in IMG/M
3300032893|Ga0335069_10994287Not Available932Open in IMG/M
3300032897|Ga0335071_10709860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium955Open in IMG/M
3300032897|Ga0335071_11379343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium649Open in IMG/M
3300032898|Ga0335072_10825703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium882Open in IMG/M
3300032955|Ga0335076_10705290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium891Open in IMG/M
3300033134|Ga0335073_10162763All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2813Open in IMG/M
3300033402|Ga0326728_10052132All Organisms → cellular organisms → Bacteria5932Open in IMG/M
3300033405|Ga0326727_10760673All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium757Open in IMG/M
3300033433|Ga0326726_10042166All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3986Open in IMG/M
3300033480|Ga0316620_10601760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium1032Open in IMG/M
3300034090|Ga0326723_0058001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea toluenoxydans1644Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland12.12%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog10.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere10.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.85%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen9.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.03%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil3.03%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.03%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.03%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.03%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge3.03%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.52%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.76%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009657Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaGEngineeredOpen in IMG/M
3300009693Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaGEngineeredOpen in IMG/M
3300010340AD_USOAcaEngineeredOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300022650Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1000077123300000567Peatlands SoilMKRKMFILLGGLMLMFLCGCVASMLTEQAANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDHVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE*
JGIcombinedJ13530_10147808423300001213WetlandMKRNIFMLVGVLMLMSLCGCVTTMLTEQAANQAAPATVEKFSYDVSTPGADVGTLMVQTRQPSYQMSVEKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKFYATSSNPAESDTVTFGKPNDKDIVVTKNRELKLKYIGPYRLLGSGSVEEIK*
JGIcombinedJ13530_10164366313300001213WetlandMKRNLIMLVGGLMLMSLSGCVTAMLTEQAANQATPPTVEPFSFDVSTPGADAGTLMVQTRQPSYQLSVEKYAIKIDSHVPLVVSKQSDVTIKLDAGTHTLKFYATSSNPAESDRVTFGKAHDKDVVITKDQELKLKYIGPYRLLGSGHVEELE*
Ga0105105_1002647713300009009Freshwater SedimentMQTKRNAFMLAGGLMFVALGGCVATMVGEQAANQVAPPQVETFSFDVSTPGASVGTLMVQTRQPSYQLAVEKYAIKIDSHAPLVVSKQSDVKIRLNAGRHALSFYATASDPAESEKVTFGKPYVKDVVIANNEVLKLRFTGPYRLLGSGDVEEIK*
Ga0105095_1005919733300009053Freshwater SedimentGEQAANQVAPPQVETFSFDVSTPGASVGTLMVQTRQPSYQLAVEKYAIKIDSHAPLVVSKQSDVTIRLNAGRHALSFYATASDPAESEKVTFGKPYDKDVVIANNEVLKLRFTGPYRLLGSGDVEEIK*
Ga0105106_1027866113300009078Freshwater SedimentMQTKRNAFMLAGGLMLVALGGCVATMVGEQAANQVAPPQVETFSFDVSTPGASVGTLMVQTRQPSYQLAVEKYAIKIDSHAPLVVSKQSDVTIRLNAGRHALSFYATASDPAESEKVTFGKPYDKDVVIANNEVLKLRFTGPYRLLGSGDVEEIK*
Ga0102851_1052298533300009091Freshwater WetlandsMKRNIFMLVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTLGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVAIKLNAGKHSLKFYATSSNPSESEKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEDIK*
Ga0116214_101929243300009520Peatlands SoilMLTEQAANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDHVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0116218_105743023300009522Peatlands SoilMLTEQAANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDQVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0116133_117114913300009623PeatlandLVSGLMLVSVCGCVTSLLVEQAANQAAPPTVEQSSFDVSTAGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIWHQPS*
Ga0116179_116314413300009657Anaerobic Digestor SludgeMNTKKTAYGLAGGLMLLALGGCVATMVSEQAANQVAPPSVETFSFDVSTPGAGVGTLLIQTRQPSYQLAVERYAIRIDDRAPLVVAKQSDVTIRLNAGRHALSFYATAADPAESSKVTFGKPSDTEVVIAN
Ga0116141_1015135713300009693Anaerobic Digestor SludgeMNTRKTAYGLAGGLMLLALGGCVATMVSEQAANQVAPPSVETFSFDVSTPGAGVGTLLVQTRQPSYQLAVERYAIRIDDRAPLVVAKQSDVTIRLNAGRHALHLYATAADPAESGKVTFGKPSDTEVVIANNDVLKLRYT
Ga0116250_1044715923300010340Anaerobic Digestor SludgeAYGLAGGLMLLALGGCVATMVSEQAANQVAPPSVETFSFDVSTPGAGVGTLLIQTRQPSYQLAVERYAIRIDDRAPLVVAKQSDVTIRLNAGRHALSFYATAADPAESSKVTFGKPSDTEVVIANNEVLKLRYTGSYRLLGAGNVEELK*
Ga0074045_1056211023300010341Bog Forest SoilMKRKIFMLFAGLMLMSLCGCLTTMVTQQAANQVAPPKVQNFSFDVSTSGADVGTLFVQTRQPSYQMAVAKYAIKIDSNPPLVVEKQSDVTIKINAGQHSLKFYGTSDNPAESDKVVWGEPHKKDIVIAKDQVLKLKYTGPYRMFGSGNVEEIK*
Ga0074044_1008059833300010343Bog Forest SoilMQMKRKMFILLGGLMLMFLCGCVASMLTEQAANQVAPPTVDKSSFDVSTPGADVGTLMVQTRQPSYQLVVNKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDQVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0074044_1013987133300010343Bog Forest SoilMKRNIFMLVGGLMLMSLCGCVTAMLTEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKFYATSSNPAESDKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEEIK*
Ga0074044_1065607823300010343Bog Forest SoilMQMKRKLFIPVGALMLMSLSGCVASMLTEQAANQVAPPTVETFSFDVSTPGADAGTLMVQTRQPSYQLVVDKYAIKIDSHAPLVVSKQSDVTIKLNAGTHSLKCYATSSDPAESDKVSFGEPNNKDIVITKGQELKLKY
Ga0116236_1006764913300010353Anaerobic Digestor SludgeMNTRKTAYGLAGGLMLLALGGCVATMVSEQAANQVAPPSVETFSFDVSTPGAGVGTLLVQTRQPSYQLAVERYAIRIDDRAPLVVAKQSDVTIRLNAGRHALHLYATAADPAESGKVTFGKPSDTEVVIANNDVLKLRYTGPYRLLGAGNVEELK*
Ga0126376_1084517113300010359Tropical Forest SoilMKRNLLMLVCGLMLTSLCGCVTAMLTEQAANQAAPPAVEQFSFDVSVPAADVGTLMVQTRQPSYQLSVEKYAIKIDTNAPMVVAKQSDVTIKLNTGQHALKFYATSSDPAQSDKVTFGRTHEKEIVITKDQELKLKYIGPYRLLGSGHVEEMQ*
Ga0136449_10106817013300010379Peatlands SoilMELKRNISMLVGGLMLVSLCGCVASMLTEQAANQVAPPAVDKFSFDVSTPEAAVGTLMVQTRQPSYQLVVDKYAIKIDSNSPLVVSKQSDVTIKLNAGKHSLKFYATSSNPAESDQITFGEPNNKDIVITKDQELKLKYTGPYRLFGSGNVGEIK*
Ga0181539_1000229323300014151BogMITEQAANQVAPPTVETFSFDVSTPGSDIGTLMVQTRQPSYQLAVDKYAIKIDSNPALVVSKQSDVTIKLNAGTHSVKCYATSSNPAESDHVTFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSLEEIQ*
Ga0181533_114107923300014152BogMQMKRKMFIPVGALMLLSLCGCVASMLTEQAANQVAPPTVENFSFDVSTAGADVGTLMVQTRQPSYQLAVDKYAIKIDSHAPLVVSKQSDVAIKLNAGKHSLKCYATSSNPAESDQVTFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0181518_1022055423300014156BogMQMKRKMFILVGGLMLMSLCGCVASMLSEQAANQVAPPTVDKFSFDVSAAGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPNNKDVVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0181518_1032667113300014156BogMKRNIITLAGGLMLMFLCGCVATMLSEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVEKYAIKIDTNAPLIVSKQSDVTIKLDVGKHALKFYATSSNPAESDQVTFGEPHKKDIVIIKDQELKLKYIGPYRLLGSGNLEEIK*
Ga0181521_1023859323300014158BogMKRKMFILVGGLMLMSLCGCVASMLSEQAANQVAPPTVDKFSFDVSTAGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHFLKCYATSSNPAESDQVSFGEPNNKDVVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0181530_1002099343300014159BogMQMKRKMFILVGGLMLMSLCGCVASMLSEQAANQVAPPTVDKFSFDVSTAGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPNNKDVVITKGQELKLKYTGPYRLLGSGSVEEIE*
Ga0181530_1057581113300014159BogLSEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVEKYAIKIDTNAPLIVSKQSDVTIKLDVGKHALKFYATSSNPAESNQVTFGEPHKKDIVIIKDQELKLKYIGPYRLLGSGNLEEIK*
Ga0181538_1012505423300014162BogMQMKRKMFILVGGLMLMSLSGCVASMLSEQAANQVAPPTVDKFSFDVSTAGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPNNKDVVITKGQELKLKYTGPYRLLGSGSVEEID*
Ga0181523_1046821123300014165BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSEPGESDKVAYGRSYNKDIVITKEQELKLKYTGPYRLLGSG
Ga0181526_1015609313300014200BogMLVSLCGCVTSLLVEQAANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGSHSLMFYAASSEPGESDKVAYGRSYNRDIVITKGQELKLKYTGPYRLLGT
Ga0181537_1018066423300014201BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIWHQPS*
Ga0182010_1000916823300014490FenMKRNRFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSLEEIK*
Ga0182016_10001384303300014493BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQTVPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLTFYAASSQPGESDNVAYGRAYNKAIVITKDQELRLKYTGPYRLLGSGKVEEIK*
Ga0182017_1009095413300014494FenMKRNLFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSLEEIK*
Ga0182017_1024440213300014494FenLMLVSLCGCVTSLLVEQASNQTAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSQPGESDKVAYGRPNNKVIVITKDQELKLKYTGPYRLLGSGKVEEIK*
Ga0182019_1006705523300014498FenMKRNIFILVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVAIKLNAGKHSLKFYATSSNPSESEKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEYIK*
Ga0182021_1012161313300014502FenMKRILFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLLVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSLEEIK*
Ga0182021_1063448623300014502FenMKRNIFMLVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTPGADIGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVAIKLNAGKHSLKFYATSSNPSESEKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEDIK*
Ga0181525_1089756213300014654BogENAMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQTAPPTVEKFSFDMSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNVGNHALMFYAASSEPGESDKVAYGRSYNRDIWHQPS*
Ga0181522_1035469213300014657BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGSHSLMFYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGSGKVEEIK*
Ga0181522_1046998213300014657BogMLVEQAANQTAPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTSKLNAGNHSLMLYAASSQPGESDKVAYGRAYNRDIIITKGQELKLKYTGPYRLLGSGSVEE
Ga0182027_1009413323300014839FenMKRSIFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEKSSFDVSTPGADVGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSEPGESDKVAYGRPYNKDIVITKDQELKLKYTGPYRLLGSGNVEETK*
Ga0182027_1013877333300014839FenMRGDVKMKIKIFMLFSGLMLMSLCGCLTTMISQQAANQAAPPKVQNFSFDVSKPGADVGTLFVQTRQPSYQMAVAKYAIKIDSNPVLVVEKQSDVTIKINAGKHSLKLYGTSDNPAESDKVVWGEPNKKDIVIAKDQVLKLKYTGPYRMFGAGNVEEIK*
Ga0182027_1022031913300014839FenSIFLLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEKSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSEPGESDKVAYGRPYNKVIVVTKDQELKLKYTGPYRLLGSGNVEEIK*
Ga0182027_1060375613300014839FenMKRNLFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSVEEIK*
Ga0182027_1070765123300014839FenMKNKLLMLSGGLMLLSVCGCVTSMLAEQAANQAAPPPVENFSFDVSTPGADAGTLTIQTRQPSYQAVVEKYAIKIDAGNPLVVSKQSDVTIKLNAGKHSLKLYAVSSNPADSEKASYGTPSSKDIVIAKNQELKLKFTGPYRLLGSGNVEDIK*
Ga0187818_1025484123300017823Freshwater SedimentMSLSGCVASMLSEQAANQVAPPTVEKFSFDVSTPGADVGTLIVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGNHSLKFYATSSNPAESDQVTFGEPNNKDIVIMKGQELRLKYTGPYRLLGSGNVEEIE
Ga0187856_115587423300017925PeatlandMKRKMFILVGALMLMSLCGCVTTMITEQAANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPSNKDIVITKGQELKLKYTGPYRLLGSGSIEEIE
Ga0187801_1017335523300017933Freshwater SedimentMKRNMFTLVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTPGADVGTLIVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDQVSFGEPNNKDIVITKGQERK
Ga0187803_1005352723300017934Freshwater SedimentMKRNMFTLVGGLMLMSLSGCVASMLSEQAANQVAPPTVEKFSFDVSTPGADVGTLIVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE
Ga0187808_1047324913300017942Freshwater SedimentLCGCVATMLTEQAANQAAPPKVENFSFDVSTPGADAGTLMVQTRQPSYQLVVEKYAIKIDTNAPLVVSKQSDVTIKLDAGKHALKFYATSSNPAESDRVTFGEPHKKDIVIIKDQELKLKYIGPYRLLGSGSLEEVK
Ga0187819_1021536823300017943Freshwater SedimentMQIKRNIFMLIGGLMLMSLCGCVASMLTEQAANQVAPPTVENFSFDQSTPGTDVGTLMVQTRQPSYQLAVDKYAIKIDSNPPLVVSKQSDVTIRLNAGKHSVKCYATSSNPAESEQATWGEPNTKDIVTTKGQELKLKYTGPYRLLGSGNVEEIK
Ga0187847_1008615923300017948PeatlandMLVSLCGCVTSMLVEQAANQTAPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSQPGESDKVAYGRAYNRDIIITKGQELKLKYTGPYRLLGSGSVEEIK
Ga0187779_1056246523300017959Tropical PeatlandMKRNLFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPEADAGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLSFYATSSNPSESDKVTFGKPYDKDIVITKDQELKLKYIGPYRLLGSGSVEEIK
Ga0187781_1040538823300017972Tropical PeatlandMKRSIFIIVSGLTLMSLCGCVASMLSEQAANQVAPPTVEKFTFDQSTPGADVGTLVVQTRQPSYQLAVDKYAIKIDSNPPLVVSKESDVTIKLNAGQHSLQFYATSSNPVESDKVTWGEPNKKDIVITKNQQLSLKYTGPYRLLG
Ga0187780_1087682223300017973Tropical PeatlandAGSLVFMFLSGCVTTMLTQQAANQVAPPKVENFSFDLSTPGADVGQLFVQFRQPTYQMLVDKYAVKIDSNPPLVVARQSDVNIKLNVGKHSLKFYAPSSEPGQVDKVAFGEPHKKDIIITKDQQLKLKYTGPYRLFGSGNVEVIQ
Ga0187777_1021106823300017974Tropical PeatlandMKRNLLMLVGGIVLMSLCGCVTAMLTEQAANQAAPPTPEEFSFDMSTPGAEIGTLMVQTRQPSYQLSVEKYAIKIDTNAPLVVAKQSDVTIKINAGEHALKFYATSSDPAQSDKVTFGRPHDQDIVITKDQELKLKYIGPYRLLGSGHVEEIK
Ga0187815_1041909613300018001Freshwater SedimentLTEQAANQAAPPTVEKFSFDVSTPGADVGTLKVQTRQPSYQLAVERYAIKIDANAPLVVSKQSDVTIKLNAGRHALKFYATSSDPAESNEVTFGEPHKKDIVITKDQELKLKYIGPYRLLGSGSVEEIK
Ga0187804_1000255123300018006Freshwater SedimentMKINIFVLLGGLVLTPLCGCVASMLAEQGANQVAPPTVEKFSFDVSTPGSDVGTLTVQTKQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTVKLNAGKHSLKFYATSSNPAESERVTFGEPNNKDVVITKDQELKLEYTGPYRLLGSGSVEEIN
Ga0187805_1019855913300018007Freshwater SedimentMLIGGLMLMSLCGCVASMLTEQAANQVAPPTVENFSFDQSTPGTDVGTLMVQTRQPSYQLAVDKYAIKIDSNPPLVVSKQSDVTIRLNAGKHSVKCYATSSAPTESEKVTWGEPSTTDIVITKGQELKLKYTGAYRYLGSGTLEVVE
Ga0187872_1016214223300018017PeatlandMKRKMFILLSGLMLMSLCGCVATMVTEQAANQVAPPTVDNFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKCYATSSNPAESDQVSFGEPSNKDIVITKGQELKLKYTGPYRLLGSGSIEEIE
Ga0187889_1039633213300018023PeatlandMKRNLFALAGGLMLMLLCGCVATMLSEQAANQAAPPTVEKFSFDVSTPGVDVGTLTVQTRQPSYQLAVEKYAIKIDTNAPLVVAKQSDVTIKLDAGKHALKFYATSSNPTESDQVTFGEPHKKDIVIIKDQELKLKYIGPYRLLGSGSLEEIK
Ga0187863_1014706823300018034PeatlandMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQTAPPTVEKFSFDMSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNVGNHALMFYAASSEPGENDKVAYGRSYNRDIVITKEQELKLKYTGPYRLLGSGKVEEIK
Ga0187863_1024286213300018034PeatlandMKIKIFMLFSGLMLMSLCGCVSTMVAQQAANQVAPPKVHNFSFDVSTPGSDVGTLFVQTRQPSYQMAVAKYAIKIDSNPPLVVEKQSDVTIKINAGKHSLKFYGTSDNPAESDKVVWGEPHKKDIVIAKDQVFKLKYTGPY
Ga0187863_1043476733300018034PeatlandMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSEPGESDKVAYGRSYNKDIVITKEQELKLKYTGPY
Ga0187875_1074734813300018035PeatlandRKIFMLLSGLMFISLCGCVTTMVSQQAANQVAPPKVQNFSFDVSQPGADAGTLFIQTRQPSYQMVVAKYAIKIDSNPPLVVEKQSDVTIKISAGKHSLKFYGTSDNPAESDKVVWGEPHKKDIVIVKDQVFKLKYTGPYRMFGSGNVEEIK
Ga0187871_1046877313300018042PeatlandMKRSPFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQSSFDVSTAGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGSHSLMFYAASSEPGESDKVAYGRSYNRDIWHQPS
Ga0187887_10002699103300018043PeatlandMLVSLCGCVTSLLVEQAANQAAPPTVEQSSFDVSTAGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIWHQPS
Ga0187851_1019617923300018046PeatlandMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQSSFDVSTAGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIWHQPS
Ga0187851_1040494613300018046PeatlandMSMKRSLFTLVSGLMLVSLCGCVTSMLVEQAANQTAPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSQPGESDKVAYGRAYNKAIVITKDQELKLKYTGPYRLLGSGKVEEI
Ga0187859_1064072023300018047PeatlandSLCGCVTTMVAQQAANQVAPPKVQNFSFDVSQPGVDVGTLFVQTRQPSYQMAVAKYAIKIDSNPPLVVEKQSDVTIKINAGKHSLKFYGTSDNPAESDKVVWGEPHKKDIVITKDQVLKLKYTGPYRMFGSGNVEEIK
Ga0187766_1077867623300018058Tropical PeatlandMKRNIVMLVGGLMLMSLCGCVTAMVAEQAANQAAPPPVENFSFDVSTPGADAGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLSFYATSSNPSESDKVTFGKPQNKDIVITTDQELKLKYIGPYRLLGS
Ga0187765_1003956153300018060Tropical PeatlandAGGLMLMSLCGCVTAMLTEQAANQAAPPTVEKFSFDVSTAGADAGTLSVQTRQPSYQLVVDKYAIKIDTNAPLVVAKQSDVTIKINAGEHALKFYATSSDPAQSDKVTFGRPHDQDIVITKDQELKLKYIGPYRLLGSGHVEEIK
Ga0187784_1013961233300018062Tropical PeatlandMKRSIFIIVSGLTLMSLSGCVASMLTEQAANQAAPPTVEKFSFDESTPGADAGTLIVQTRQPSYQLAVDKYAIKIDTNPPLVVSKESDVTIKLNAGQHSLQFYATSSNPVESDKVTWGEPNKKDIVITKNQQLSLKYTGPYRLLGSGSVEEIE
Ga0187773_1105378813300018064Tropical PeatlandMKRITLATFGGLTLVSLCGCVTATVTEQVANQLAPPTVEKFSFDLSTSGADVGTLTVQTRQPSYRLAVDRYAIKVDSSAPLVVATQSDVTIKLNAGAHSLKFYATSSDPAQSDKVSFGAPNTKDIV
Ga0187772_1053262013300018085Tropical PeatlandMKRNLFTLAGGLMLMLLCGCVATMLSEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVERYAIKIDTNAPLVVAKQSDVTIKLNAGQHALKFYATSSDPAESNEVTFGEPHTKDIVIAKDQELKLKYIGPYRLLGSGSLEEIK
Ga0187769_1098252523300018086Tropical PeatlandMKRNLFTLAGGLMLVSLCGCVATMLSEQAANQAAPPTVEKFSFDASTPGADVGTLSVQTRQPSYQLAVERYAVKIDNNAPLVVAKQSDVTIKLNAGQHTLKFYATSSDPAESNEVTFGEPHTKDIV
Ga0187769_1111592513300018086Tropical PeatlandMKRNLFTLAGGLMLMLLCGCVASMLSEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVSKYAIKIDTNAPLVVAKQSDVTIKLNAGQHALKFYATSSDPTESNEVTFGEPHTKDIVIAKDQELKLKYIGPYRLLGS
Ga0187769_1149904513300018086Tropical PeatlandGCVTTMLTEQAANQAAPPTVEKFSFDMSTPGADVGTLSVQTRQPSYQLAVERYAIKIDTNAPLVVAKQSDVTIKLNAGKHALKLYAASSDPAESNEVTFGEPHKKDIVIAKDQELKLKYIGPYRLLGSGSLEEIK
Ga0187771_1096122313300018088Tropical PeatlandMKRNLFTLAGGLMLVLLCGCVTTMLTEQAANQTAPPTVEKFSFDMSTPGADVGTLMVQTRQPSYQLAVERYAIKIDTNAPLVVSKQSDVTIKLNAGQHALKFYATSSDPAESNEVTFGEPHTKDIVIAKDQELKLKYIGPYRLLGS
Ga0187771_1159977013300018088Tropical PeatlandTMVAEQAANQAAPPTVEKFSFDVSTPGADVGMLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGNHSLKFYATSSNPAESNQVTFGEPNNKDIVITKGQELRLKYTGPYRLLGSGSVEEIE
Ga0187770_1020377223300018090Tropical PeatlandMKRNLFTLAGGLMLMLLCGCVASMLSEQAANQAAPPTIEKFSFDVSTPGADVGTLMVQTRQPSYQLAVSKYAIKIDTNAPLVVAKQSDVTIKLNAGKHALKLYATSSDPAESNEVTFGEPHTKDIVIAKDQELKLKYIGPYRLLGSGSLEEIK
Ga0187770_1080812513300018090Tropical PeatlandMKRSLFTLAGGLMLMSLCGCVATMLSEQAANQAAPPTIEKFSFDVSTPGVDVGTLMVQTRQPSYQLAVERYAIKIDTNAPLVVAKQSDVTIKLNAGQHALKFYATSSDPAESDQVTFGEPHKKDIVIAKDQELKLKYIGPYRLLGSGSLEEIK
Ga0187800_139337913300019278PeatlandVASMLTEQAANQVAPPTVENFSFDQSTPGTDVGTLTVQTRQPSYQLAVDKYAIKIDSNPPLVVSKQSDVTIKVNAGKHSVKCYATSSNPAESEQATWGEPNTKDIVMAKGQELKLKYTGAYRYLGSGSLEEIE
Ga0182022_105706413300019785FenMKRNRFMLVGGLMLMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLLVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSLEEIK
Ga0236339_124332513300022650FreshwaterMKRNFVMLVGGLMLMFLCGCVTSMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNASLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSLEEIK
Ga0256681_1005018413300023311FreshwaterMKRNFVMLVGGLMLMFLCGCVTSMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPHNKDIVITKDQELKLKYIGPYRLLGSGSVEEIK
Ga0208199_101784833300027497Peatlands SoilANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDHVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE
Ga0208042_100167583300027568Peatlands SoilMKRKMFILLGGLMLMFLCGCVASMLTEQAANQVAPPTVDKFSFDVSTPGADVGTLMVQTRQPSYQLVVDKYAIKIDSNAPLVVSKQSDVTIKVNAGKHSLKCYATSSNPAESDHVSFGEPNNKDIVITKGQELKLKYTGPYRLLGSGSVEEIE
Ga0209286_132836213300027713Freshwater SedimentMQTKRNAFMLAGGLMLVALGGCVATMVGEQAANQVAPPQVETFSFDVSTPGASVGTLMVQTRQPSYQLAVEKYAIKIDSHAPLVVSKQSDVTIRLNAGRHALSFYATASDPAESEKVTFGKPYDKDVVIANNEVLKLRFTGPYRLLGSGDVEEIK
Ga0209048_1001886313300027902Freshwater Lake SedimentMLVGGLMVMSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNASLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVTFGKPYNKDIVITKDQELKLKYIGPYRLLGSGSVEEIK
Ga0209048_1002613763300027902Freshwater Lake SedimentMKRNIFMLVGVLMLMSLCGCVATMLTEQAANQAAPATVEKFSFDVSTPGADVGTLMVQTRQPSYQMSVDKYAIKIDSNAPLVVSKQSDVTIKLNAGKHSLKFYATSSNPAESDTVTFGAPNNKDIVVTNNRELKLKYIGPYRLLGSGSVEEIK
Ga0265337_104740223300028556RhizosphereMKRSIITLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265319_108871323300028563RhizosphereMKRSIITLVSGLMLVSLCGCVTSLLVEQAANQAAPPTVEQFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIVITK
Ga0265334_1006510623300028573RhizosphereMKRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSEPGESDKVAYGRSYNRDVVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265334_1030029223300028573RhizosphereMKRSIITLVSGLMLVSSCGCVTSLLVEQAANQAAPPTVEQFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIVITKDQEL
Ga0265318_1011749213300028577RhizosphereMKRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGKHSLMFYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265323_1027404613300028653RhizosphereMKRIIFVIASSFVLISLCGCVSTMLCQQTASVVAPPKVEKASFDVSTPGSDAGQLFVQFRQPTYRMLVDKYAVKIDSNPPLVVPRQSDVDIKLNAGKHTLKFYAPSSVPGQVDKVAYGQPSKKDIVITKDQQLKLKYTG
Ga0265338_1001181563300028800RhizosphereMLVSLCGCVTSLLVEQAANQAAPPTVEQFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265338_1014180023300028800RhizosphereMKRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265338_1037193513300028800RhizosphereMKRSTFTLVSGLILVSLCGCVTSLLVEQAANQTAPPTVEKSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHALMFYAASSQPGESDKVAYGRAYNKEIVITKDQELKLKYTGPYRLLGSGNVEEIK
Ga0302200_1010319723300028909BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQTVPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLTFYAASSQPGESDNVAYGRAYNKAIVITKDQELRLKYTGPYRLLGSGKVEEIK
Ga0311361_1023112133300029911BogMKRSLFTLVSGLMLVSLCGCVTSLLVEQAANQTVPPTVVKSSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLTFYAASSQPGESDNVAYGRAYNKAIVITKDQELRLKYTGPYR
Ga0311336_1082498323300029990FenMKRNIFMLVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVAIKLNAGKHSLKFYATSSNPAESEKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVEDIK
Ga0302271_1054281513300029998BogMKRYIFILVSAFMLMSLCGCVATMLTEQAANQAAPPTVEKFNFDISMPGADVGTLIVQTRQPSYQLLAVDKYGIKIDSNAPLVVSKQSDVTIKLNTGKHSLKFYATSANPAESEKTTFGRPHNKDIFITKDQALKLKYIGPYRLLGSGSVEEIK
Ga0311350_1064676523300030002FenMKRNIFMLVGGLMLMSLCGCVASMLTEQAANQVAPPTVEKFSFDVSTPGADVGTLMVQTRQPSYQLAVDKYAIKIDSNAPLVVSKQSDVAIKLNAGKHSLKFYATSSNPAESEKVTFGEPHNKDIVITKDQELKLKYIGPYRLLGSGSVE
Ga0311348_1097913113300030019FenMKRYIFILVSGFMLMSLCGCVATMLTEQAANQAAPPTVEKFNFDISMPGADVGALIVQTRQPSYQLLAVDKYAIKIDSNAPLVVSKQSDVTIKLNTGKHSLKFYATSANSAESEKTTFGRPHNK
Ga0311333_1069014413300030114FenMKRYIFILVSAFMLMSLCGCVATMLTEQAANQAAPPTVEKFNFDISMPGTDVGTLIVQTRQPSYQLLAVDKYAIKIDSNAPLVVSKQSDVTIKLNTGKHSLKFYATSANPPESEKTTFGRPHNKDIVITKDQALKLKYIGPYRLLGSGSVEEIK
Ga0265320_1049027213300031240RhizosphereRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSEPGESDKVAYGRSYNRDVVITKDQELKLKYTGPYRLLGSGKVEEIK
Ga0265325_1012969313300031241RhizosphereMKRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGKHSLMLYAASSEPGESDKVAYGRSYNRDIVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0265339_1047118913300031249RhizosphereMKRSTFTLVSGLILVSLCGCVTSLLVEQAANQTAPPTVEKSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHALMFYAASSQPGESDKVAYGRAYNKEIVIT
Ga0265316_1001839783300031344RhizosphereMKRSIFTLVSGLILVSLCGCVTSLLVEQAANQTAPPTVEKSSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMFYATSSQPGESDKVAYGRPNNKVIVITKDQELKLKYTGPYRLLGSGKVEEIK
Ga0265316_1085656213300031344RhizosphereMKRSLFTLVSGLMLVSLCGCVTSVLVEQTANQAAPPTVEKFSFDVSTPGADAGTLMVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHSLMLYAASSEPGESDKVAYGRSYNRDVVITKDQELKLKYTGPYRLLGSGKVEEIK
Ga0302320_1026014323300031524BogMKRSLFTLVSGLMLVSLCGCVTSVLVEQAANQTAPPTVEKFSFDVSTPGADAGTLTVQTRQPSYQISFDRYAIKIDTNAPLVVAKQSDVTIKLNAGNHALMFYAASSEPGESDKVAYGRSYNRDVVITKDQELKLKYTGPYRLLGTGKVEEIK
Ga0335085_1027134313300032770SoilMKRNILTLVGGLMLMSLSGCVTAMLTEQAANQATPPTVENFSFDISTPGADAGTLMLQTRQPSYQLSVAKYAIKIDTNAPLVVSKQSDVTVKLDAGKHSLKLYATSSDPTECEKVTYGRANTKEIVVTKDQELNLKYTGPYRLLGSGTVKEID
Ga0335079_1084364313300032783SoilMKRNLLTLAGGSMLMLLCGCVASMISEQAANQAAPPTVENFSFDVSTPGADVGTLSVQTRQPSYQLAVERYAIKIDTNAPLVVARQSDVTIRLNAGQHALKLYATSSNPAESDQVTFGEPHKMDIVIIKDQELKLKYIGPYRLLGSGSLEEIK
Ga0335078_1018641913300032805SoilMKRNILTLVGGLMLMSLSGCVTAMLTEQAANQATPPTVENFSFDISTPGADAGTLMLQTRQPSYQLSVAKYAIKIDTNAPLVVSKQSDVTVKLDAGKHSLKLYATSSDPTESEKVTYGRANTKEIVVTKGQELNLKYTGPYRLLGSGTVKEID
Ga0335078_1049185023300032805SoilMKRNLFKLAGGLMLMSLCGCVTTMLTEQAANQAAPPTVDKFSFDVSTPGADVGTLTVQTRQPSYQLAVERYAIKIDTNAPLVVSKQSDVTIKLNAGQHALKFYATSSNPAESDQVTFGEPHKKDIVITKDQELKLKYIGPYRLLGSGSVEEMK
Ga0335078_1102035623300032805SoilMKRNLFTLAGGLMLMCLCGCVATMLSEQAANQAAPPTVETFSFDVSTPGADAGTLSVQTRQPSYQLAVARYAIKIDTNAPLVVPKQSDVTIKLDAGQHALKFYATSSNPAESDQVTFGETHKK
Ga0335078_1229909313300032805SoilMKRIIIMLVGGLMLVSSGGCVTSMLTEQAANQAAPPTVEKFSFDVSTPGADVGTLIVQTRQPSYQLAVSKYAIKIDSHAPLVVSKQSDVTIKLDAGNHALKFYATSSDPAQSEEVTFGEPHHKDIVITKDQELKLKYTGPYRL
Ga0335081_1217945013300032892SoilPMKRNLLMPVGGIVLMSLCGCVTAMLTEQAANQAAPPTTETFTFDVSTPGAEVGTLLIQTRQPSYQLSVEKYAIKIDTHAPLVVAKQSDVTIRLNAGEHALKFYATSSDPAESDKVTFGRPHDKDVVITKDQELKLKYIGPYRLLGSGHVEEIN
Ga0335069_1099428723300032893SoilTEQATNQAAPPTVEKVSFDVSTPGADAGTLMIQTRQPSYQMLAGEKYAIKIDTNAPLLVARQSDVTIKLDAGKHSLKLYSASANPADSEKIAYGEPNKKDVVIEKDQELKLKYTGAYRAFGAGNLEAMK
Ga0335071_1070986033300032897SoilMKRNIFLLAGGLMLLSLCGCVTAMISEQAANQAAPPTVENFAFDVSTPGADAGALMIQTRQPSYQLAVEKYAIKIDSNAPLVVSKQSDVTIKLNAGNHSLKFYATSSNPAESENVTFGEPHKKDVVIAKG
Ga0335071_1137934313300032897SoilSLCGCVTAMVAEQAANQAAPPTVEKFSFDVSTPGADLGTLMVQTRQPSYQLAVDKYAIKIDSNASLVVSKQSDVTIKLNAGAHSLNFYATSSNPAESDKVAFGKPYNKDIVITKDQELKLKYIGPYRLLGSGSIEEIK
Ga0335072_1082570313300032898SoilMKQNLFTLVGALILMSLCGCVTAMLTEQAANQAAPPTVEKFSFDVSTPGADAGTLNVQTRQPSYQLAVERYAIQIDTNAPLVVAKQSDVTIKLNAGNHALKFYATSSNPAESEQVTFGEPHKKDIVITKDQELKLKYIGPYRLLGSGSLEEIK
Ga0335076_1070529023300032955SoilAANQAAPPTVETSSFDVSTPGADVGTLMIQTRQPSYQLAVERYAIKIDTNAPLVVARQSDVTIRLNAGQHALKLYATSSNPAESDQVTFGEPHKMDIVIIKDQELKLKYIGPYRLLGSGSLEEIK
Ga0335073_1016276343300033134SoilSLCGCVTAMLTEQAANQAAPPTVEKFSFDVSTPGADAGTLNVQTRQPSYQLAVERYAIQIDTNAPLVVAKQSDVTIKLNAGNHALKFYATSSNPAESEQVTFGEPHKKDIVITKDQELKLKYIGPYRLLGSGSLEEIK
Ga0326728_1005213253300033402Peat SoilMKRNLFTLAGGLMLMSLCGCVATMLTEQAANQAAPPTVEKFSFDASTPGADVGTLMVQTRQPSYQLAVEKYAIKIDTNAPLVVAKQSDVTIKLNAGKHALKFYATSSDPAESDKVTFGEPHKKDIVIIKDQELKLKYIGPYRLLGSGSVEEIK
Ga0326727_1076067323300033405Peat SoilMLTEQAANQTAPPTVVNFSFDVSMPGTDVGTLMVQTRQPSYQLAVSKYAIKIDTNAPLVVSKQSDVTIKLNAGKHSLKFYATSSDPAESDKVTFGEPHNKDIVITKDQEIKMKYIGPYRLLGSGSVEEIK
Ga0326726_1004216653300033433Peat SoilMKRNIFILVGGLMLVSLCGCVTALVTEQAANQVAPPTVERFSFDVSTLGTDVGTLMVQTRQPSYRLAVDKYAIKIDSNAPLVVSPQSDVAIKLNAGKHSLKFYATSSNPAESNKVTFGEPDNKDVVITKDQELKLKYIGPYRLFGSGSVEDIK
Ga0316620_1060176013300033480SoilMQTKRNAFMLAGGLMLVALGGCVATMVGEQAANQVAPPQVETFSFDVSTPGASVGTLMVQTRQPSYQLAVEKYAIKIDSHAPLVVSKQSDVTIRLNAGRHAVSFYATASDPAESEKVTFGKPYNKDVVITNNEVLKLRFTGPYRLLGSGDVEEIK
Ga0326723_0058001_879_13463300034090Peat SoilMQMKRNIFILVGGLMLVSLCGCVTALVTEQAANQVAPPTVERFSFDVSTLGTDVGTLMVQTRQPSYRLAVNKYAIKIDSNAPLVVSPQSDVAIKLNAGKHSLKFYATSSNPAESNKVTFGEPDNKDVVITKDQELKLKYIGPYRLFGSGSVEDIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.